DESIGN AND USE OF SPECIFIC REGULATORY T-CELLS TO INDUCE IMMUNE TOLERANCE
20190203174 ยท 2019-07-04
Assignee
Inventors
Cpc classification
A61K39/4611
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
C12N5/0637
CHEMISTRY; METALLURGY
A61K39/46433
HUMAN NECESSITIES
A61K2039/57
HUMAN NECESSITIES
A61K39/0008
HUMAN NECESSITIES
A61K39/46434
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
Abstract
The present invention generally relates to the production of antigen-specific T regulatory cells (Tregs). Such cells can be used in therapy to minimize undesirable immune responses such as those observed in autoimmunity and hemophilia and other diseases as well as in the response to protein therapy for genetic diseases. Methods for producing antigen specific Tregs and conditions for preferential expansion of functionally stable, specific Tregs are also provided.
Claims
1.-19. (canceled)
20. A method for producing an antigen specific T regulatory cell comprising: transducing a T cell with an expression vector comprising a nucleotide sequence encoding a T cell receptor that specifically recognizes an antigen, and expanding the transduced T cells ex vivo.
21. The method of claim 20, wherein the step of transducing a T cell comprises transducing an HLA matched restricted natural T regulatory cell.
22. The method of claim 20, wherein the step of transducing comprises transducing a cell with an amphotrophic packaging retrovirus.
23. The method of claim 20, wherein the T cell is obtained from a donor's buffy coat prior to being transduced.
24. The method of claim 20, wherein the T cell is subjected to a stimulation step prior to being transduced.
25. The method of claim 20, wherein the antigen is selected from the group consisting of the C2 domain of human clotting factor VIII, myelin basic protein (MBP), and an antigen associated with diabetes, or uveitis.
26. The method of claim 25, wherein the T cell receptor specifically recognizes the c2 domain of human clotting factor VIII and has the amino acid sequence of SEQ ID NO:1.
27. The method of claim 25, wherein the T cell receptor specifically recognizes myelin basic protein (MBP) and has the amino acid sequence of SEQ ID NO: 2.
28. A method for expanding a T regulatory cell and/or T effector cell transduced with a T cell receptor-encoding sequence, the method comprising culturing the cell in IL-2 containing RPMI1640 media with 10% fetal bovine serum for up to 4 days.
29. A method for expanding a functionally stable T regulatory cell transduced with a T cell receptor-encoding sequence, the method comprising culturing the cell in the presence of the specific antigen recognized by the T cell receptor and further in the presence of oligodeoxynucleotides, irradiated DR1 HLA-typed peripheral blood mononuclear cells, and IL2.
30. The method of claim 29, wherein the cell is cultured for about 21 days.
31. An antigen specific T regulatory cell prepared by a method according to claim 20.
32. A method of reducing an immune response to an antigen, comprising administering to a subject in need thereof a composition comprising an antigen specific T regulatory cell according to claim 31 that is specific to the antigen.
33. The method of claim 32, wherein the subject is suffering from a disease selected from the group consisting of hemophilia, multiple sclerosis, diabetes, and uveitis.
34. The method of claim 32, wherein the subject has received a biotherapeutic treatment for a genetic disease selected from the group consisting of Pompe's and hemophilia.
35. An antigen specific T regulatory cell according to claim 31 for use in reducing an immune response to an antigen.
36. A retroviral construct comprising variable regions (V and V) encoding a T cell receptor specific for an antigen, human constant regions (C and C), a reporter sequence, and an intra ribosome entry site (IRES), wherein the T cell receptor is linked to the reporter via the IRES.
37. The retroviral construct of claim 36, wherein the antigen is selected from the group consisting of clotting factor FVIII, MBP, MOG, S-antigen and GAD-65.
38. The retroviral construct of claim 37, further comprising a P2A cleavage peptide inserted between the V and V variable regions.
39. The retroviral construct of claim 37, wherein the variable regions are from a FVIII-2191-2220 specific T effector clone.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013]
[0014] (A) Scheme of FVIII-2191-2220-specific TCR cloning from a hemophilia A subject's T-cell clone. The cloning procedure is described in Materials and Methods. Briefly, to amplify TCR cDNA from the clone, poly C oligonucleotide was linked onto the 3 terminus of total cDNAs by terminal deoxynucleotidyl transferase (TdT). The variable region was amplified using semi-nested PCR with a poly GI primer and two reverse primers (pC1 and pC2) corresponding to two different 5 upstream coding regions of the and chain constant regions. The figure discloses TTTTTTTTTT as SEQ ID NO: 8.
[0015] (B) Amplification of V regions of the 17195TCR using semi-nested PCR. Primary amplification and nested amplification were carried out with pC1 and pC2 (
[0016] (C) Retroviral expression construct of the FVIII-2191-2220-specific TCR. To build the FVIII-2191-2220-specific TCR, the variable regions (V and V) from the FVIII-2191-2220-specific T effector clone were combined with human constant regions (Ca and C(3) extracted from the NCBI database. To produce the individual a and (3 TCR chains from a single transcript, a P2A cleavage peptide was inserted between the and chain sequences. Expression of the GFP reporter is controlled by IRES, which is located downstream of the TCR construct. The figure discloses SEQ ID NOS 9 and 10, respectively, in order of appearance.
[0017] (D) Amino acid sequence of a FVIII C2-specific human T cell receptor (TCR17195).
[0018]
[0019] (A) Proliferation of 17195TCR-transduced CD4 T cells with FVIII-2191-2220. Pre-stimulated primary CD4 T cells were transduced with 17195 TCR or with a mock vector and maintained for 10 days in culture media supplemented with IL-2. For proliferation assays, cells were labeled with cell proliferation dye (eFluor 450) and then re-activated with irradiated DR1-PBMCs plus peptide FVIII-2191-2220 (0.5 g/ml), pOVA (0.5 g/ml), or anti-CD3 antibody (0.5 g/ml) for 4 days. Cell proliferation was measured by flow cytometry using a standard dye dilution assay. Representative results are shown for CD4 cells from two different donors that were transduced with 17195TCR.
[0020] (B) Staining of transduced, expanded GFP 17195 T effectors shown in (A) using PE-labeled DRI tetramers loaded with FVIII-2191-2220.
[0021] (C) Proliferation of GFP.sup. and GFP.sup.+ T cell effectors stimulated with OVA peptide, FVIII-2191-2220 or anti-CD3 antibody. Transduced T effectors (210.sup.6/well) were stimulated using irradiated DR1-APCs (Responder:Stimulator=1:5) as in (A). After culturing for 10 days, The cells were harvested and, viable GFP.sup. and GFP.sup.+ CD4 cells were counted using flow cytometry.
[0022] (D) Retroviral expression of 17195 TCR in CD4 T nave and CD4 Treg cells. Nave T cells were pre-stimulated in plate-bound anti-CD3 antibody and anti-CD28 antibody for 48 hrs. Then, these cells were transduced in virus-coated plate for 24hrs. Expression of GFP and staining with FVIII peptide/DR1 tetramer was performed by FACS analysis at 3 days after transduction of 17195TCR.
[0023] (E) Cell surface expression of 17195 TCR in transduced T cells (10 day-cultured). Expression of retroviral 17195 TCR was measured by flow cytometry with anti-V2 versus GFP.
[0024] (F) FVIII peptide-specific induction of Treg-specific surface markers in transduced Tregs. Two week-expanded mock and 17195 Tregs (transduction followed as in
[0025]
[0026]
[0027] (A) FVIII-2191-2220-specific enrichment of transduced Foxp3.sup.+Helios.sup.+ Tregs via long-term expansion. After a 2n.sup.d round of expansion (described in
[0028] (B) Comparison of FVIII-2191-2220-specificity and Fox3.sup.+Helios.sup.+ phenotypes for short-term and long-term expanded 17195TCR-Tregs. First-round expanded (Exp) cells (1.sup.st Exp) were harvested 8 days after viral transduction and second-round expanded cells (2.sup.nd Exp) were harvested 16 days after transduction. Tetramer staining (to determine FVIII-2191-2220 specificity) and intracellular FACS staining (to quantify Foxp3 and Helios expression) were performed as in
[0029] (C) Plasticity of long-term expanded 17195TCR-Tregs and Treg phenotype stability induced by antigen. Second-round expanded 17195TCR-transduced Tregs were rested for 3-days of culture without IL-2 and then re-stimulated for 4 hrs with PMA and ionomycin in the presence of Golgi-block reagent. Intracellular IFN (top contour plots and graph) and IL-2 (bottom contour plots and graph) production were measured by FACs analysis.
[0030] (D) DNA methylation of TSDR in long-term expanded 17195TCR Tregs with FVIII-2191-2220 plus ODN. To analyze DNA methylation in the TSDR, mock-transduced and 17195TCR-transduced Tregs were expanded with anti-CD3 antibody or FVIII-2191-2220 in the presence of ODN, as in
[0031]
[0032] (C) Suppression of FVIII-specific cytokine secretion by 17195TCR-Tregs. Four week-expanded mock-transduced Tregs or 17195TCR-Tregs were mixed with 17195TCR-T effectors (responders) at the indicated ratios with y-irradiated DR1-PBMCs and rFVIII (0.2 g/ml) and cultured for 36 hrs without IL-2. Cytokines in culture media were measured using a human Th1, Th2, Th17 CBA kit (BD Bioscience). The quality of the mock-transduced and 17195TCR-transduced Tregs was evaluated by measuring their GFP expression (left panels) and the expression of Foxp3 and Helios in the GFP cells (right panels). Raw MFI data from the CBA assays were converted to cytokine concentrations according to standard curves generated for each experiment. Data are presented as meanSD.
[0033]
[0034] Pooled splenocytes from two immunized DR1/E16-FVIII-KO mice were used as T-responders. In a T25 flask, 110.sup.7 splenocytes were co-cultured with 17195TCR-transduced or mock-transduced Tregs at different ratios in the absence/presence of 1 g/ml rFVIII. After 6 days in culture, FVIII-specific antibody secreting cells (ASC) were detected using an ELISPOT assay as described in Methods.
[0035] (A) FVIII-specific ASC detected in splenocyte cultures that contained no TCR- or mock-transduced Tregs.
[0036] (B) FVIII-specific ASCs detected in splenocytes co-cultured with various ratios of 17195TCR-transduced or mock-transduced Tregs. Co-culture with 17195TCR-Tregs profoundly inhibited anti-FVIII ASC formation, even with responder to suppressor ratios as low as 1:0.0625 (1/16). The histograms in (C) and (D) summarize the ELISPOT data in (A) and (B), respectively. Data are presented as meanSEM. (E) The quality of the Tregs used in these experiments was evaluated by measuring their GFP expression (left panels) and the expression of Foxp3 and Helios in the GFP cells (right panels).
[0037]
[0038]
[0039]
[0040] Pre-stimulated Treg cells (CD4+CD25hiCD127lo) were transduced with retroviral 17195 TCR and then 1st round expanded for 8-10 days with three different stimuli: anti-CD3e antibody, FVIII peptide, or FVIII peptide plus oligonucleotide (FVIII peptide/ODN) in the presence of irradiated DR1 PBMCs and IL-2 (200 U/ml). For 2nd round expansion culture, the cells were rested in the media without IL-2 for 48-72 hrs. The stimulating and culturing condition for 2nd expansion was identical with 1st expansion. After 2nd expansion, the expanded cells were rested for 48 hrs in the absence of IL-2 for further experiments. To monitor the quality of each grouped 17195 Tregs, FVIII peptide/DR1 tetramer staining and intracellular staining of Foxp3 and Helios were performed every 5 days during the expansion culture.
[0041]
DETAILED DESCRIPTION
[0042] Described herein are methods of producing specific human T regulatory cells (Tregs), useful, for example, to reduce undesirable immune responses in conditions such as autoimmunity, including hemophilia, type 1 diabetes, uveitis and multiple sclerosis, as well as in the response to protein therapy for genetic diseases. As used herein the term specific Tregs designates Tregs that respond to a specific antigen and inhibit effector T cells that are reactive to a specific antigen.
[0043] Specific embodiments of the methods are illustrated as follows: T cell receptors (TCR) from a patient with an autoimmune disease (such as, for example, a hemophilia A patient) are cloned. TCRs can be cloned according to procedures known in the art, including those described in Nature Medicine, 19(11) 1534-41 (2013) and Nature Medicine, 19(11) 1542-46 (2013). Stimulated patient's polyclonal T cells are transduced with the TCRs, thus rendering the expanded cells antigen specific. When the polyclonal Tregs, isolated from peripheral blood, are stimulated under conditions that lead to non-specific Tregs, the cells can then be transduced to become antigen-specific Tregs, capable of specifically suppressing the undesirable immune response to the antigen.
[0044] T cells previously have been rendered specific for cancer antigens (CAR's) to specifically destroy cancer cells (turn on immunity). However, the methods described herein produce specific Tregs to modulate (turn off) undesirable immune responses, e.g., to reduce an immune response. The present inventors have now obtained io definitive evidence that specific Tregs can be produced using the methods described herein, and that the resulting Tregs are functionally active to inhibit effector T cells that are reactive to a specific antigen (e.g., an FVIII peptide). By expressing a specific TCR directed to a specific antigen, (e.g., human clotting factor VIII, MBP, MOG, GAD65, S-Antigen, or other target), a patient's Tregs can be made specific and used for immunotherapy of the associated disease.
[0045] In addition, the methods described herein provide for the first time a protocol for preferential expansion of functionally stable, specific Tregs using specific antigen and oligonucleotide components. The methods therefore are useful for producing Tregsin a cellular therapy to treat, for example, hemophilia patients who are prone to making antibodies against FVIII. Further, the methods can be applied to other diseases associated with undesirable immune responses, such as type I diabetes, multiple sclerosis, uveitis, and other conditions of autoimmunity, or undesireable immune response to protein therapy.
[0046] Thus, described herein are methods for developing antigen-specific T regulatory cells (Tregs), which can be used to treat or minimize unwanted immune responses, such as those that occur in autoimmune diseases and in protein therapy for genetic diseases. Conditions for preferential expansion of functionally stable, specific Tregs using specific antigen and oligonucleotide components also are described.
[0047] In accordance with one aspect, there is provided a method for producing antigen specific T regulatory cells comprising transducing T cells with an expression vector comprising a nucleotide sequence encoding a T cell receptor that specifically recognizes the antigen, and expanding the transduced T cells ex vivo. In some embodiments, the T cells are expanded ex vivo to obtain a greater number of functional Tregs and without experiencing functional loss.
[0048] In some embodiments, the T cells are obtained from a donor's buffy coat by, for example, FACS sorting (FACSAria, BIC, USUHS) CD4+CD25CD45RA+ for T nave cells and CD4+CD25.sup.hiCD127.sup.lo for Treg cells, prior to being transduced. In some embodiments a pre-stimulation step precedes the transduction step. For example, cells may be pre-stimulated with plate-coated anti-CD3 antibody and plate-coated anti-CD28 antibody for 36 to 48 hours.
[0049] In accordance with any of the foregoing embodiments, transducing the T cells may comprise transducing HLA DR1 restricted natural T regulatory cells and/or effector T cells. In some embodiments, the transducing comprises transducing pre-stimulated cells with an amphotrophic packaging retrovirus containing a sequencing encoding a T cell receptor. In specific embodiments, the T cell receptor is specific for clotting factor FVIII. In further specific embodiments, the cells are transduced with an amphotrophic TCR-17195 packaging retrovirus designated TCR-17195-IRES-GFP (i.e., a retroviral construct comprising a sequence encoding the TCR-17195 linked with green fluorescent protein (GFP) expression via intra ribosome entry site (IRES)).
[0050] In accordance with any of the foregoing embodiments, the transduction protocol may involve transduction with retroviral culture supernatant in retronectin-coated plates.
[0051] In some embodiments, after transduction by viral particles, expressed TCR can be detected flow cytometry based on GFP expression.
[0052] In specific embodiments, expansion of transduced Treg or T effector cells may be carried out in IL-2 containing RPMI1640 media with 10% fetal bovine serum (FBS) for up to 4 days.
[0053] In specific embodiments, the expansion step of specific Tregs is conducted in accordance with oligonucleotide technology as disclosed in Kim et al., Oligodeoxynucleotides stabilize Helios-expressing Foxp3+ human T regulatory cells during in vitro expansion, Blood 2012 Mar. 22; 119(12):2810-8. doi: 10.1182/blood-2011-09-377895. Epub 2012 Jan. 31, incorporated herein by reference in its entirety. For example, a 25mer DNA oligonucleotide of random composition may be added during the expansion of Tregs in vitro to prolong stabilization of the Foxp3.sup.+Helios.sup.+ subpopulation and to yield a population particularly suitable for use in cellular biotherapy. In the oligonucleotide treatment protocol in the long term expansion of antigen-specific Tregs, expanded Tregs express almost the same level of Foxp3 and Helios as freshly isolated Tregs. Moreover, oligonucleotide treatment maintains demethylation status of Treg-specific demethylation region (TSDR) in the expanded Tregs.
[0054] In some embodiments the T cells are subjected to a stimulation step prior to being transduced, and then subjected to an expansion step after transduction.
[0055] In some embodiments, the antigen for which the antigen-specific T regulatory cells and/or T effector cells are specific is selected from the group consisting of the C2 domain of human clotting factor VIII (FVIII) or an antigen associated with multiple sclerosis, type I diabetes, uveitis, or other diseases.
[0056] An exemplary sequence of a FVIII C2-specific human T cell receptor (TCR17195) is the 620 amino acid sequence of SEQ ID NO:1 below:
TABLE-US-00001 (SEQIDNO:1) RQVARVIVFLTLSTLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYIT WYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTA VYYCLVGDAPNSGNTPLVFGKGTRLSVIANIQNPDPAVYQLRDSKSSDKS VCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDF ACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFR ILLLKVAGFNLLMTLRLWSSRAKRGSGATNFSLLKQAGDVEENPGPMLLL LLLLGPGSGLGAVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFP KKSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAQPEDSS FYICSAHTRANYGYTFGSGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQ KATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYC LSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA WGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRK DF
[0057] In another embodiment, the antigen for which the antigen-specific T regulatory cells and/or T effector cells are specific is selected is an antigen associated with multiple sclerosis. An exemplary sequence of a Ob.2F3-specific human T cell receptor is the amino acid sequence of SEQ ID NO:2 below:
TABLE-US-00002 ETLLGVSLVILWLQLARVNSQQGEEDPQALSIQEGENATMNCSYKTSINN LQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRA ADTASYFCATDTTSGTYKYIFGTGTRLKVLANIQNPDPAVYQLRDSKSSD KSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKS DFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIG FRILLLKVAGFNLLMTLRLWSSRAKRGSGATNFSLLKQAGDVEENPGPML LLLLLLGPGISLLLPGSLAGSGLGAVVSQHPSWVICKSGTSVKIECRSLD FQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLS TLTVTSAHPEDSSFYICSARDLTSGSLNEQFFGPGTRLTVLEDLNKVFPP EVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTD PQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEW TQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLY AVLVSALVLMAMVKRKDF
[0058] Also described herein is a protocol for preferential expansion of functionally stable, specific Tregs using specific antigen and, optionally, oligonucleotide components as described above. This protocol comprises gamma-irradiated DR1-HLA typed PBMCs as antigen presenting cells (6000 rad by Co60) and recombinant IL2 as a growth factor in the media.
EXAMPLES
Identification of FVIII-Specific TCR
[0059] The cloning strategy for the FVIII-specific TCR from a hemophilia A T effector clone is shown in
Isolation, Transduction, and Expansion of TCR-Transduced T Effectors and Tregs
[0060] Buffy-coat fractions from healthy 20-70-year-old males were provided by the Department of Transfusion Medicine at the National Institutes of Health (NIH) or purchased from the American Red Cross. All procedures were approved by the USUHS Institutional Review Board, and all blood donors provided written informed consent in accordance with the Declaration of Helsinki. To obtain CD4 T-nave and Treg cells, peripheral blood mononuclear cells (PBMC) were isolated from buffy coats by ficoll separation (Ficoll-Paque Plus, GE Healthcare). CD4 T cells were enriched by positive selection with MACS (Miltenyi Biotech, Auburn, CA). Nave CD4 T cells (CD4.sup.+CD25.sup.CD127.sup.+CD45RA.sup.+) and Tregs)(CD4.sup.+CD25.sup.hiCD127.sup.lo) were then sorted on a FACSAria (BD Biosciences).
[0061] For transduction of 17195TCR, T-nave cells or Tregs (210.sup.5/ml) were stimulated with plate-coated anti-CD3 (5 g/ml) and anti-CD28 antibodies (2 g/ml) for 48-72 hrs plus recombinant human IL-2 (200 U/ml). Stimulated cells were transferred into 17195 TCR viral particle-coated, retronectin (10 g/ml)-pretreated plates and incubated for 24 hrs. After transduction, the cells were expanded for 3-5 weeks with 6000r gamma-irradiated HLA-DRB1*01:01 (abbreviated hereafter as DR1) PBMCs and peptide FVIII-2191-2220 (0.2-0.5 g/ml) plus IL-2 (200 U/ml). Irradiated PBMCs (PBMC:T cells=2:1) and FVIII-2191-2220 (0.5 g/ml) were added to the culture every 2 weeks. Expanded 17195TCR-effectors and 17195TCR-Tregs were rested in the media (RPMI1640 supplemented with 10% fetal bovine serum (FBS), 1% human AB serum, 1 Glutamax, and antibiotics) for 48-72 hrs.
Intracellular Staining for Foxp3, Helios, and Cytokines
[0062] Rested cells were re-stimulated with phorbol myristate acetate (PMA; 50 ng/ml) and Ionomycin (1 g/ml) for 4 hours in the presence of Golgi Stop (0.75 l/ml). Cells were then fixed with 4% paraformaldehyde solution and permeabilized in BSA-containing 0.1% Triton X-100/PBS. Permeabilized cells were stained for Foxp3-APC, Helios-PE, IL-2-PE and IFN-PECy7 (BD Bioscience).
Cell Proliferation and Suppression Assays
[0063] For standard suppression assays, fresh isolated or expanded T effectors were washed 2 in PBS and labeled with 10 M eFluor-450 for 20 min. Labeled cells were washed in FBS-supplemented medium and 2-510.sup.4 cells co-cultured with -irradiated DR1-PBMC as APCs in the presence of specific FVIII-2191-2220 or a non-specific peptide (OVA) for 4-5 days. Proliferation was measured by a flow cytometric dye-dilution assay.
[0064] An in vitro Treg suppression assay was also performed as previously described.sup.5,6. Briefly, 3-4 week-expanded 17195TCR-effectors (410.sup.4) and -irradiated DR1-PBMCs were mixed at a ratio of 1:2 in the absence of IL-2. 17195TCR-Tregs were then added at various ratios and stimulated with soluble anti-CD3 antibody (0.5 g/ml), FVIII-2191-2220 (0.5 g/ml), or rFVIII (0.2 g/ml) for 4-6 days and cell proliferation was assayed by dye dilution or by thymidine incorporation following incubation with [.sup.3H]-thymidine (1 Ci/well) during the final 16-18 hours of culture. To measure suppression of cytokine production by Tregs, T effectors were incubated with Tregs (mock or 17195TCR) for 24 hours in the presence of FVIII-2191-2220 with irradiated DR1-PBMC and without IL-2. The supernatants were harvested and assayed for cytokine expression using a Th1, Th2 and Th17 human CBA kit (BD Bioscience).
DNA Methylation Analysis of Human Treg-Specific De-Methylation Regions (TSDR)
[0065] Three-week-expanded 17195TCR-Tregs were harvested, washed and genomic DNA extracted using a Wizard Genomic DNA Purification Kit (Promega). Epitect Bisulfite kits (Qiagen) were used to convert unmethylated Cytosines in the genomic DNAs to Uracils. A Promark Q24 instrument was used to detect and quantify methylated TSDR CpGs in the TSDR, using human TSDR-specific primers. Nine CpGs were determined to be methylation-sensitive TSDR CpGs within the Foxp3 genome (2376 to 2263 from translation starting site).
ELISPOT Assay and In Vitro Suppression of Antibody Production by FVIII-Specific B Cells from HLA-Transgenic Hemophilia A Mice
[0066] To quantify the in vitro anti-FVIII suppression, humanized hemophilia A mice were created by crossing E16-FVIII knockout (KO) mice.sup.7 with DR1-transgenic mice (Dr. Chella David, Mayo Clinic). These mice were immunized subcutaneously with 2 g rFVIII in incomplete Freund's adjuvant and boosted twice with 2 g rFVIII in PBS intraperitoneally 3 and 5 weeks later. Pooled splenocytes from two immunized mice having established titers against FVIII were used as T-responders. Next, 110.sup.7 HLA-DR1-FVIII-KO splenocytes were co-cultured with 17195TCR-Tregs or mock transduced Tregs at various ratios in T25 flasks for 6 days in RPMI 1640 medium supplemented with 10% FBS, 2 mM L-glutamine, 50 M 2-mercaptoethanol, and 1 g/ml rFVIII. The effect of these human Tregs on FVIII-specific antibody secreting cell (ASC) formation was measured using an enzyme-linked immunospot (ELISPOT) assay with rFVIII-coated plates.sup.8,9. Cells were washed, added to ELISPOT wells in triplicate and cultured overnight. The captured anti-FVIII antibodies were detected by HRP-conjugated anti-mouse IgG (H+L) (Invitrogen), and anti-FVIII ASC revealed with AEC substrate (BD Biosciences). Plates were read on a CTL ELISPOT plate reader (Cellular Technology Limited, Shaker Heights, Ohio).
Retroviral Expression of an Engineered FVIII-Specific TCR and FVIII-Mediated Proliferation of Polyclonal CD4 T Effectors
[0067] To prepare T effectors for retroviral transduction of 17195TCR, PBMCs from normal healthy donors were sorted to obtain a nave CD4.sup.+ T population (CD4.sup.+CD25.sup.CD127.sup.+CD45RA.sup.+); natural T-regulatory cells (nTreg, CD4.sup.+CD25.sup.hiCD127.sup.low) were also sorted and transduced as described below, stimulated with plate-coated anti-CD3c antibody and anti-CD28 antibody, and transduced with retroviral particles encoding the 17195 TCR. Transduced cells were maintained and rested in the presence of IL-2 for 8 days without additional stimuli. Twenty-four hours after transduction, initial transfection efficiency was determined by measuring the GFP expression. GFP cells comprised 6-25% of the virus-treated CD4 cells, and this proportion did not change during the maintenance period (2-4 days) (Fig S1A and data not shown). Transduction yields were comparable for mock-transduced cells and 17195TCR-transduced T effectors. The transduced GFP.sup.+ CD4 cells were next stained with an anti-V2 antibody (recognizing the 17195TCR). The GFP cells were predominantly V2+ (67% of the GFP cells) whereas 10% of the non-transduced (GFP.sup.) cells were V2+, indicating endogenous TCR expression levels (
[0068] To validate the antigen specificity of the 17195TCR, the transduced T effector cells were stained with DR1 tetramers loaded with FVIII-2191-2220. Despite the strong expression of this TCR on GFP cells, only a small percentage of expanded nave T cells (less than 5% of the transduced and 0.2% of the total CD4 population) showed a tetramer phenotype (
[0069] The functional activity of these 17195TCR-transduced T effectors was tested directly as follows. Ten day-rested TCR-transduced CD4 cells were labeled with a cell proliferation dye, and a proliferation assay was performed with DR1-PBMC presenting FVIII-2191-2220 or an OVA peptide (pOVA). When 17195TCR-effectors were cultured with FVIII-2191-2220, almost 100% of the GFP cells proliferated (
Production of Antigen Specific Treg Cells and Induction of Treg-Specific Factors by Antigenic Stimulation
[0070] To produce TCR17195 expressing T regulatory cell (Treg-17195), human Tregs (CD4.sup.+CD25.sup.hiCD127.sup.lo) were isolated from healthy donor's buffy coat. Pre-stimulation, retroviral transduction, and expansion of Treg-17195 was done as described above for effector T cells and as shown in
Functional Stability of Transduced Tregs After Long-Term Ex Vivo Expansion Using Specific FVIII-2191-2220 and ODN
[0071] The function of expanded human Tregs in vitro can be stabilized using random oligodeoxynucleotides (ODN).sup.10-13. Thus, we hypothesized that long-term expansion in the presence of FVIII-2191-2220 and ODN would optimize the enrichment of antigen-specific, transduced Treg expressing high levels of Foxp3 and Helios. Transduced Tregs were cultured with anti-CD3 antibody, FVIII-2191-2220, or FVIII-2191-2220 and ODN (FVIII-2191-2220/ODN), in the presence of DR1-PBMCs plus recombinant IL-2 (
[0072] After a second round of expansion, GFP cells were dramatically enriched only in the FVIII-2191-2220 and FVIII-2191-2220/ODN culture conditions (72% and 74%), compared to anti-CD3 stimulation (top dot plots in
[0073] Analysis of the cytokine expression profile (
[0074] The status of Treg-specific demethylated region (TSDR) in ex vivo expanded Foxp3.sup.+Helios.sup.+ human and murine nTregs is an important marker for stabilization of Tregs.sup.13-17. GFP.sup.+ cells were FACS-sorted from expanded 17195TCR Tregs and the methylation status of their TSDR CpGs analyzed (
Evaluation of Suppressive Function
[0075] For the immunosuppression assay, nave T effector cells and Tregs were prepared as in
[0076] Cell mixtures were cultured with anti-CD3e antibody or pC2 for 2 days (
[0077] Since Tregs are known to inhibit the production of inflammatory cytokines.sup.18-22, we next determined the levels of IL-2, IFN, IL-4, and IL-17 produced by T effectors in the presence of Tregs after 24 h. At a ratio of 1:8 (Tregs:T effectors), FVIII-specific Tregs significantly suppressed dominant Th1 cytokine (IFN and TNF) production by T effectors compared to mock Tregs (
Effective Suppression of FVIII-Specific ASC Formation by 17195TCR Tregs In Vitro
[0078] To determine whether human FVIII-specific Tregs could suppress the humoral anti-FVIII response as well, splenocytes from FVIII-primed HLA-DR1-FVIII-KO mice were co-cultured with rFVIII plus 17195TCR-Tregs or mock-transduced Tregs at different ratios (
[0079] The methods described herein therefore are useful for producing Tregs useful in a cellular therapy to treat hemophilia patients who are prone to making antibodies against FVIII that inhibit its clotting function, as well as in patients with type I diabetes, uveitis, and multiple sclerosis. Further, the methods can be applied to other diseases associated with undesirable immune responses.
REFERENCES
[0080] 1. Wlchli S, Lset G , Kumari S, et al. A practical approach to T-cell receptor cloning and expression. PLoS ONE. 2011; 6(11):e27930. [0081] 2. James E A, Kwok W W, Ettinger R A, Thompson A R, Pratt K P. T-cell responses over time in a mild hemophilia A inhibitor subject: epitope identification and transient immunogenicity of the corresponding self-peptide. J. Thromb. Haemost. 2007; 5(12):2399-2407. [0082] 3. Ettinger R A, James E A, Kwok W W, Thompson A R, Pratt K P. Lineages of human T-cell clones, including T helper 17/T helper 1 cells, isolated at io different stages of anti-factor VIII immune responses. Blood. 2009; 114(7):1423-1428. [0083] 4. Yang S, Cohen C J, Peng P D, et al. Development of optimal bicistronic lentiviral vectors facilitates high-level TCR gene expression and robust tumor cell recognition. Gene Ther. 2008; 15(21):1411-1423. [0084] 5. Thornton A M, Piccirillo C A, Shevach E M. Activation requirements for the induction of CD4+CD25+ T cell suppressor function. Eur J Immunol. 2004; 34(2):366-376. [0085] 6. Thornton A M, Donovan E E, Piccirillo C A, Shevach E M. Cutting edge: IL-2 is critically required for the in vitro activation of CD4+CD25+ T cell suppressor function. J Immunol. 2004; 172(11):6519-6523. [0086] 7. Bi L, Lawler A M, Antonarakis S E, et al. Targeted disruption of the mouse factor VIII gene produces a model of haemophilia A. Nat. Genet. 1995; 10(1):119-121. [0087] 8. Hausl C, Ahmad R U, Sasgary M, et al. High-dose factor VIII inhibits factor VIII-specific memory B cells in hemophilia A with factor VIII inhibitors. Blood. 2005; 106(10):3415-3422. [0088] 9. Hausl C, Ahmad R U, Schwarz H P, et al. Preventing restimulation of memory B cells in hemophilia A: a potential new strategy for the treatment of antibody-dependent immune disorders. Blood. 2004; 104(1):115-122. [0089] 10. Vonderheide R H, June C H. Engineering T cells for cancer: our synthetic future. Immunol. Rev. 2014; 257(1):7-13. [0090] 11. Grupp S A, Kalos M, Barrett D, et al. Chimeric antigen receptor-modified T cells for acute lymphoid leukemia. N Engl J Med. 2013; 368(16):1509-1518. [0091] 12. Kalos M, June C H. Adoptive T Cell Transfer for Cancer Immunotherapy in the Era of Synthetic Biology. Immunity. 2013; 39(1):49-60. [0092] 13. Kim Y C, Bhairavabhotla R, Yoon J, et al. Oligodeoxynucleotides stabilize Helios-expressing Foxp3+ human T regulatory cells during in vitro expansion. Blood. 2012; 119(12):2810-2818. [0093] 14. Fransson M, Piras E, Burman J, et al. CAR/FoxP3-engineered T regulatory cells target the CNS and suppress EAE upon intranasal delivery. J Neuroinflammation. 2012; 9:112-112. [0094] 15. Jethwa H, Adami A A, Maher J. Use of gene-modified regulatory T-cells to control autoimmune and alloimmune pathology: Is now the right time? Clinical Immunology. 2014; 150(1):51-63. [0095] 16. Floess S, Freyer J, Siewert C, et al. Epigenetic control of the foxp3 locus in regulatory T cells. PLoS Biol. 2007; 5(2):e38. [0096] 17. Polansky J K, Kretschmer K, Freyer J, et al. DNA methylation controls Foxp3 gene expression. Eur J Immunol. 2008; 38(6):1654-1663.