BINDING MOLECULES TO ARGINASE II [ARG2]

Abstract

An isolated antigen-binding protein characterised in that it is capable of binding specifically to human Arginase II (ARG2) and inhibiting the enzyme activity of human ARG2.

Claims

1. An isolated antigen-binding protein characterised in that it is capable of binding specifically to human Arginase II (ARG2) and inhibiting the enzyme activity of human ARG2.

2. The antigen-binding protein according to claim 1, wherein a) the antigen-binding protein is capable of binding specifically to and inhibiting monomeric and/or trimeric human ARG2; b) the antigen-binding protein binds trimeric human ARG2 with a dissociation constant (K.sub.D) of less than 10 nM, less than 1 nM, less than 500 pM, less than 300 pM, or less than 150 pM, when assessed by Bio-Layer Interferometry (BLI); c) the antigen-binding protein is selective for binding and inhibiting human ARG2 over human ARG1; d) selectivity for binding human ARG2 over human ARG1 is assessed by Bio-Layer Interferometry (BLI); e) the antigen-binding protein does not measurably bind human ARG1 when assessed by Bio-Layer Interferometry (BLI); f) the antigen-binding protein binds human ARG2 with a 1:1 or 3:1 stoichiometry (antigen binding protein:human ARG2); g) the antigen-binding protein is capable of binding specifically to and inhibiting the enzyme activity of cynomolgus ARG2; h) the antigen-binding protein inhibits ARG2 by a mode of action that is not competitive; and/or, i) the antigen-binding protein restores T-cell proliferation in vitro in the presence of ARG2.

3-10. (canceled)

11. The antigen-binding protein according to claim 1, comprising: (a) a VH domain comprising a set of HCDRs: HCDR1, HCDR2 and HCDR3, interspersed with framework (FW) regions (HFW1-HCDR1-HFW2-HCDR2-HFW3-HCDR3-HFW4), wherein the amino acid sequence of HCDR3 (amino acids 95-102) is LRADLGLYMDL (SEQ ID NO: 315) and optionally further comprising (b) a VL domain comprising a set of LCDRs: LCDR1, LCDR2 and LCDR3, interspersed with framework (FW) regions (LFW1-LCDR1-LFW2-LCDR2-LFW3-LCDR3-LFW4), wherein the amino acid sequence of LCDR1 (amino acids 24-34) is SGSSSNIGNHYVS (SEQ ID NO: 318), wherein the sequences are defined by Kabat nomenclature.

12. The antigen-binding protein according to claim 1, comprising: (a) a VH domain comprising a set of HCDRs: HCDR1, HCDR2 and HCDR3, interspersed with framework regions (HFW1-HCDR1-HFW2-HCDR2-HFW3-HCDR3-HFW4), wherein the set of HCDRs is selected from those of antibody C0021158fgl2 (SEQ ID NO: 313, 314 and 315), C0021181 (SEQ ID NO: 343, 344, and 345), C0021180 (SEQ ID NO: 333, 334 and 335), C0021177 (SEQ ID NO: 323, 324 and 325), C0021158 (SEQ ID NO: 273, 274 and 275), C0021158 IgG (SEQ ID NO: 283, 284 and 285), C0021158fgl (SEQ ID NO: 303, 304 and 305), C0021158dr (SEQ ID NO: 293, 294 and 295), C0021061 (SEQ ID NO: 63, 64 and 65), C0020187 (SEQ ID NO: 13, 14 and 15), C0021155 (SEQ ID NO: 263, 264 and 265), C0021144 (SEQ ID NO: 253, 254 and 255), C0021142 (SEQ ID NO: 233, 234 and 235), C0021142 IgG (SEQ ID NO: 243, 244 and 245), C0021141 (SEQ ID NO: 223, 224 and 225), C0021139 (SEQ ID NO: 213, 214 and 215), C0021135 (SEQ ID NO: 203, 204 and 205), C0021133 (SEQ ID NO: 193, 194 and 195), C0021131 (SEQ ID NO: 183, 184 and 185), C0021129 (SEQ ID NO: 173, 174 and 175), C0021128 (SEQ ID NO: 163, 164 and 165), C0021124 (SEQ ID NO: 153, 154 and 155), C0021118 (SEQ ID NO: 143, 144 and 145), C0021101 (SEQ ID NO: 133, 134 and 135), C0021098 (SEQ ID NO: 123, 124 and 125), C0021097 (SEQ ID NO: 113, 114 and 115), C0021096 (SEQ ID NO: 103, 104 and 105), C0021092 (SEQ ID NO: 93, 94 and 95), C0021089 (SEQ ID NO: 83, 84 and 85), C0021065 (SEQ ID NO: 73, 74 and 75), C0021032 (SEQ ID NO: 53, 54 and 55), C0021022 (SEQ ID NO: 43, 44 and 45), C0021021 (SEQ ID NO: 33, 34 and 35), C0021017 (SEQ ID NO: 23, 24 and 25) and C0020065 (SEQ ID NO: 3, 4 and 5); and/or (b) a VL domain comprising a set of LCDRs: LCDR1, LCDR2 and LCDR3, interspersed with framework regions (LFW1-LCDR1-LFW2-LCDR2-LFW3-LCDR3-LFW4), wherein the set of LCDRs is selected from those of antibody C0021158fgl2 (SEQ ID NO: 318, 319 and 320), C0021181 (SEQ ID NO: 348, 349, and 350), C0021180 (SEQ ID NO: 338, 339 and 340), C0021177 (SEQ ID NO: 328, 329 and 330), C0021158 (SEQ ID NO: 278, 279 and 280), C0021158 IgG (SEQ ID NO: 288, 289 and 290), C0021158fgl (SEQ ID NO: 308, 309 and 310), C00021158dr (SEQ ID NO: 298, 299 and 300), C0021061 (SEQ ID NO: 68, 69 and 70), C0020187 (SEQ ID NO: 18, 19 and 20), C0021155 (SEQ ID NO: 268, 269 and 270), C0021144 (SEQ ID NO: 258, 259 and 260), C0021142 (SEQ ID NO: 238, 239 and 240), C0021142 IgG (SEQ ID NO: 248, 249 and 250), C0021141 (SEQ ID NO: 228, 229 and 230), C0021139 (SEQ ID NO: 218, 219 and 220), C0021135 (SEQ ID NO: 208, 209 and 210), C0021133 (SEQ ID NO: 198, 199 and 200), C0021131 (SEQ ID NO: 188, 189 and 190), C0021129 (SEQ ID NO: 178, 179 and 180), C0021128 (SEQ ID NO: 168, 169 and 170), C0021124 (SEQ ID NO: 158, 159 and 160), C0021118 (SEQ ID NO: 148, 149 and 150), C0021101 (SEQ ID NO: 138, 139 and 140), C0021098 (SEQ ID NO: 128, 129 and 130), C0021097 (SEQ ID NO: 118, 119 and 120), C0021096 (SEQ ID NO: 108, 109 and 110), C0021092 (SEQ ID NO: 98, 99 and 100), C0021089 (SEQ ID NO: 88, 89 and 90), C0021065 (SEQ ID NO: 78, 79 and 80), C0021032 (SEQ ID NO: 58, 59 and 60), C0021022 (SEQ ID NO: 48, 49 and 50), C0021021 (SEQ ID NO: 38, 39 and 40), C0021017 SEQ ID NO: 28, 29 and 30) and C0020065 (SEQ ID NO: 8, 9 and 10); wherein the sequences are defined by Kabat nomenclature; or (c) the antigen-binding protein comprising any one of the VH domains selected from the following: a VH domain comprising HCDR1 (SEQ ID NO: 313), HCDR2 (SEQ ID NO: 314) and HCDR3 (SEQ ID NO: 315) and a VL domain comprising LCDR1 (SEQ ID NO: 318), LCDR2, (SEQ ID NO: 319) and LCDR3 (SEQ ID NO: 320) of C0021158fgl2; a VH domain comprising HCDR1 (SEQ ID NO: 343), HCDR2 (SEQ ID NO: 344) and HCDR3 (SEQ ID NO: 345) and a VL domain comprising LCDR1 (SEQ ID NO: 348), LCDR2, (SEQ ID NO: 349) and LCDR3 (SEQ ID NO: 350) of C0021181; a VH domain comprising HCDR1 (SEQ ID NO: 313), HCDR2 (SEQ ID NO: 314) and HCDR3 (SEQ ID NO: 315) and a VL domain comprising LCDR1 (SEQ ID NO: 318), LCDR2, (SEQ ID NO: 319) and LCDR3 (SEQ ID NO: 320) of C0021180; a VH domain comprising HCDR1 (SEQ ID NO: 323), HCDR2 (SEQ ID NO: 324) and HCDR3 (SEQ ID NO: 325) and a VL domain comprising LCDR1 (SEQ ID NO: 328), LCDR2, (SEQ ID NO: 329) and LCDR3 (SEQ ID NO: 330) of C0021177; a VH domain comprising HCDR1 (SEQ ID NO: 273), HCDR2 (SEQ ID NO: 274) and HCDR3 (SEQ ID NO: 275) and a VL domain comprising LCDR1 (SEQ ID NO: 278), LCDR2, (SEQ ID NO: 279) and LCDR3 (SEQ ID NO: 280) of C0021158; a VH domain comprising HCDR1 (SEQ ID NO: 283), HCDR2 (SEQ ID NO: 284) and HCDR3 (SEQ ID NO: 285) and a VL domain comprising LCDR1 (SEQ ID NO: 288), LCDR2, (SEQ ID NO: 289) and LCDR3 (SEQ ID NO: 290) of C0021158 IgG; a VH domain comprising HCDR1 (SEQ ID NO: 303), HCDR2 (SEQ ID NO: 304) and HCDR3 (SEQ ID NO: 305) and a VL domain comprising LCDR1 (SEQ ID NO: 308), LCDR2, (SEQ ID NO: 309) and LCDR3 (SEQ ID NO: 310) of C0021158fgl; a VH domain comprising HCDR1 (SEQ ID NO: 293), HCDR2 (SEQ ID NO: 294) and HCDR3 (SEQ ID NO: 295) and a VL domain comprising LCDR1 (SEQ ID NO: 298), LCDR2, (SEQ ID NO: 299) and LCDR3 (SEQ ID NO: 300) of C0021158dr; a VH domain comprising HCDR1 (SEQ ID NO: 63), HCDR2 (SEQ ID NO: 64) and HCDR3 (SEQ ID NO: 65) and a VL domain comprising LCDR1 (SEQ ID NO: 68), LCDR2, (SEQ ID NO: 69) and LCDR3 (SEQ ID NO: 70) of C0021061; a VH domain comprising HCDR1 (SEQ ID NO: 13), HCDR2 (SEQ ID NO: 14) and HCDR3 (SEQ ID NO: 15) and a VL domain comprising LCDR1 (SEQ ID NO: 18), LCDR2, (SEQ ID NO: 19) and LCDR3 (SEO ID NO: 20) of C0020187; a VH domain comprising HCDR1 (SEQ ID NO: 263), HCDR2 (SEQ ID NO: 264) and HCDR3 (SEQ ID NO: 265) and a VL domain comprising LCDR1 (SEQ ID NO: 268), LCDR2, (SEQ ID NO: 269) and LCDR3 (SEQ ID NO: 270) of C0021155; a VH domain comprising HCDR1 (SEQ ID NO: 253), HCDR2 (SEQ ID NO: 254) and HCDR3 (SEQ ID NO: 255) and a VL domain comprising LCDR1 (SEQ ID NO: 258), LCDR2, (SEQ ID NO: 259) and LCDR3 (SEQ ID NO: 260) of C0021144; a VH domain comprising HCDR1 (SEQ ID NO: 233), HCDR2 (SEQ ID NO: 234) and HCDR3 (SEQ ID NO: 235) and a VL domain comprising LCDR1 (SEQ ID NO: 238), LCDR2, (SEQ ID NO: 239) and LCDR3 (SEQ ID NO: 240) of C0021142; a VH domain comprising HCDR1 (SEQ ID NO: 243), HCDR2 (SEQ ID NO: 244) and HCDR3 (SEQ ID NO: 245) and a VL domain comprising LCDR1 (SEQ ID NO: 248), LCDR2, (SEQ ID NO: 249) and LCDR3 (SEQ ID NO: 250) of C0021142 IgG; a VH domain comprising HCDR1 (SEQ ID NO: 223), HCDR2 (SEQ ID NO: 224) and HCDR3 (SEQ ID NO: 225) and a VL domain comprising LCDR1 (SEQ ID NO: 228), LCDR2, (SEQ ID NO: 229) and LCDR3 (SEQ ID NO: 230) of C0021141; a VH domain comprising HCDR1 (SEQ ID NO: 213), HCDR2 (SEQ ID NO: 214) and HCDR3 (SEQ ID NO: 215) and a VL domain comprising LCDR1 (SEQ ID NO: 218), LCDR2, (SEQ ID NO: 219) and LCDR3 (SEQ ID NO: 220) of C0021139; a VH domain comprising HCDR1 (SEQ ID NO: 203), HCDR2 (SEQ ID NO: 204) and HCDR3 (SEQ ID NO: 205) and a VL domain comprising LCDR1 (SEQ ID NO: 208), LCDR2, (SEQ ID NO: 209) and LCDR3 (SEQ ID NO: 210) of C0021135; a VH domain comprising HCDR1 (SEQ ID NO: 193), HCDR2 (SEQ ID NO: 194) and HCDR3 (SEQ ID NO: 195) and a VL domain comprising LCDR1 (SEQ ID NO: 198), LCDR2, (SEQ ID NO: 199) and LCDR3 (SEQ ID NO: 200) of C0021133; a VH domain comprising HCDR1 (SEQ ID NO: 183), HCDR2 (SEQ ID NO: 184) and HCDR3 (SEQ ID NO: 185) and a VL domain comprising LCDR1 (SEQ ID NO: 188), LCDR2, (SEQ ID NO: 189) and LCDR3 (SEQ ID NO: 190) of C0021131; a VH domain comprising HCDR1 (SEQ ID NO: 173), HCDR2 (SEQ ID NO: 174) and HCDR3 (SEQ ID NO: 175) and a VL domain comprising LCDR1 (SEQ ID NO: 178), LCDR2, (SEO ID NO: 179) and LCDR3 (SEO ID NO: 180) of C0021129; a VH domain comprising HCDR1 (SEQ ID NO: 163), HCDR2 (SEQ ID NO: 164) and HCDR3 (SEQ ID NO: 165) and a VL domain comprising LCDR1 (SEQ ID NO: 168), LCDR2, (SEQ ID NO: 169) and LCDR3 (SEQ ID NO: 170) C0021128; a VH domain comprising HCDR1 (SEQ ID NO: 153), HCDR2 (SEQ ID NO: 154) and HCDR3 (SEQ ID NO: 155) and a VL domain comprising LCDR1 (SEQ ID NO: 158), LCDR2, (SEQ ID NO: 159) and LCDR3 (SEQ ID NO: 160) of C0021124; a VH domain comprising HCDR1 (SEQ ID NO: 143), HCDR2 (SEQ ID NO: 144) and HCDR3 (SEQ ID NO: 145) and a VL domain comprising LCDR1 (SEQ ID NO: 148), LCDR2, (SEQ ID NO: 149) and LCDR3 (SEQ ID NO: 150) of C0021118; a VH domain comprising HCDR1 (SEQ ID NO: 133), HCDR2 (SEQ ID NO: 134) and HCDR3 (SEQ ID NO: 135) and a VL domain comprising LCDR1 (SEQ ID NO: 138), LCDR2, (SEQ ID NO: 139) and LCDR3 (SEQ ID NO: 140) of C0021101; a VH domain comprising HCDR1 (SEQ ID NO: 123), HCDR2 (SEQ ID NO: 124) and HCDR3 (SEQ ID NO: 125) and a VL domain comprising LCDR1 (SEQ ID NO: 128), LCDR2, (SEQ ID NO: 129) and LCDR3 (SEQ ID NO: 130) of C0021098; a VH domain comprising HCDR1 (SEQ ID NO: 113), HCDR2 (SEQ ID NO: 114) and HCDR3 (SEQ ID NO: 115) and a VL domain comprising LCDR1 (SEQ ID NO: 118), LCDR2, (SEQ ID NO: 119) and LCDR3 (SEQ ID NO: 120) of C0021097; a VH domain comprising HCDR1 (SEQ ID NO: 103), HCDR2 (SEQ ID NO: 104) and HCDR3 (SEQ ID NO: 105) and a VL domain comprising LCDR1 (SEQ ID NO: 108), LCDR2, (SEQ ID NO: 109) and LCDR3 (SEQ ID NO: 110) of C0021096; a VH domain comprising HCDR1 (SEQ ID NO: 93), HCDR2 (SEQ ID NO: 94) and HCDR3 (SEQ ID NO: 95) and a VL domain comprising LCDR1 (SEQ ID NO: 98), LCDR2, (SEQ ID NO: 99) and LCDR3 (SEQ ID NO: 100) of C0021092; a VH domain comprising HCDR1 (SEQ ID NO: 83), HCDR2 (SEQ ID NO: 84) and HCDR3 (SEQ ID NO: 85) and a VL domain comprising LCDR1 (SEQ ID NO: 88), LCDR2, (SEQ ID NO: 89) and LCDR3 (SEQ ID NO: 90) of C0021089; a VH domain comprising HCDR1 (SEQ ID NO: 73), HCDR2 (SEQ ID NO: 74) and HCDR3 (SEQ ID NO: 75) and a VL domain comprising LCDR1 (SEQ ID NO: 78), LCDR2, (SEQ ID NO: 79) and LCDR3 (SEO ID NO: 80) of C0021065; a VH domain comprising HCDR1 (SEQ ID NO: 53), HCDR2 (SEQ ID NO: 54) and HCDR3 (SEQ ID NO: 55) and a VL domain comprising LCDR1 (SEQ ID NO: 58), LCDR2, (SEQ ID NO: 59) and LCDR3 (SEQ ID NO: 60) of C0021032; a VH domain comprising HCDR1 (SEQ ID NO: 43), HCDR2 (SEQ ID NO: 44) and HCDR3 (SEQ ID NO:45) and a VL domain comprising LCDR1 (SEQ ID NO: 48), LCDR2, (SEQ ID NO: 49) and LCDR3 (SEQ ID NO: 50) of C0021022; a VH domain comprising HCDR1 (SEQ ID NO: 33), HCDR2 (SEQ ID NO: 34) and HCDR3 (SEQ ID NO: 35) and a VL domain comprising LCDR1 (SEQ ID NO: 38), LCDR2, (SEQ ID NO: 39) and LCDR3 (SEQ ID NO: 40) of C0021021; a VH domain comprising HCDR1 (SEQ ID NO: 23), HCDR2 (SEQ ID NO: 24) and HCDR3 (SEQ ID NO: 25) and a VL domain comprising LCDR1 (SEQ ID NO: 28), LCDR2, (SEQ ID NO: 29) and LCDR3 (SEQ ID NO: 30) of C0021017; or a VH domain comprising HCDR1 (SEQ ID NO: 3), HCDR2 (SEQ ID NO: 4) and HCDR3 (SEQ ID NO: 5) and a VL domain comprising LCDR1 (SEQ ID NO: 8), LCDR2, (SEQ ID NO: 9) and LCDR3 (SEQ ID NO: 10) of C0020065; wherein the sequences are defined by Kabat nomenclature; or, (d) the antigen-binding protein comprising: (i) a VH domain selected from a VH domain of antibody C0021158 fgl2 (SEQ ID NO: 312), C0021181 (SEQ ID NO: 342), C0021180 (SEQ ID NO: 332), C0021177 (SEQ ID NO: 322), C0021158 (SEQ ID NO: 272), C0021158 IgG (SEQ ID NO: 282), C0021158fgl (SEQ ID NO: 302), C0021158dr (SEQ ID NO: 292), C0021061 (SEQ ID NO: 62), C0020187 (SEQ ID NO: 12), C0021155 (SEQ ID NO: 262), C0021144 (SEQ ID NO: 252), C0021142 (SEQ ID NO: 232), C0021142 IgG (SEQ ID NO: 242), C0021141 (SEQ ID NO: 222), C0021139 (SEQ ID NO: 212), C0021135 (SEQ ID NO: 202), C0021133 (SEQ ID NO: 192), C0021131 (SEQ ID NO: 182), C0021129 (SEQ ID NO: 172), C0021128 (SEQ ID NO: 162), C0021124 (SEQ ID NO: 152), C0021118 (SEQ ID NO: 142), C0021101 (SEQ ID NO: 132), C0021098 (SEQ ID NO: 122), C0021097 (SEQ ID NO: 112), C0021096 (SEQ ID NO: 102), C0021092 (SEQ ID NO: 92), C0021089 (SEQ ID NO: 82), C0021065 (SEQ ID NO: 72), C0021032 (SEQ ID NO: 52), C0021022 (SEQ ID NO: 42), C0021021 (SEQ ID NO: 32), C0021017 (SEQ ID NO: 22) and C0020065 (SEO ID NO: 2), or a germlined version thereof, or a VH domain with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto; and/or (ii) a VL domain selected from a VL domain of antibody C0021158 fgl2 (SEQ ID NO: 317), C0021181 (SEQ ID NO: 347), C0021180 (SEQ ID NO: 337), C0021177 (SEQ ID NO: 327), C0021158 (SEQ ID NO: 277), C0021158 IgG (SEQ ID NO: 287), C0021158fgl (SEQ ID NO: 307), C0021158dr (SEQ ID NO: 297), C0021061 (SEQ ID NO: 67), C0020187 (SEQ ID NO: 17), C0021155 (SEQ ID NO: 267), C0021144 (SEQ ID NO: 257), C0021142 (SEQ ID NO: 237), C0021142 IgG (SEQ ID NO: 247), C0021141 (SEQ ID NO: 227), C0021139 (SEQ ID NO: 217), C0021135 (SEQ ID NO: 207), C0021133 (SEQ ID NO: 197), C0021131 (SEQ ID NO: 187), C0021129 (SEQ ID NO: 177), C0021128 (SEQ ID NO: 167), C0021124 (SEQ ID NO: 157), C0021118 (SEQ ID NO: 147), C0021101 (SEQ ID NO: 137), C0021098 (SEQ ID NO: 127), C0021097 (SEQ ID NO: 117), C0021096 (SEQ ID NO: 107), C0021092 (SEQ ID NO: 97), C0021089 (SEQ ID NO: 87), C0021065 (SEQ ID NO: 77), C0021032 (SEQ ID NO: 57), C0021022 (SEQ ID NO: 47), C0021021 (SEQ ID NO: 37), C0021017 (SEQ ID NO: 27) and C0020065 (SEQ ID NO: 7), or a germlined version thereof, or a VL domain with at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto; wherein the sequences are defined by Kabat nomenclature; or, (e) the antigen binding protein comprising a VH domain and a VL domain at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical with; a VH domain (SEQ ID NO: 312) and VL domain (SEQ ID NO: 317) of C0021158 fgl2, a VH domain (SEQ ID NO: 342) and a VL domain (SEQ ID NO: 347) of C0021181, a VH domain (SEQ ID NO: 332) and a VL domain (SEQ ID NO: 337) of C0021180, a VH domain (SEQ ID NO: 322) and a VL domain (SEQ ID NO: 327) of C0021177, a VH domain (SEQ ID NO: 272) and a VL domain (SEQ ID NO: 277) of C0021158, a VH domain (SEQ ID NO: 282) and a VL domain (SEQ ID NO: 287) of C0021158 IgG, a VH domain (SEQ ID NO: 302) and a VL domain (SEQ ID NO: 307) of C0021158fgl, a VH domain (SEQ ID NO: 292) and a VL domain (SEQ ID NO: 297) of C0021158dr, a VH domain (SEO ID NO: 62) and a VL domain (SEO ID NO: 67) of C0021061, a VH domain (SEQ ID NO: 12) and a VL domain (SEQ ID NO: 17) of C0020187, a VH domain (SEQ ID NO: 262) and a VL domain (SEQ ID NO: 267) of C0021155, a VH domain (SEQ ID NO: 252) and a VL domain (SEQ ID NO: 257) of C0021144, a VH domain (SEQ ID NO: 232) and a VL domain (SEQ ID NO: 237) of C0021142, a VH domain (SEQ ID NO: 242) and a VL domain (SEQ ID NO: 247) of C0021142 IgG, a VH domain (SEQ ID NO: 222) and a VL domain (SEQ ID NO: 227) of C0021141, a VH domain (SEQ ID NO: 212) and a VL domain (SEQ ID NO: 217) of C0021139, a VH domain (SEQ ID NO: 202) and a VL domain (SEQ ID NO: 207) of C0021135, a VH domain (SEQ ID NO: 192) and a VL domain (SEQ ID NO: 197) of C0021133, a VH domain (SEQ ID NO: 182) and a VL domain (SEQ ID NO: 187) of C0021131, a VH domain (SEQ ID NO: 172) and a VL domain (SEQ ID NO: 177) of C0021129, a VH domain (SEQ ID NO: 162) and a VL domain (SEQ ID NO: 167) C0021128, a VH domain (SEQ ID NO: 152) and a VL domain (SEQ ID NO: 157) C0021124, a VH domain (SEQ ID NO: 142) and a VL domain (SEQ ID NO: 147) of C0021118, a VH domain (SEQ ID NO: 132) and a VL domain (SEQ ID NO: 137) of C0021101, a VH domain (SEQ ID NO: 122) and a VL domain (SEQ ID NO: 127) of C0021098, a VH domain (SEQ ID NO: 112) and a VL domain (SEQ ID NO: 117) of C0021097, a VH domain (SEQ ID NO: 102) and a VL domain (SEQ ID NO: 107) of C0021096, a VH domain (SEQ ID NO: 92) and a VL domain (SEQ ID NO: 97) of C0021092, a VH domain (SEQ ID NO: 82) and a VL domain (SEQ ID NO: 87) of C0021089, a VH domain (SEQ ID NO: 72) and a VL domain (SEQ ID NO: 77) of C0021065, a VH domain (SEQ ID NO: 52) and a VL domain (SEQ ID NO: 57) of C0021032, a VH domain (SEQ ID NO: 42) and a VL domain (SEQ ID NO: 47) of C0021022, a VH domain (SEQ ID NO: 32) and a VL domain (SEQ ID NO: 37) of C0021021, a VH domain (SEQ ID NO: 22) and a VL domain (SEQ ID NO: 27) of C0021017, or a VH domain (SEQ ID NO: 2) and a VL domain (SEQ ID NO: 7) of C0020065: wherein the sequences are defined by Kabat nomenclature; or (f) the antigen binding protein comprising a VH domain (SEQ ID NO: 312) and VL domain (SEQ ID NO: 317) of C0021158fgl2, a VH domain (SEO ID NO: 342) and a VL domain (SEO ID NO: 347) of C0021181, a VH domain (SEQ ID NO: 332) and a VL domain (SEQ ID NO: 337) of C0021180, a VH domain (SEQ ID NO: 322) and a VL domain (SEQ ID NO: 327) of C0021177, a VH domain (SEQ ID NO: 272) and a VL domain (SEQ ID NO: 277) of C0021158, a VH domain (SEQ ID NO: 282) and a VL domain (SEQ ID NO: 287) of C0021158 IgG, a VH domain (SEQ ID NO: 302) and a VL domain (SEQ ID NO: 307) of C0021158fgl, a VH domain (SEQ ID NO: 292) and a VL domain (SEQ ID NO: 297) of C0021158dr, a VH domain (SEQ ID NO: 62) and a VL domain (SEQ ID NO: 67) of C0021061, a VH domain (SEQ ID NO: 12) and a VL domain (SEQ ID NO: 17) of C0020187, a VH domain (SEQ ID NO: 262) and a VL domain (SEQ ID NO: 267) of C0021155, a VH domain (SEQ ID NO: 252) and a VL domain (SEQ ID NO: 257) of C0021144, a VH domain (SEQ ID NO: 232) and a VL domain (SEQ ID NO: 237) of C0021142, a VH domain (SEQ ID NO: 242) and a VL domain (SEQ ID NO: 247) of C0021142 IgG, a VH domain (SEQ ID NO: 222) and a VL domain (SEQ ID NO: 227) of C0021141, a VH domain (SEQ ID NO: 212) and a VL domain (SEQ ID NO: 217) of C0021139, a VH domain (SEQ ID NO: 202) and a VL domain (SEQ ID NO: 207) of C0021135, a VH domain (SEQ ID NO: 192) and a VL domain (SEQ ID NO: 197) of C0021133, a VH domain (SEQ ID NO: 182) and a VL domain (SEQ ID NO: 187) of C0021131, a VH domain (SEQ ID NO: 172) and a VL domain (SEQ ID NO: 177) of C0021129, a VH domain (SEQ ID NO: 162) and a VL domain (SEQ ID NO: 167) C0021128, a VH domain (SEQ ID NO: 152) and a VL domain (SEQ ID NO: 157) C0021124, a VH domain (SEQ ID NO: 142) and a VL domain (SEQ ID NO: 147) of C0021118, a VH domain (SEQ ID NO: 132) and a VL domain (SEQ ID NO: 137) of C0021101, a VH domain (SEQ ID NO: 122) and a VL domain (SEQ ID NO: 127) of C0021098, a VH domain (SEQ ID NO: 112) and a VL domain (SEQ ID NO: 117) of C0021097, a VH domain (SEQ ID NO: 102) and a VL domain (SEQ ID NO: 107) of C0021096, a VH domain (SEQ ID NO: 92) and a VL domain (SEQ ID NO: 97) of C0021092, a VH domain (SEQ ID NO: 82) and a VL domain (SEQ ID NO: 87) of C0021089, a VH domain (SEQ ID NO: 72) and a VL domain (SEQ ID NO: 77) of C0021065, a VH domain (SEQ ID NO: 52) and a VL domain (SEQ ID NO: 57) of C0021032, a VH domain (SEO ID NO: 42) and a VL domain (SEO ID NO: 47) of C0021022, a VH domain (SEQ ID NO: 32) and a VL domain (SEQ ID NO: 37) of C0021021, a VH domain (SEQ ID NO: 22) and a VL domain (SEQ ID NO: 27) of C0021017, or a VH domain (SEQ ID NO: 2) and a VL domain (SEQ ID NO: 7) of C0020065; or a germlined version thereof, wherein the sequences are defined by Kabat nomenclature.

13-18. (canceled)

19. An antigen-binding protein that competes for binding to human ARG2 with an antigen binding protein comprising: (a) the VH domain of SEQ ID NO: 312 and a VL domain of SEQ ID NO: 317 (C0021158fgl2), (b) the VH domain of SEQ ID NO: 192 and the VL domain of SEQ ID NO: 197 (C0021133), (c) the VH domain of SEQ ID NO: 12 and VL domain of SEQ ID NO: 17 (C0020187), or (d) the VH domain of SEQ ID NO: 2 and VL domain of SEQ ID NO: 7 (C0020065), when assessed in an epitope competition assay.

20. The antigen-binding protein according to claim 1, characterised in that: (a) it is capable of binding specifically to an epitope of human Arginase II (ARG2) and thereby inhibiting the enzyme activity of human ARG2 by an allosteric mechanism; (b) it is capable of binding specifically to an epitope of human Arginase II (ARG2) and thereby inducing structural remodelling of residues 33-40 within human ARG2, wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; (c) it is capable of binding specifically to an epitope of human Arginase II (ARG2) and thereby inhibiting the enzyme activity of human ARG2 by an allosteric mechanism, wherein the antigen-binding protein binds to an epitope on human Arg2 that induces structural or biophysical changes upon His160 of human ARG2 that confer a reduction in ARG2 enzyme activity or ability to process substrate, wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; (d) the antigen-binding protein binds to an epitope on human Arg2 that induces structural changes whereby Arg39 moves into closer proximity with His160 of human ARG2 thereby conferring a reduction in ARG2 enzyme activity or ability to process substrate, wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; (e) the antigen-binding protein binds to an epitope on human Arg2 that induces structural changes whereby the ability of His160 to act as a proton donor/acceptor and/or stabilize a catalytically competent bound orientation of the substrate is compromised thereby conferring a reduction in ARG2 enzyme activity; wherein optionally the antigen-binding protein (i) binds to an epitope on human ARG2 comprising a conformational epitope comprising residues from Gln35 to Arg39, residues from Lys78 to Ile86, and/or residues from Leu152 to Pro179, wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; (ii) binds to an epitope on human ARG2 comprising one or more residues selected from GLN35, GLY36, GLN37, LYS38, ARG39, LYS78, ASP79, ASP80, LEU81, TYR82, ASN84, LEU85, ILE86, LEU152, THR153 THR154, SER155, SER156, GLY157, LEU178 and PRO179; (iii) binds to an epitope on human ARG2 comprising a conformational epitope comprising residues from Pro32 to Glu51, residues from Asp70 to Ile86, and/or residues from Pro299 to Ala308, wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; (iv) binds to an epitope on human ARG2 comprising one or more residues selected from PRO32, GLN37, LYS38, LYS40, GLY41, GLU43, HIS44, ALA47, ALA48, GLU51, ASP70, SER72, PHE73, THR74, PRO75, LYS78, ASP79, ASP80, LEU81, TYR82, ASN84, LEU85, ILE86, PRO299, GLN300, GLU305 and ALA308; (v) binds to an epitope on human ARG2 comprising a conformational epitope comprising residues from Gln37 to Glu51, residues from Asp79 to Ile86, and/or residues from Pro299 to Ala308, wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; (vi) binds to an epitope on recombinant human ARG2 comprising one or more residues selected from GLN37, LYS38, LYS40, GLY41, HIS44, ALA47, ALA48, GLU51, ASP79, ASP80, LEU81, TYR82, ASN84, LEU85, ILE86, PRO299, GLN300, ALA302, THR303, SER304, GLU305 and ALA308; or, (vii) binds to an epitope on human ARG2 comprising one or more residues selected from PRO32, GLN35, GLY36, GLN37, LYS38, ARG39, LYS40, GLY41, GLU43, HIS44, ALA47, ALA48, GLU51, ASP70, SER72, PHE73, THR74, PRO75, LYS78, ASP79, ASP80, LEU81, TYR82, ASN84, LEU85, ILE86, LEU152, THR153 THR154, SER155, SER156, GLY157, LEU178, PRO179, PRO299, GLN300, ALA302, THR303, SER304, GLU305 and ALA308; wherein the epitope of (ii) is optionally defined as any residue within human ARG2 with a predicted change in solvent accessibility upon Fab complexation resulting from direct protection by the bound antibody as derived from X-ray structural data of ARG2 inhibitory Fab C0020187, and wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; wherein the epitope of (iii) or (iv) is optionally defined as any residue within human ARG2 with a predicted change in solvent accessibility upon Fab complexation resulting from direct protection by the bound antibody as derived from X-ray structural data of ARG2 inhibitory Fab C0021158, and wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; wherein the epitope of (vi) is optionally defined as any residue within human ARG2 with a predicted change in solvent accessibility upon Fab complexation resulting from direct protection by the bound antibody as derived from X-ray structural data of ARG2 inhibitory Fab C0021181, and wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540; and wherein the epitope of (vii) is optionally defined as any residue within human ARG2 with a predicted change in solvent accessibility upon Fab complexation as derived from X-ray structural data of an ARG2 inhibitory Fab selected from C0020187, C0021158 and C0021181 and wherein the sequence numbering is that of the human ARG2 sequence of Uniprot ID #P78540.

21-35. (canceled)

36. The antigen-binding protein according to claim 1, wherein the antigen-binding protein is selected from the group consisting of a) an antibody or a fragment thereof, a domain antibody, a protein scaffold, or an aptamer, b) a human IgG or a modified human IgG, c) a human IgG1, IgG2, IgG4, or a modified version thereof, and d) a human IgG1 or IgG1-YTE; and/or wherein the antigen-binding protein has a modified Fc to confer effector function and/or half-life extension.

37-40. (canceled)

41. A pharmaceutical composition comprising an antigen-binding protein according to claim 1, and a pharmaceutically acceptable excipient.

42. (canceled)

43. A method of treating an individual in need thereof for a treatment to restore immunocompetancy, alleviate inflammation-triggered immune dysfunction, inflammation-associated immune suppression, promote T cell immune responses, or to prevent tumour immune escape, fibrosis, and immunopathology of infectious diseases, comprising: administering to the individual the pharmaceutical composition of claim 41, whereby the individual in need thereof is treated.

44. The method of claim 43, wherein the treatment further comprises restoring T cell proliferation in the presence of ARG2.

45. A method of treating an individual in need thereof for a treatment of cancer, immune cell dysfunction, autoimmunity or unwanted immune deviation, comprising: administering to the individual the pharmaceutical composition of claim 41, whereby the individual in need thereof is treated.

46. The method of claim 45, wherein the cancer is selected from acute myeloid leukemia (AML), osteosarcoma, HCMV-driven GBM, pancreatic cancer, head and neck squamous cell carcinoma, thyroid, prostate, breast or ovarian cancer.

47. A method of treating an individual in need thereof for a treatment of infection (e.g., neonate infection), endothelial dysfunction (e.g. erectile dysfunction), vascular disease, cardiovascular disease, ageing and cellular senescence, CNS disease and injury; diabetes-associated disease, cystic fibrosis or infection associated with cystic fibrosis, comprising: administering to the individual the pharmaceutical composition of claim 41, whereby the individual in need thereof is treated.

48. (canceled)

49. An isolated nucleic acid encoding an antigen-binding protein according to claim 1.

50. A host cell in vitro transformed with nucleic acid according to claim 49.

51. A method of producing an antigen-binding protein, comprising culturing host cells according to claim 50 under conditions for production of the antigen-binding protein, optionally further comprising isolating and/or purifying the antigen-binding protein.

52. (canceled)

53. The method according to claim 51, further comprising formulating the antigen-binding protein into a composition comprising at least one additional component.

54. A method for producing an antigen-binding protein that binds specifically to and inhibits human ARG2, the method comprising providing a variant VH domain which is an amino acid sequence variant of a parent VH domain, by way of addition, deletion, substitution or insertion of one or more amino acids in the amino acid sequence of a parent VH domain comprising HCDR1, HCDR2 and HCDR3, wherein the parent VH domain HCDR1, HCDR2 and HCDR3 are a set of HCDRs selected from the set of HCDRs of C0021158fgl2, C0021181, C0021180, C0021177, C0021158, C0021158 IgG, C0021158fgl, C0021158dr, C0021061, C0020187, C0021155, C0021144, C0021142, C0021142 IgG, C0021141, C0021139, C0021135, C0021133, C0021131, C0021129, C0021128, C0021124, C0021118, C0021101, C0021098, C0021097, C0021096, C0021092, C0021089, C0021065, C0021032, C0021022, C0021021, C0021017 and C0020065, and optionally combining the variant VH domain thus provided with one or more VL domains to provide one or more VH/VL combinations; and testing said variant VH domain which is an amino acid sequence variant of the parent VH domain or the variant VH/VL combination or combinations to identify an antigen-binding protein antigen binding domain for human ARG2; or optionally wherein the parent VH domain is selected from C0021158fgl2, C0021181, C0021180, C0021177, C0021158, C0021158 IgG, C0021158fgl, C0021158dr, C0021061, C0020187, C0021155, C0021144, C0021142, C0021142 IgG, C0021141, C0021139, C0021135, C0021133, C0021131, C0021129, C0021128, C0021124, C0021118, C0021101, C0021098, C0021097, C0021096, C0021092, C0021089, C0021065, C0021032, C0021022, C0021021, C0021017 and C0020065, or a germlined version thereof; or optionally wherein the one or more VL domains is a variant VL domain provided by way of addition, deletion, substitution or insertion of one or more amino acids in the amino acid sequence of a parent VL domain comprising LCDR1, LCDR2 and LCDR3, wherein the parent VL domain LCDR1, LCDR2 and LCDR3 are a set of LCDRs selected from the set of LCDRs of C0021158fgl2, C0021181, C0021180, C0021177, C0021158, C0021158 IgG, C0021158fgl, C0021158dr, C0021061, C0020187, C0021155, C0021144, C0021142, C0021142 IgG, C0021141, C0021139, C0021135, C0021133, C0021131, C0021129, C0021128, C0021124, C0021118, C0021101, C0021098, C0021097, C0021096, C0021092, C0021089, C0021065, C0021032, C0021022, C0021021, C0021017 and C0020065, producing one or more variant VL domains each of which is an amino acid sequence variant of the parent VL domain; or optionally wherein the parent VL domain is the VL domain of any of C0021158fgl2, C0021181, C0021180, C0021177, C0021158, C0021158 IgG, C0021158fgl, C0021158dr, C0021061, C0020187, C0021155, C0021144, C0021142, C0021142 IgG, C0021141, C0021139, C0021135, C0021133, C0021131, C0021129, C0021128, C0021124, C0021118, C0021101, C0021098, C0021097, C0021096, C0021092, C0021089, C0021065, C0021032, C0021022, C0021021, C0021017 and C0020065, or a germlined version thereof.

55-57. (canceled)

58. The method according to claim 54, further comprising producing the antigen-binding protein antigen-binding domain as a component of an IgG, scFv or Fab antigen-binding protein.

59. A method for producing an antigen-binding protein that binds to and inhibits human ARG2, wherein the method comprises: providing starting nucleic acid encoding a VH domain or a starting repertoire of nucleic acids each encoding a VH domain, wherein the VH domain or VH domains either comprise a HCDR1, HCDR2 and/or HCDR3 to be replaced or lack a HCDR1, HCDR2 and/or HCDR3 encoding region; combining said starting nucleic acid or starting repertoire with donor nucleic acid or donor nucleic acids encoding the amino acid sequence of an HCDR1, HCDR2, and/or HCDR3 selected from the HCDR1, HCDR2 and/or HCDR3 of C0021158fgl2, C0021181, C0021180, C0021177, C0021158, C0021158 IgG, C0021158fgl, C0021158dr, C0021061, C0020187, C0021155, C0021144, C0021142, C0021142 IgG, C0021141, C0021139, C0021135, C0021133, C0021131, C0021129, C0021128, C0021124, C0021118, C0021101, C0021098, C0021097, C0021096, C0021092, C0021089, C0021065, C0021032, C0021022, C0021021, C0021017 and C0020065, such that said donor nucleic acid is or donor nucleic acids are inserted into the CDR1, CDR2 and/or CDR3 region in the starting nucleic acid or starting repertoire, so as to provide a product repertoire of nucleic acids encoding VH domains; expressing the nucleic acids of said product repertoire to produce product VH domains; optionally combining said product VH domains with one or more VL domains; selecting an antigen-binding protein for ARG2, wherein the antigen-binding protein comprises a product VH domain and optionally a VL domain; and recovering the nucleic acid encoding the antigen-binding protein or the antigen-binding protein thereof; optionally wherein the donor nucleic acids are produced by mutation of said HCDR1 and/or HCDR2; or optionally wherein the donor nucleic acid is produced by mutation of HCDR3; or optionally providing the donor nucleic acid by random mutation of nucleic acid; or optionally the method further comprises attaching a product VH domain that is comprised within the recovered antigen-binding protein to an antigen-binding protein constant region or optionally comprising providing an IgG, scFv or Fab antigen-binding protein comprising the product VH domain and a VL domain.

60-64. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0383] FIG. 1 shows the results of the direct binding HTRF™ assay between the purified scFv clones C0020065 and C0020187 and a series of arginase enzymes. FIG. 1A shows the specific binding to biotinylated recombinant human trimeric ARG2 enzyme. FIG. 1B shows that there is no binding to biotinylated recombinant human trimeric ARG1 enzyme. FIG. 1C shows the specific binding to biotinylated recombinant cynomolgus trimeric ARG2 enzyme. C0020065 (Δ) and C0020187 (x) both bound to recombinant human trimeric ARG2 enzyme (FIG. 1A) and to cynomolgus trimeric ARG2 enzyme (FIG. 1C) but showed no binding to recombinant human trimeric ARG1 enzyme (FIG. 1B). The negative control scFv antibody CEA6 (.diamond-solid.) showed no binding to any of the arginase enzymes, as expected.

[0384] FIG. 2 Inhibition of trimeric ARG2 by lead isolation scFv antibody fragments. FIG. 2 shows the results of the human trimeric ARG2 enzyme inhibition assay for the purified scFv clones C0020065 and C0020187 (n=4 C0020187, n=2 all other clones). Both clones C0020065 (Δ) and C0020187 (x) inhibited the activity of human trimeric ARG2. The negative control antibody CEA6 (.diamond-solid.) was unable to inhibit the activity of human trimeric ARG2, as expected. The small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) (◯) was included as a positive control and was able to inhibit the activity of human trimeric ARG2.

[0385] FIG. 3 Inhibition of trimeric Human ARG2 by lead isolation IgGs. FIG. 3 shows the results of the human trimeric ARG2 enzyme inhibition assay for the purified recombinant human IgG1 clones C0020065 and C0020187 (n=4 C0020187, n=2 all other clones). Both clones C0020065 (Δ) and C0020187 (x) inhibited the activity of human trimeric ARG2. The negative control antibody NIP228 (.diamond-solid.) was unable to inhibit the activity of human trimeric ARG2, as expected. The small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) (◯) was included as a positive control and was able to inhibit the activity of human trimeric ARG2.

[0386] FIG. 4 Restoration of T cell proliferation by ARG2 IgGs in the presence of ARG2. FIG. 4 shows the results of the T cell proliferation assay for the purified recombinant human IgG1 clones C0020065 and C0020187. Both clones inhibited the activity of human trimeric ARG2 (exogenous), leading to an increase in T cell proliferation. The negative control antibody NIP228 had no effect upon T cell proliferation, as expected. The small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) was included as a positive control and was able to inhibit the activity of human trimeric ARG2, giving an increase in T cell proliferation.

[0387] FIG. 5 Inhibition of ARG2 monomer by lead isolation IgGs. FIG. 5 shows the results of the human monomeric ARG2 enzyme inhibition assay for the purified recombinant human IgG1 clones C0020065 and C0020187 (n=3 C0020187, n=2 all other clones). Both clones C0020065 (Δ) and C0020187 (x) inhibited the activity of human monomeric ARG2. The negative control antibody NIP228 (.diamond-solid.) was unable to inhibit the activity of human monomeric ARG2 as expected. The small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) (∘) was included as a positive control and was able to inhibit the activity of human monomeric ARG2.

[0388] FIG. 6 Specific binding to THP1 derived ARG2 by lead isolation IgGs. FIG. 6 shows the results of the ELISA assay for binding of the biotinylated recombinant human IgG1 (huIgG1-biot) clones to THP-1 lysate derived human trimeric ARG2. Both clones C0020065 huIgG1-biot (custom-character) and C0020187 huIgG1-biot (custom-character) showed strong binding to THP-1 lysate derived human trimeric ARG2. No binding to lysates prepared from wild type THP-1 cells was observed. The negative control antibody NIP228 (custom-character) did not bind to recombinant human trimeric ARG2 enzyme as expected.

[0389] FIG. 7 C0020187 has a not competitive mode of action on the homotrimer ARG2. FIG. 7 shows the results of a mode of action study for C0020187 recombinant human IgG1 to assess if the antibody is a competitive, non competitive or uncompetitive inhibitor. This study utilised the human trimeric ARG2 enzyme inhibition assay. 10 μM (∘), 3 μM (custom-character), 1 μM (Δ) and 0.3 μM (.Math.) concentrations of C0020187 recombinant human IgG1 were incubated in the presence of increasing concentrations of the substrate arginine and the impact of each inhibitor concentration on ARG2 K.sub.m and V.sub.max assessed. A no inhibitor control (⋄) was also included. Increasing concentrations of C0020187 recombinant human IgG1 had a clear impact on arginine V.sub.max values.

[0390] FIG. 8 Epitope competition assay for affinity-matured clones as scFv over parent C0020187 IgG FIG. 8 shows the results from an epitope competition HTRF™ assay in which inhibition of the formation of a complex between biotinylated recombinant human trimeric ARG2 enzyme and C0020187 recombinant human IgG1 by increasing concentrations of competing purified scFv antibodies was measured. All 22 scFv antibodies tested were derived from the process of affinity maturing C0020187. Parent C0020187 scFv was also included in this analysis alongside the negative control scFv antibody CEA6. See below for a key for all scFv antibodies tested. All affinity-matured scFv antibodies tested in this experiment showed improvements in IC.sub.50 compared to parent C0020187 scFv.

[0391] Key:

TABLE-US-00006 custom-character C0021017 scFv custom-character C0021089 scFv custom-character C0021118 scFv custom-character C0021135 scFv custom-character C0021021 scFv custom-character C0021092 scFv custom-character C0021124 scFv custom-character C0021139 scFv custom-character C0021022 scFv custom-character C0021096 scFv custom-character C0021128 scFv custom-character C0021141 scFv custom-character C0021032 scFv custom-character C0021097 scFv custom-character C0021129 scFv custom-character C0021142 scFv custom-character C0021061 scFv custom-character C0021098 scFv custom-character C0021131 scFv custom-character CEA6 scFv custom-character C0021065 scFv custom-character C0021101 scFv custom-character C0021133 scFv custom-character C0020187 scFv

[0392] FIG. 9 Enzyme Inhibition assay data for affinity-matured clones as scFv vs parent C0020187 IgG. FIG. 9 shows the results of the human trimeric ARG2 enzyme inhibition assay for a panel of purified scFv antibodies derived from the process of affinity maturing C0020187. Parent C0020187 scFv was also included in this analysis alongside the negative control scFv antibody CEA6. See below for a key for all scFv antibodies tested. All affinity-matured scFv antibodies tested in this experiment showed improvements in IC.sub.50 compared to parent C0020187 scFv.

[0393] Key:

TABLE-US-00007 custom-character C0021017 scFv custom-character C0021089 scFv custom-character C0021118 scFv custom-character C0021135 scFv custom-character C0021021 scFv custom-character C0021092 scFv custom-character C0021124 scFv custom-character C0021139 scFv custom-character C0021022 scFv custom-character C0021096 scFv custom-character C0021128 scFv custom-character C0021141 scFv custom-character C0021032 scFv custom-character C0021097 scFv custom-character C0021129 scFv custom-character C0021142 scFv custom-character C0021061 scFv custom-character C0021098 scFv custom-character C0021131 scFv custom-character CEA6 scFv custom-character C0021065 scFv custom-character C0021101 scFv custom-character C0021133 scFv custom-character C0020187 scFv

[0394] FIG. 10 Binding of IgGs to THP-1 derived human ARG2 in the presence of human plasma. FIG. 10 shows the results of the ELISA assay for binding of a panel of biotinylated recombinant human IgG1 (huIgG1-biot) clones to THP-1 lysate derived human trimeric ARG2. Binding to THP-1 lysate derived human trimeric ARG2 was tested in the presence and absence of 12.5% human plasma. See below for a key for all biotinylated recombinant human IgG1 tested. All clones showed strong binding to THP-1 lysate derived human trimeric ARG2 in the presence and absence of 12.5% human plasma. Binding signal was slightly reduced in the presence of 12.5% plasma for all clones tested. Binding to lysates prepared from wild type THP-1 cells was tested as a negative control and no binding was observed for any of the clones. Binding to recombinant human trimeric ARG2 (produced in house as described in example 1, section 1.1) was tested as a positive control and all clones showed strong binding. The negative control antibody R347 did not bind to THP-1 lysate derived human trimeric ARG2 or recombinant human trimeric ARG2 enzyme as expected.

[0395] Key:

[0396] custom-character C0020187 hu IgG1—bio

[0397] custom-character C0021022 hu IgG1—bio

[0398] custom-character C0021061 hu IgG1—bio

[0399] custom-character C0021065 hu IgG1—bio

[0400] custom-character C0021092 hu IgG1—bio

[0401] custom-character C0021133 hu IgG1—bio

[0402] custom-character C0021139 hu IgG1—bio

[0403] custom-character R347 hu IgG1—bio

[0404] custom-character no IgG

[0405] FIG. 11 Inhibition of THP-1 derived human ARG2 activity by affinity-matured IgGs in the presence of human plasma. FIG. 11 shows the results of the THP-1 lysate derived human trimeric ARG2 enzyme inhibition assay for a panel of recombinant human IgG1 derived from the process of affinity maturing C0020187. See below for a key for all recombinant human IgG1 antibodies tested. All clones inhibited the activity of THP-1 lysate derived human trimeric ARG2 with improved IC.sub.50 values compared to parent recombinant human IgG1 C0020187. The negative control antibody R347 was unable to inhibit the activity of THP-1 lysate derived human trimeric ARG2 as expected. The small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) was included as a positive control and was able to inhibit the activity of THP-1 lysate derived human trimeric ARG2.

[0406] Key:

TABLE-US-00008 custom-character C0021022 custom-character C0021133 custom-character C0021061 custom-character C0020187 custom-character C0021065 custom-character R347 custom-character C0021092 custom-character NHLA custom-character C0021139

[0407] FIG. 12 Restoration of T cell Proliferation by affinity-matured IgGs in the presence of recombinant ARG2. FIG. 12 shows the results of the T cell proliferation assay for the purified recombinant human IgG1 clones C0020187 (Parent), C0021139, C0021133, C0021092, C0021065, C0021061 and C0021022. All clones inhibited the activity of human trimeric ARG2 (exogenous), leading to an increase in T cell proliferation. The negative control antibody R347 had no effect upon T cell proliferation as expected. 1.sup.st generation affinity-matured IgG1 clones showed an improvement in potency compared to the parent IgG1 clone in the range of 7-10 fold.

[0408] FIG. 13 Inhibition of THP-1 derived human ARG2 activity by second generation affinity-matured IgGs. FIG. 13 shows the results of the THP-1 lysate derived human trimeric ARG2 enzyme inhibition assay for a panel of recombinant human IgG1 derived from the second generation affinity maturation process. See below for a key for all recombinant human IgG1 antibodies tested. All clones inhibited the activity of THP-1 lysate derived human trimeric ARG2 with improved IC.sub.50 values compared to the first generation lead recombinant human IgG1 C0021061. The negative control antibody R347 was unable to inhibit the activity of THP-1 lysate derived human trimeric ARG2 as expected. The small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) was included as a positive control and was able to inhibit the activity of THP-1 lysate derived human trimeric ARG2.

[0409] Key:

TABLE-US-00009 custom-character C0021144 IgG custom-character C0021181 IgG custom-character C0021158 IgG custom-character C0021133 IgG custom-character C0021180 IgG custom-character C0021061 IgG (First generation lead) custom-character C0021155 IgG custom-character NHLA custom-character C0021177 IgG custom-character R347 IgG

[0410] FIG. 14 Restoration of T cell Proliferation by second generation affinity-matured ARG2 specific IgGs in the presence of ARG2. FIG. 14 shows the results of the T cell proliferation assay for the purified recombinant human IgG1 clones C0020187 (Parent), C0021061, C0021158, C0021177, C0021180. All clones inhibited the activity of human trimeric ARG2 (exogenous), leading to an increase in T cell proliferation. The negative control antibody R347 had no effect upon T cell proliferation as expected. 2.sup.nd generation affinity-matured IgG1 clones showed an improvement in potency compared to the parent IgG1, C0020187.

[0411] FIG. 15 Second generation affinity-matured lead C0021158 has a not competitive MOA. (A) C0021158 IgG—effect on ARG2 V.sub.max and K.sub.m. (B) Isothermal titration calorimetry of the ARG2 small-molecule inhibitor S-(2-Boronoethyl)-L-cysteine hydrochloride (BEC) with ARG2 only and ARG2-1158 fab complex, upper and lower panel, respectively. FIG. 15 shows that the 2nd generation affinity-matured lead C0021158 has a not competitive MOA. (A) C0021158 IgG—effect on ARG2 V.sub.max and K.sub.m shows the results of a mode of action study for C0021158 recombinant human IgG1 to assess whether the antibody is a competitive, non competitive or uncompetitive inhibitor. This study utilised the human trimeric ARG2 enzyme inhibition assay. 1 μM (∘), 100 nM (□), 30 nM (Δ) and 10 nM (∇) concentrations of C0020187 recombinant human IgG1 were incubated in the presence of increasing concentrations of the substrate arginine and the impact of each inhibitor concentration on ARG2 K.sub.m and V.sub.max assessed. A no inhibitor control (⋄) was also included. Increasing concentrations of C0021158 recombinant human IgG1 had a clear impact on arginine V.sub.max values. The impact on arginine K.sub.m was less clear. (B) Isothermal titration calorimetry of the ARG2 small-molecule inhibitor S-(2-Boronoethyl)-L-cysteine hydrochloride (BEC) with ARG2 only and ARG2-1158 fab complex, upper and lower panel, respectively. Upper panel: BEC at a concentration of 0.75 mM was titrated to a solution containing 20 μM of human ARG2 (monomer concentration). Data was fitted to a one-to-one binding model using a 68.3% confidence interval as error. Lower panel: BEC at a concentration of 0.50 mM was titrated to a solution containing 20 μM of human ARG2 (monomer concentration) and 20 μM of C0021158 fab. The presence of C0021158 fab prevents BEC from binding.

[0412] FIG. 16 Inhibition of THP-1 derived human ARG2 activity by second generation affinity-matured lead C0021158, and its germ-lined and de-risked form C0021158-fgl2, shows the results of the THP-1 lysate derived human trimeric ARG2 enzyme inhibition assay for recombinant human IgG1 C0021158 (□) and its germ-lined and de-risked form C0021158-fgl2 (Δ). The process of de-risking and germ-lining C0021158 had no impact on IC.sub.50 value in this assay. Parent recombinant human IgG1 C0020187 and the small molecule arginase inhibitor NG-Hydroxy-L-arginine (NHLA) were included in this assay as positive controls and both were able to inhibit the activity of THP-1 lysate derived human trimeric ARG2 with expected IC.sub.50 values.

[0413] FIG. 17 Immunoprecipitation (IP) of ARG2 from cell culture medium (CCM) of prostate, sarcoma and ovarian cancer cell line panels. ARG2 is detected in pull downs from LNCaP, A673 and A2780-Cis cell lines, demonstrating that these cell lines release ARG2 into CCM. PNT2 was derived from normal prostate epithelium. Cell viability values (%) determined prior to IP are also shown. This shows the results of immunoprecipitation of ARG2 from CCM of prostate, sarcoma and ovarian cell line panels. The blots show that ARG2 was detected in the pull downs from CCM of LNCaP, A673 and A2780-Cis cell lines. Each blot was validated by detection of recombinant ARG2 (positive control) and not recombinant ARG1 (negative control) in the pull downs. This result demonstrates that ARG2 is released into the CCM from LNCaP, A673 and A2780-Cis cell lines. A high cell viability count underneath the blots indicate that ARG2 is released from live cells.

[0414] FIG. 18 Binding of 1st generation IgG C0021061, 2nd generation IgG C0021158, PAD antibody (positive control) and irrelevant IgG control R347 (negative control) to ARG2 from CCM of LNCaP, A673 and A2780-Cis measured using ELISA. Each bar represents mean of absorbance (A460 nm) from duplicate samples+SD. This shows binding of 1.sup.st generation IgG C0021061, 2.sup.nd generation IgG C0021158 to ARG2 from CCM of LNCaP, A673 and A2780-Cis measured using ELISA. The ARG2 PAD antibody was included as a positive control and R347 as an irrelevant IgG negative control. The significantly high absorbance values of the three CCM samples compared to R347 and media only control clearly demonstrate binding of C0021061 and C0021158 to ARG2 from LNCaP, A673 and A2780-Cis cell lines.

[0415] FIG. 19 panels (A) and (B) show top and side views, respectively of the X-ray crystal structure of the ARG2 C0020187 Fab complex, Fabs are coloured light grey and ARG2 is coloured dark grey. (C) a view of the epitope:paratope interface within the ARG2 complex with C0020187 where ARG2 is shown in dark grey, bound Fabs in medium grey (bottom right corner of the panel) and the complex is overlaid with unbound ARG2 in light grey (derived from PDB entry: 4HZE) for the purposes of comparison.

[0416] FIG. 20 panels (A) and (B) show top and side views, respectively of the X-ray crystal structure of the ARG2 C0021158 Fab complex, in which Fabs are coloured light grey and ARG2 is coloured dark grey. (C) a view of the epitope:paratope interface within the ARG2 complex with C0021158 where ARG2 is shown in dark grey, bound Fabs in medium grey (bottom right corner of the panel) and the complex is overlaid with unbound ARG2 in light grey (derived from PDB entry: 4HZE) for the purposes of comparison.

[0417] FIG. 21 panels (A) and (B) show top and side views, respectively of the X-ray crystal structure of the ARG2 C0021181 Fab complex; in which Fabs are coloured light grey and ARG2 is coloured dark grey. (C) a view of the epitope:paratope interface within the ARG2 complex with C0021181 where ARG2 is shown in dark grey, bound Fabs in medium grey (bottom right corner of the panel) and the complex is overlaid with unbound ARG2 in light grey (derived from PDB entry: 4HZE) for the purposes of comparison.

[0418] FIG. 22 shows a view of the ARG2 active site from the X-ray crystal structure of the ARG2 C0021158 Fab complex. ARG2 amino acid side chains as well as key interactions are shown. Residues are numbered according to human ARG2 Uniprot ID: P78540.

[0419] FIG. 23 shows that Fab C0021139 occupies all three protomers in ARG2, whereas the Fab of the initial lead C0020187 binds only one ARG2 subunit with high affinity, as analysed by size-exclusion chromatography (A) and dynamic light scattering (B). (A) The size-exclusion profile of 1:1 molar mixtures of ARG2 and C0020187 Fab (empty circles) displays a peak at 150 kDa indicating binding of one fab (˜50 kDa) to one ARG2 trimer (˜120 kDa). In line with this, the ARG2-C0020187 Fab mixture contains considerable amounts of unbound fab (peak at ˜19.2 ml). The size-exclusion profile of 1:1 molar mixtures of ARG2 and LO C0021139 Fab (empty triangles) shows a peak at 275 kDa suggesting binding of three Fabs (˜150 kDa) to one ARG2 trimer (˜120 kDa). Accordingly, the ARG2-C0021139 Fab mixture contains minute amounts of unbound Fab. (B) Dynamic light scattering shows an increase in the average hydrodynamic radius (R.sub.h) of ARG2-C0021139 Fab complexes (empty triangles) by 1.5 nm in comparison with R.sub.h of ARG2-C0020187 Fab complexes (empty circles).

[0420] custom-character ARG2

[0421] custom-character C0020187 Fab

[0422] custom-character C0021139 Fab

[0423] custom-character ARG2:C0020187 Fab [0424] 1:1 mixture

[0425] custom-character ARG2:C0021139 Fab [0426] 1:1 mixture

[0427] FIG. 24 Table 4 shows the Sequence identity across the entire VH sequence (Kabat residues 1 to 113) of the parental C0020187 antibody and the thirty-three affinity-matured antibodies described herein. All affinity-matured sequences share at least 90% identity with the parental C0020187 antibody. Percent diversity and percent divergence values derived from Clustal W method alignment (Thompson, Higgins et al. 1994).

[0428] FIG. 25 Table 5 shows the sequence identity across the entire VL sequence (Kabat residues 1 to 107) of the parental C0020187 antibody and the thirty-three affinity-matured antibodies described herein. All affinity-matured sequences share at least 89.1% identity with the parental C0020187 antibody. Percent diversity and percent divergence values derived from Clustal W method alignment (Thompson, Higgins et al. 1994).

[0429] FIG. 26 shows the heavy and light chain amino acid sequence alignments for clones C0020065 and C0020187.

[0430] FIG. 27 shows the heavy and light chain amino acid sequence alignments for clones C0020187, C0021017, C0021021, C0021022, C0021032, C0021061, C0021065, C0021089, C0021092, C0021096, C0021097, C0021098, C0021101, C0021118, C0021124, C0021128, C0021129, C0021131, C0021133, C0021135, C0021139, C0021141, C0021142, C0021142 IgG, C0021144, C0021155, C0021158, C0021158dr, C0021158fgl, C0021158 fgl2, C0021158 IgG, C0021177, C0021180 and C0021181.

DESCRIPTION OF EMBODIMENTS

Examples

Example 1. Anti-ARG2 Specific Antibody Isolation and Lead Selection

[0431] 1.1 Production of Trimeric Recombinant ARG2 and ARG1

[0432] Expression vectors compromising a synthetic DNA sequence encoding for human ARG2 (aa23-354), cynomolgus ARG2 (aa23-354) or human ARG1 (aa1-322) that had been codon optimised for expression in E. coli, plus flanking regions encoding for either N-terminal Avi tag (-AGLNDIFEAQKIEWHE- (SEQ ID NO: 351)) and/or C-terminal His10 tag. Amplified inserts (SEQ ID NO: 353: Avi-huARG2-His10, SEQ ID NO: 355: huARG2-His10 and SEQ ID NO: 352 Avi-huARG1-His10) containing the gene sequence of interest and tag(s) were cloned into pET16b vector (Novagen—EMD Millipore) using NcoI and XhoI restriction sites. The resulting vectors pAviHuArg2His10, pHuArg2His10 and pAviHuArg1His10 were transformed into BL21 (DE3) E. coli and a single transformed colony was used to inoculate a culture of 2×TYA, which was grown overnight at 37° C. at 280 rpm.

[0433] The overnight culture was used to inoculate 2×TYA cultures in 2 L shake flasks. Each culture was incubated at 37° C. at 280 rpm until an OD600 of 0.6. The cultures were then moved to an incubator at 18° C. before the addition of IPTG (0.5 M), the resulting cultures were then incubated overnight at 18° C. at 280 rpm.

[0434] Cultures were pelleted by centrifugation at 12,000 rpm for 20 minutes at room temperature. The supernatant was decanted off and discarded before the pellet was frozen overnight at −80° C. The resulting frozen pellet was thawed and processed for lysis using BugBuster™ Protein extraction reagent with the addition of lysonase bioprocessing reagent (Merck, 71370). Pellets were fully resuspended in BugBuster reagent at 4° C. before the addition of lysonase, after addition of lysonase the pellets were incubated at room temperature on a shaker platform at approximately 120 rpm. Lysis mixture was then pelleted by centrifugation at 20,000 rpm for 45 minutes at 4° C.

[0435] Soluble fractions were then decanted and combined into a clean bottle. Ni-NTA resin (pre-washed and equilibrated into tris 50 mM pH 8, 300 mM NaCl) was then added to supernatant and left to bind at 4° C. for 1 hour with gentle mixing. After binding, the Ni resin was filtered from the supernatant by gravity filtration through a Pierce Centrifuge column (ThermoFisher, 89898). The captured resin was washed (Ni wash buffer, tris 50 mM pH 8, 300 mM NaCl, 40 mM imidazole), and then eluted in Ni elution buffer (tris 50 mM pH 8, 300 mM NaCl, 400 mM imidazole).

[0436] The elution fraction was further purified on the Hiload 16 60 superdex 200 prep grade SEC column on the AKTAxpress by manual injection into a 5 ml loop. Column was equilibrated in and elution was performed with Tris glycerol storage buffer (25 mM tris pH8, 150 mM NaCl, 10% glycerol) and 1.5 ml fractions were collected across the entire volume of the elution. Fractions containing observable peaks were pooled and analysed by SDS-PAGE and peaks were compared to molecular weight markers to establish trimeric and monomeric fraction(s).

[0437] 1.2 Production of Monomeric Recombinant ARG2

[0438] ARG2 sequence within pAviHuARG2His10, pHuArg2His10 vectors were modified by site directed mutagenesis such that amino acid 275 was mutated from a glutamic acid to a glutamine (arginase residue number is based on human ARG2 Uniprot ID: P78540). These modified vectors were then used to express monomeric ARG2 from E. coli following the protocol used to express trimeric ARG2 as described in section 1.1.

[0439] 1.3 Phage Display Selections to Isolate ARG2 Specific scFvs

[0440] Soluble phage display selections were performed using five naïve libraries (nFL, DP47, CS, BMV and EG3) cloned into a phagemid vector based on the filamentous phage M13 (Vaughan et al., 1996). Anti-ARG2 scFv antibodies were isolated from the phage display libraries using a series of selection cycles on recombinant human biotinylated ARG2 (avi-Arg2-His10, made in house) essentially as previously described (Hawkins et al., 1992; Vaughan et al., 1996). In brief, for the first round of solution-phase selections, biotinylated human ARG2 in Dulbecco's phosphate buffered saline (DPBS, pH 7) was added (final concentration of 100 nM biotinylated human ARG2) to purified phage particles that had been pre-incubated for 1 hour in Marvel-PBS (3% w/v) containing Streptavidin-coupled paramagnetic beads (Dynabeads® M280, Invitrogen Life Sciences, UK). Streptavidin beads were removed prior to addition of antigen. Phage particles that bound to the biotinylated human ARG2 were captured using new Streptavidin-coupled paramagnetic beads, and weakly-bound phage were removed by a series of wash cycles using PBS-Tween (0.1% v/v). Bound phage particles were eluted from the beads using Trypsin (10 ng/ml final concentration diluted in 0.1 M sodium phosphate buffer; pH 7), infected into E. coli TG1 bacteria and rescued for the next round of selection (Vaughan et al., 1996). Two subsequent rounds of selection were carried out as previously described but with a reduced concentration of biotinylated ARG2 antigen, specifically 50 nM and 25 nM of biotinylated human ARG2 at round 2 and round 3, respectively.

[0441] 1.4 Identification of ARG2 Specific scFv Fragments Using a Direct-Binding Assay (Unpurified scFv)

[0442] Unpurified scFv from periplasmic preparations were screened in a homogeneous time-resolved fluorescence (HTRF™, CisBio Bioassays, France) binding assay using a Pherastar plate reader (BMG Labtech, Germany). In this assay, binding of unpurified scFv to recombinant human trimeric ARG2 enzyme was assessed by measuring the fluorescence resonance energy transfer (FRET) between the c-myc tagged scFv and the biotinylated enzyme using streptavidin cryptate and anti-c-myc-XL665 detection reagents (CisBio International, France; cat: 610SAKLB and 61 MYCXLB respectively). Selection outputs were screened as unpurified bacterial periplasmic extracts containing scFv, prepared in 200 mM tris buffer pH 7.4, 0.5 mM EDTA and 0.5 M sucrose. 5 μl of unpurified scFv samples were added to a Greiner® 384 well assay plate (Greiner Bio-one, UK; cat: 784076). This was followed by the addition of 5 μl of 12 nM recombinant human trimeric ARG2 enzyme, 5 μl of 6.67 nM streptavidin cryptate and 5 μl 40 nM anti-c-myc-XL665. Non-specific binding wells (negative controls) were defined for each plate by using a negative control unpurified scFv in place of the test scFv sample. Cross-reactive scFv clones were identified using a concurrent assay with recombinant human trimeric ARG1 enzyme. All dilutions were performed in phosphate buffered saline (ThermoFisher Scientific, UK; cat: 14190-094) containing 0.4 M KF (VWR, UK; cat: 26820.236) and 0.1% bovine serum albumin (Sigma, UK; cat: A9576) (assay buffer). Assay plates were incubated overnight at 4° C. prior to reading time resolved fluorescence on a Pherastar plate reader (PerkinElmer, USA) using an excitation wavelength of 320 nm and measuring the emission at 620 nm and 665 nm (100 flashes).

[0443] Data were analysed by calculating % Delta F values for each sample. % Delta F was determined according to equation 1.

[00001] % Delta F = ( sample 665 nm / 620 nm ratio ) - ( negative control 665 nm / 620 nm ratio ) ( negative control 665 nm / 620 nm ratio ) × 100 Equation 1

[0444] 1.5 Identification of ARG2 Inhibitory scFv Using an Enzyme Inhibition Assay (Unpurified scFv)

[0445] Unpurified anti-ARG2 scFv fragments from periplasmic preparations were screened in an ARG2 enzyme inhibition assay using a Pherastar plate reader (BMG Labtech, Germany). In this assay, the ability of unpurified scFv to inhibit the enzymatic activity of trimeric ARG2 was determined by measuring the production of urea, the product of L-arginine turnover by ARG2.

[0446] Selection outputs were screened as unpurified bacterial periplasmic extracts containing scFv, prepared in 200 mM TES buffer pH 7.4, 0.5 mM EDTA and 0.5 M sucrose. 10 μl of unpurified scFv were added to a Greiner Bio-One® 384 well assay plate (Greiner Bio-one, UK; cat: 781901). This was followed by the addition of 5 μl of 1.6 μg/ml trimeric human ARG2 that had been diluted in 40 mM MnCl.sub.2, 100 mM tris-HCl, pH7.4 (4× enzyme buffer).

[0447] Following an overnight pre-incubation of ARG2 and unpurified scFv at 4° C., the assay plate was brought to room temperature and the enzymatic reaction was started with the addition of 5 μl 100 mM L-arginine substrate and incubated for 60 min at room temperature.

[0448] Urea was detected by the simultaneous addition of equal volumes of O-Phthaldialdehyde (1.5 mM O-Phthaldialdehyde, 7% H.sub.2SO.sub.4, 0.03% Brij L23) and N-(1-Napthyl)ethylenediamine (1.66 mM N-(1-Napthyl)ethylenediamine, 81 mM Boric acid, 21% H.sub.2SO.sub.4, 0.03% Brij L23) followed by an 18 minute incubation at room temperature before the colorimetric product was quantified on the Pherastar by measuring absorbance at 505 nm.

[0449] Background control wells were defined for each plate by the omission of substrate. Maximum signal control wells were defined for each plate by using CEA6, an irrelevant unpurified scFv in place of the test scFv sample.

[0450] Data were analysed by calculating % maximum (max) control for each sample using the 505 nm absorbance data. % max control was determined according to equation 2.


% max control=100*((Test sample−mean maximum control)/(mean background control−mean maximum control))  Equation 2:

[0451] 1.6 Identification of ARG2 Specific scFv Using a Direct Binding Assay (Purified scFv)

[0452] Unpurified scFv periplasm extracts that showed specific binding to biotinylated recombinant human trimeric ARG2 enzyme by HTRF™ assay were subjected to DNA sequencing (Osbourn et al., 1996; Vaughan et al., 1996). The scFv with unique protein sequences were expressed in E. coli and purified by affinity chromatography (essentially as described (Bannister et al., 2006)). The ARG2 binding profile of each purified scFv was determined by testing a dilution series of the purified scFv in the HTRF™ assay described in section 1.4, substituting the unpurified scFv periplasmic preparation with the purified scFv. The purified scFv were tested concurrently for binding to biotinylated recombinant human trimeric ARG2 enzyme, biotinylated recombinant human trimeric ARG1 enzyme and recombinant cynomolgus monkey trimeric ARG2 enzyme. Data were analysed by calculating the % Delta F values as described in section 1.4. Example results for purified C0020187 scFv and purified C0020065 scFv are shown in FIG. 1. These results demonstrate that C0020187 scFv and C0020065 scFv specifically bind to biotinylated recombinant human trimeric ARG2 enzyme and biotinylated recombinant cynomolgus monkey trimeric ARG2 enzyme and not to human recombinant human trimeric ARG1 enzyme.

[0453] 1.7 Screening for Purified scFv Fragments which Inhibit ARG2 in an Enzyme Inhibition Assay

[0454] Purified anti-ARG2 scFv fragments were screened for their ability to inhibit enzymatic activity of trimeric ARG2 (FIG. 2) using the assay described in section 1.5.

[0455] IC.sub.50 values were determined by testing a dilution series of the purified scFv, prepared in TBS, in the ARG2 enzyme inhibition assay described in section 1.5, substituting the unpurified scFv periplasmic preparation with the purified scFv.

[0456] Background control wells were defined for each plate by the omission of substrate. Maximum signal control wells were defined for each plate in wells, which contained substrate in the absence of inhibitor. Data were analysed by calculating % maximum (max) control for each sample. % max control was determined according to equation 1 detailed in section 1.5.

[0457] Purified scFv were tested alongside N-Hydroxyl-L-Arginine (a small molecule competitive inhibitor of ARG2) as a positive control and CEA6 (irrelevant isotype control antibody) as a negative control. Data points were plotted and IC.sub.50s determined using a four-parameter fit in GraphPad Prism.

[0458] 1.8 Reformatting of ARG2 Specific, Inhibitory Antibodies from scFv to IgG,

[0459] Specific clones were converted from scFv to IgG.sub.1 by sub-cloning the variable heavy chain (VH) and variable light chain (VL) domains into vectors expressing whole human antibody heavy and light chains respectively. The variable heavy chains were cloned into a mammalian expression vector (pEU 1.3) containing the human heavy chain constant domains and regulatory elements to express whole IgG.sub.1 heavy chain in mammalian cells. Similarly, the variable light chain domain was cloned into a mammalian expression vector for the expression of the human lambda light chain constant domains (pEU4.4) or human lambda kappa light chain constant domains (pEU3.4) and regulatory elements to express whole IgG light chain in mammalian cells. Vectors for the expression of heavy chains and light chains were originally described in Persic et al., 1997. To obtain clones as IgG.sub.1, the heavy and light chain IgG expression vectors were transiently transfected into ExpiCHO (ThermoScientific UK; cat. number: A29133) cells where the antibody was expressed and secreted into the medium. Harvested media was filtered prior to purification. The IgGs were purified using Protein A chromatography (MabSelect SuRe, GE Healthcare, UK). Culture supernatants were loaded onto an appropriate Protein A column pre-equilibrated in 25 mM tris pH 7.4, 50 mM NaCl. Bound IgG was eluted from the column using 0.1 M Sodium Citrate pH 3.0, 100 mM NaCl. The IgGs were buffer exchanged into TBS 25 mM tris pH 7.4, 150 mM NaCl). The purified IgGs were passed through a 0.2 μm filter and the concentration of IgG was determined by absorbance at 280 nm using an extinction coefficient based on the amino acid sequence of the IgG. The purified IgGs were analysed for aggregation or degradation using SEC-HPLC and SDS-PAGE techniques.

[0460] 1.9 Confirming Binding Profile of ARG2 Specific Recombinant IgG, to ARG2 in a Direct Binding Assay

[0461] The purified scFv fragments that bound specifically to biotinylated recombinant human trimeric ARG2 enzyme were converted to recombinant IgG. Binding of recombinant IgG to human trimeric ARG2 enzyme was confirmed by testing a dilution series of the recombinant IgG in the HTRF™ assay described in section 1.4, substituting the unpurified scFv with the recombinant IgG. A further modification to the assay was the substitution of anti-c-myc-XL665 detection reagent with anti-human Fc XL665 detection reagent (CisBio International, France; cat: 61 HFCXLB) as the recombinant IgG had no c-myc tag. Data were analysed by calculating the % Delta F values as described in section 1.4.

[0462] 1.10 Confirming the Trimeric ARG2 Inhibition Profile of ARG2 Specific Recombinant IgG, in an Enzyme Inhibition Assay

[0463] The purified scFv fragments that inhibited the enzymatic activity of human trimeric ARG2 enzyme were converted to recombinant IgG. ARG2 specific recombinant IgG.sub.1 were screened for their ability to inhibit enzymatic activity of trimeric ARG2 (FIG. 3) using the assay described in section 1.5.

[0464] IC.sub.50 values were determined by testing a dilution series of the ARG2 specific recombinant IgG.sub.1, prepared in TBS, in the ARG2 enzyme inhibition assay described in section 1.5, substituting the unpurified scFv periplasmic preparation with the ARG2 specific recombinant IgG.sub.1.

[0465] ARG2 specific recombinant IgG.sub.1 were tested alongside N-Hydroxyl-L-Arginine (a small molecule competitive inhibitor of ARG2) as a positive control and NIP228 (irrelevant isotype control antibody) as a negative control. Data points were plotted and IC.sub.50 values determined using a four parameter fit in GraphPad Prism.

[0466] 1.11 Restoration of T Cell Proliferation by ARG2 IgGs

[0467] Anti-ARG2 antibodies were screened for their ability to restore T cell proliferation by inhibiting enzymatic activity of ARG2 and hence, prevent the depletion of the L-arginine, which is required for T cell proliferation. This assay served to provide in vitro evidence of functional efficacy for each antibody.

[0468] Briefly, Leukocyte cones (NHS Blood and Transplant, Watford, UK) underwent Ficoll Plaque (GE, Sweden; Cat: 17-1440-02) gradient separation, PBMC's were extracted and pan T cell population isolated by negative selection using the Human T Cell Enrichment Kit (Stemcell Technologies, France; Cat: 19051) according to the manufacturer's instructions.

[0469] 40000 cells/well were seeded in complete growth media (RMPI 1640, 5% Human Serum Albumin) into a 96 well clear TC treated microplate (Greiner-Bio One, Germany; Cat: 655180). T Cells were activated by the addition of ImmunoCult CD3/CD28 (Stemcell Technologies, France; Cat: 10971) at a dilution of 1:40 directly into wells and the plate incubated 37° C., 5% CO.sub.2 for 45 minutes.

[0470] To determine EC.sub.50's of test antibodies, a dilution series was created in sterile TBS at 8× the final assay concentration was added to the assay plate containing cells. Plate was incubated for 30 minutes at 37° C., 5% CO.sub.2.

[0471] ARG2 was added to relevant wells of the plate at a final concentration of 15 μg/ml. The equivalent volume of ARG2 vehicle and test antibody vehicle was added to relevant control wells. The total volume in each well was 200 μL. Cells were treated with test antibodies for a total of 72 hours at 37° C., 5% CO.sub.2. Antibodies were tested alongside N-Hydroxyl-L-Arginine (a small molecule competitive inhibitor of ARG2) as a positive control and NIP228 (irrelevant isotype control antibody) as a negative control (FIG. 4).

[0472] Assessment of T cell proliferation was performed using the BrdU Cell Proliferation Kit (Merck Millipore, UK; Cat: QIA58). BrdU labelling reagent was added after 54 hours of antibody treatment and the plate further incubated for 18 hours at 37° C., 5% CO.sub.2. The remainder of the assay was performed according to the manufacturer's instructions.

[0473] Calculated data was expressed as % of control (Equation 3) and graphical plots were constructed using a four parameter fit and EC.sub.50's determined using model 205 in XLFit (IDBS, UK).

[0474] All test sample data was corrected for background (mean of no cell control)


% Control=100*((Test Sample−Mean Positive Control)/(Mean Negative Control−Mean Positive Control))  Equation 3:

[0475] Mean Positive Control=T Cells in Absence of ARG2

[0476] Mean Negative Control=T Cells in Presence of ARG2

TABLE-US-00010 TABLE 8 Assessment of T cell proliferation (Figure 4) In Presence of rhARG2 In Absence of rhARG2 Top Maximum % Maximum % Maximum % Maximum % Clone ID Format Conc Proliferation Proliferation EC.sub.50 Proliferation Proliferation EC.sub.50 NHLA SMI 4 mM  49*  8 ND 80 13 <[0.0018 mM] NIP228 hlgG1 2 μM   7  7 >[2 μM] 90  9 <[0.0003 μM]  C0020065 hlgG1 2 μM  49  8 >[2 μM] 82  9 <[0.0008 μM]  C0020187 hlgG1 2 μM  59 11 0.971 98  6 <[0.0008 μM]  *Graphical plot of NHLA had the top two concentration data points excluded, the maximum % proliferation value corresponds to a concentration of 0.444 mM. ND = Not Determined. SMI = Small Molecule Inhibitor. C0020187 n = 2, C0020065 n = 4, NHLA n = 3, NIP228 n = 4.

[0477] This report is independent research. NHS Blood & Transport have provided material in support of the research. The views expressed in this publication are those of the author(s) and not necessarily those of NHS Blood & Transport.

[0478] 1.12 Confirming the Monomeric ARG2 Inhibition Profile of ARG2 Specific Recombinant IgG.sub.1 in an Enzyme Inhibition Assay

[0479] ARG2 specific recombinant IgG.sub.1 were screened for their ability to inhibit enzymatic activity of monomeric ARG2. In this assay, the ability of ARG2 specific recombinant IgG.sub.1 to inhibit the enzymatic activity of monomeric ARG2 was determined by measuring the production of urea, the product of L-arginine turnover by monomeric ARG2.

[0480] IC.sub.50 values were determined by testing a dilution series of the ARG2 specific recombinant IgG.sub.1, prepared in TBS.

[0481] 10 μl of ARG2 specific recombinant IgG.sub.1 (dilution series) were added to a Greiner Bio-One® 384 well assay plate (Greiner Bio-one, UK; cat: 781901). This was followed by the addition of 5 μl of 1.6 μg/ml monomeric ARG2 that had been diluted in 40 mM MnCl.sub.2, 100 mM tris-HCl, pH7.4 (4× enzyme buffer).

[0482] Following an overnight pre-incubation of monomeric ARG2 and ARG2 specific IgG.sub.1 at 4° C., the assay plate was brought to room temperature and the enzymatic reaction was started with the addition of 5 μl 100 mM L-arginine substrate and incubated for 60 min at room temperature.

[0483] Urea was detected by the simultaneous addition of equal volumes of O-Phthaldialdehyde (1.5 mM O-Phthaldialdehyde, 7% H.sub.2SO.sub.4, 0.03% Brij L23) and N-(1-Napthyl)ethylenediamine (1.66 mM N-(1-Napthyl)ethylenediamine, 81 mM Boric acid, 21% H.sub.2SO.sub.4, 0.03% Brij L23) followed by an 18 minute incubation at room temperature before the colorimetric product was quantified on the Pherastar by measuring absorbance at 505 nm.

[0484] ARG2 specific recombinant IgG.sub.1 were tested alongside N-Hydroxyl-L-Arginine (a small molecule competitive inhibitor of ARG2) as a positive control and NIP228 (irrelevant isotype control antibody) as a negative control. Data points were plotted and IC.sub.50 values determined using a four parameter fit in GraphPad Prism (FIG. 5).

[0485] 1.13 Binding Human ARG2 Produced by THP1 Cells with IgG1

[0486] C0020187 and C0020065 IgGs were tested for their ability to bind to mammalian expressed human ARG2 produced in transfected THP-1 cells. Lysates of human ARG2 transfected THP-1 cells were prepared and binding to these lysates measured using an ELISA.

[0487] Cell lysates were prepared from THP-1 cells overexpressing human ARG2 and from wild type THP-1 cells. Between 600,000-1,000,000 cells were suspended in 1 ml tris-buffered saline (25 mM tris+150 mM sodium chloride in dH.sub.2O, pH 7.4) and cell lysates prepared using QIAshredders (QIAgen, UK; cat: 79654).

[0488] For the ELISA, maxisorp white plates (Nunc; cat: 437796) were coated overnight at 4° C. with rabbit anti-human ARG2 antibody (Abcam, ab137069) at 1 μg/ml in PBS. The next day, the plate was washed with PBS and blocked with casein blocker (Thermo Scientific, 37528).

[0489] Prior to addition to the ELISA plate, cell lysates were pre-incubated for 45 minutes (with gentle shaking at room temperature) with biotinylated versions of C0020187 and C0020065 lead antibodies. Antibodies were at a final concentration of 50 μg/ml in the pre-incubation mixtures.

[0490] The blocked ELISA plate was washed with PBS and 50 μl of the pre-incubation mixtures were transferred to the ELISA plate and incubated for 90 minutes at room temperature. The ELISA plate was washed five times with PBS-Tween (0.1%) and 50 μl 1/30000 streptavidin-HRP was added to each well. The plate was incubated at room temperature for 1 hour before being washed 6 times with PBS-Tween (0.1%). Next, 100 μl PICO ELISA substrate (Thermo Scientific, 37070) was added to each well, the plate was incubated for 1 minute at room temperature in the dark before being read for luminescence using the Envision plate reader. Data were analysed using GraphPad Prism. Results are shown in FIG. 6.

[0491] 1.14 Generation of Fab Fragments to Enable Kinetic Profiling of Improved Variants.

[0492] The heavy chain mammalian expression vector pEU1.3 was modified using the Q5 SDM kit (New England Biolabs E0554) to remove the human heavy chain constant domains CH2 and CH3 and generate a vector only containing the CH1 domain and part of the Hinge region. The resulting vector is called pEU1.3 fab. Vectors for the expression of heavy chains and light chains were originally described in Persic et al., 1997. Specific clones were converted from scFv to Fab by sub-cloning the variable heavy chain (VH) and variable light chain (VL) domains into vectors expressing human fab heavy and light chains respectively. To obtain clones as IgG1, the heavy and light chain fab expression vectors were transiently transfected into ExpiCHO (ThermoScientific UK; cat. number: A29133) cells where the Fab fragment was expressed and secreted into the medium. Harvested media was filtered prior to purification. The Fabs were purified using IgG1-CH1 chromatography (CaptureSelect™ IgG-CH1 Pre-packed Column, ThermoFisher). Culture supernatants were loaded onto an appropriate CaptureSelect IgG-CH1 column pre equilibrated in 1×DPBS. Bound Fab fragments was eluted from the column using 0.1 M glycine pH 3.0. The Fab fragments were buffer exchanged into TBS (25 mM tris pH 7.4, 150 mM NaCl). The purified Fab fragments were passed through a 0.2 μm filter and the concentration of the Fabs was determined by absorbance at 280 nm using an extinction coefficient based on the amino acid sequence of the Fabs. The purified Fab fragments were analysed for aggregation or degradation using SEC-HPLC and SDS-PAGE techniques.

[0493] 1.15 Determination of Binding Affinities of Lead Antibody C0020187 to Human ARG2, Cynomolgus ARG2 and Human ARG1 Using Bio-Layer Interferometry

[0494] The OctetRED (Pall ForteBio) instrument was used to assess the kinetic parameters of the interactions between C0020187 and recombinantly produced human ARG2, cynomolgus ARG2 and human ARG1. The Octet biosensor uses an optical analytical technique that analyses the interference pattern of white light reflected from two surfaces: a layer of immobilised protein on the sensor tip, and an internal reference layer. Any changes in binding at the biosensor tip result in a shift in interference pattern, which can be measured in real time. Molecules associating with or dissociating from ligands at the biosensor tip shift the interference pattern and generate a response on the Octet system which is recorded by the acquisition software.

[0495] Typically, a defined concentration of the analyte species is brought into contact with the coupled ligand and any binding is detected as an increased in signal (association phase). This is followed by a period of buffer rinse, during which dissociation of the analyte species from the surface immobilised ligand can be observed as a decrease in signal (dissociation phase). Repetition of this with a range of analyte concentrations provides data for the analysis of binding kinetics.

[0496] An Octet Kinetics Buffer (PBS containing 0.01% BSA and 0.002% Tween20) is typically used as the diluent buffer for the analyte samples and as the flow buffer during the dissociation phase. The experimental data is recorded over time as shift in interference pattern (nm) over time, which is directly proportional to the optical thickness at the biosensor tip, which in turn is an approximate measure of the mass of analyte bound. The proprietary Octet Data Analysis software package can then be used to process data and fit binding models to the data sets. Returned association (k.sub.a, M.sup.−1 s.sup.−1) and dissociation (k.sub.d, s.sup.−1) rate constants allow calculation of dissociation (K.sub.D, M) affinity constants.

[0497] The affinity of binding between the Fab of C0020187 and human ARG2, cynomolgus ARG2 and human ARG1 was estimated using assays in which the biotinylated ARG antigen was captured on a streptavidin sensor tip. A fresh sensor tip was used for each measurement and no regeneration was used. A series of dilutions of the C0020187 Fab (3.25-240 nM) were individually placed in contact with the ligand surface for a sufficient amount of time to observe sensorgrams that could be fitted to an appropriate binding model with confidence (typically 5 minutes), followed by an appropriate length of dissociation time (typically 10 minutes). Blank reference (0 nM Fab) data were subtracted from each dataset to reduce the impact of any buffer artefacts or non-specific binding effects. An appropriate binding model was then fitted simultaneously to the data from each analyte titration using the Octet Evaluation software.

[0498] Example results for C0020187 are shown in Table 9, showing the association rate constants (k.sub.a), dissociation rate constants (k.sub.d) and dissociation constants (K.sub.D). These parameters were derived from a 1:1 binding fit to the data.

TABLE-US-00011 TABLE 9 Affinity Data for C0020187 and ARG2 interaction K.sub.D K.sub.D k.sub.a k.sub.a k.sub.d k.sub.d Ligand Analyte (M) Error (1/Ms) Error (1/s) Error Human C0020187 8.35E−09 9.57E−11 6.92E+04 6.20E+02 5.77E−04 4.14E−06 ARG2 Fab Cyno C0020187 6.26E−09 7.07E−11 1.01E+05 8.62E+02 6.31E−04 4.66E−06 ARG2 Fab Human C0020187 No binding ARG1 Fab

[0499] 1.16 Understanding the Mechanism of Action of ARG2 Specific IgGs on the Enzyme ARG2

[0500] The mechanism of action of the lead identification clone C0020187 IgG was investigated using the human ARG2 (trimer) enzyme inhibition assay.

[0501] The enzyme inhibition assay is described in sections 1.5 and is a biochemical assay that measures production of urea, the product of L-arginine turnover by ARG2. To investigate the mechanism of action of C0020187 IgG, four point titrations of C0020187 IgG (10, 3, 1 and 0.3 μM) were set up in the presence of 11 concentrations of arginine (500, 400, 300, 200, 125, 75, 50, 25, 17, 10 and 5 mM) and the reaction allowed to proceed for 80, 60, 45, 30, 15 or 5 minutes before the addition of the urea detection reagents O-Phthaldialdehyde and N-(1-Napthyl)ethylenediamine.

[0502] Raw data from each separate concentration of C0020187 was plotted as a function of time for each concentration of arginine and fitted using a linear fit (GraphPad Prism) to derive initial velocities (slope values).

[0503] Initial velocity data was plotted against arginine concentration for each concentration of C0020187 IgG see FIG. 7. Each trace was fitted to the Michaelis-Menten model (Y=V.sub.max*X/(K.sub.m+X)) in GraphPad Prism to derive maximum velocity (V.sub.max) and enzyme/substrate affinity (K.sub.n) values at each inhibitor concentration (Table 10).

TABLE-US-00012 TABLE 10 V.sub.max (AU ms.sup.−1) K.sub.m (mM) R square  10 μM C0020187 IgG 141.4 3.16 0.5218   3 μM C0020187 IgG 196.4 5.59 0.7072   1 μM C0020187 IgG 244.2 12.31 0.9222 0.3 μM C0020187 IgG 270.2 13.36 0.9360 No inhibitor 519.8 27.97 0.9841

[0504] The mechanism of action of enzyme inhibitors can be broadly divided into competitive, uncompetitive and non-competitive and can be identified as such based on their effects on K.sub.m and V.sub.max.

[0505] A competitive inhibitor binds only to free enzyme, often at the active site, causing the affinity of the enzyme for the substrate to be reduced (increased K.sub.m) with no change to the maximum enzyme rate (V.sub.max).

[0506] An uncompetitive inhibitor binds exclusively to the enzyme-substrate complex yielding an inactive enzyme-substrate-inhibitor complex. The enzyme's affinity for the substrate is increased (K.sub.m is decreased) and the maximum enzyme rate (V.sub.max) is decreased.

[0507] A non-competitive inhibitor binds equally well to free enzyme and enzyme-substrate complex. The enzyme's affinity for the substrate (K.sub.m) is unchanged and the maximum enzyme rate (V.sub.max) is decreased.

[0508] In the case of C0020187 IgG inhibitor it V.sub.max decreased in the presence of C0020187 IgG inhibitor, ruling out a competitive mode of action and pointing towards an uncompetitive or a non-competitive mode of action. To distinguish non-competitive from uncompetitive modes of action the effect on K.sub.m must be assessed. Unfortunately, the initial velocity/arginine concentration plots had an unusual profile where, in the presence of inhibitor, the initial anticipated increase in initial velocity is followed by a drop as arginine concentration increases. This uncharacteristic profile lead to poor fitting of the data making it difficult to derive an accurate K.sub.m. The lack of accurate K.sub.m data means C0020187 IgG cannot be assigned as uncompetitive or non-competitive. It is only possible to state that the inhibitor is ‘not competitive’.

Example 2—Affinity Maturation of C0020187 by Targeted and StEP SHUFFLE Mutagenesis Using Phage and Ribosome Display

[0509] 2.1 Targeted Mutagenesis of Antibody C0020187 by Phage Display

[0510] The lead antibody C0020187 was optimised for improved affinity to human ARG2 using a targeted mutagenesis approach with affinity-based phage display selections. Twelve large scFv-phage libraries derived from C0020187 were created by oligonucleotide-directed mutagenesis of the variable heavy (V.sub.H) and variable light (V.sub.L) chain complementarity determining regions 1, 2 and 3 (CDR1, CDR2, CDR3) using standard molecular biology techniques as described by Clackson and Lowman ((2004) A Practical Approach, Oxford University Press).

[0511] Libraries were subjected to affinity-based phage display selections to enrich for variants with higher affinity for human ARG2. The selections were performed essentially as described previously (Hawkins et al., 1992; Schier et al., 1996; Thompson et al., 1996). In brief, the scFv phage particles were incubated with biotinylated human ARG2 (avi-Arg2-His10, made in house) in solution. ScFv-phage that bound to the antigen were then captured on streptavidin-coated paramagnetic beads (Dynabeads® M280, Invitrogen Life Sciences, UK) following the manufacturer's recommendations. The selected scFv-phage particles were then rescued as described previously (Osbourn et al., 1996). The selection process was repeated for five successive rounds, in the presence of decreasing concentrations of biotinylated human ARG2 target antigen (30 nM antigen at round 1 falling to 10 pM antigen by round 5).

[0512] 2.2 Recombination of Successful Selection Outputs to Produce “Binary” Libraries, and their Subsequent Affinity Optimisation

[0513] Collectively, screening of C0020187 CDR-targeted mutagenesis library outputs in the C0020187 epitope competition (Section 2.4) and human ARG2 enzyme inhibition assay (Section 1.5) enabled identification of individual CDR-targeted phage display selection output libraries displaying overall improvements in huARG2 direct binding and inhibition, relative to parent C0020187 scFv. Specifically, four targeted mutagenesis libraries, (covering the V.sub.HCDR1, V.sub.HCDR2, V.sub.LCDR2 and V.sub.LCDR3), were recombined in a pair-wise fashion to produce four “binary” recombination libraries in which two of the six CDRs were mutated. For example, the affinity-matured library covering the V.sub.HCDR1 was randomly recombined with the affinity-matured V.sub.LCDR2 library to generate a V.sub.H1:V.sub.L2 library. The remaining libraries were produced as: V.sub.H1:V.sub.L3, V.sub.H2:V.sub.L2 and V.sub.H2:V.sub.L3. A subset of each recombination library was sequenced to verify the integrity of each library.

[0514] Soluble phage display selections utilising these recombination libraries were completed as previously described (Section 1.3) in the presence of decreasing concentrations of biotinylated human ARG2 (avi-Arg2-His10, made in house; 1 nM decreasing to 5 pM over the course of three successive rounds of selection). As before, all recombination library selection outputs were screened in the C0020187 epitope competition (Section 2.4) and human ARG2 enzyme inhibition assay (Section 1.5)

[0515] 2.3 Recombination of Phage-Optimised CDR Blocks & Selections Using Ribosome Display

[0516] Ribosome display is described in Hanes J and Plückthun A. (1997).

[0517] Modest (approx. 8-fold) improvements in C0020187's affinity were achieved using the single CDR targeting and subsequent binary CDR recombination approaches described in Section 2.1. To drive for further improvements in C0020187 affinity, two additional strategies were followed, in parallel. The first strategy corresponded to a targeted CDR recombinatorial approach focusing on two CDRs: V.sub.HCDR2 and V.sub.LCDR2. The second strategy was a non-biased approach recombining outputs from all six CDRs. This second non-biased strategy enabled the entire scFv sequence space to be sampled, enabling both intra and inter-chain recombination events (Zhao et al., 1998) that would not be possible using standard targeted (biased) recombinatorial approaches.

[0518] Recombinatorial PCR was used to combine the phage-optimised V.sub.HCDR2 and V.sub.LCDR2 repertoires into a single population of full-length scFv clones, to generate a V.sub.HCDR2/V.sub.LCDR2 recombination library (H2L2). For the non-biased recombination library, the phage-optimised outputs from V.sub.HCDR1, V.sub.HCDR2, V.sub.HCDR3, V.sub.LCDR1, V.sub.LCDR2 and V.sub.LCDR3 were used as template for V.sub.H/V.sub.L chain shuffling by recombinatorial PCR (Shuffle library). The resulting library was also subjected to random recombination using the Staggered-extension process (StEP) in vitro DNA recombination (Zhao et al., 1998) to promote additional intra-chain recombinations (StEP library).

[0519] The libraries of recombined scFv constructs were then modified into the ribosome display format using standard molecular biology methods. The ribosome display construct include the structural features necessary for ribosome display, including a 5′ and 3′ stem loop to prevent degradation of the mRNA transcript by exonucleases, a Shine-Dalgarno sequence to promote ribosome binding to the mRNA transcript, and a geneIII spacer that allows the translated scFv molecule to fold while still remaining attached to the ribosome (Groves et al., 2005).

[0520] The libraries were then used in affinity-based soluble ribosome display selections to enrich for variants with higher affinity for human ARG2. The selections were performed essentially as described in Hanes et al., 2000. In brief, each recombination library was individually transcribed into mRNA. Using a process of stalled translation, mRNA-ribosome-scFv tertiary complexes were formed (Hanes et al., 1997). These complexes were then subjected to three rounds of selection incubated in the presence of decreasing concentrations of synthetic biotinylated human ARG2 to select for variants with higher affinity. Those complexes that bound to the antigen were then captured on streptavidin-coated paramagnetic beads (Dynabeads™, Invitrogen, UK; cat: 112-05D) and non-specific ribosome complexes were washed away. The mRNA was subsequently isolated from the bound ribosomal complexes, reverse transcribed to cDNA and then amplified by PCR. This DNA was used for the next round of selection.

[0521] After affinity maturation, the selection outputs were cloned out for screening purposes. The scFv isolated by ribosome display were cloned into the phagemid vector pCANTAB6 by NotI/NcoI restriction endonuclease digestion of the ribosome display construct (New England BioLabs, USA; cat: R0189L, R0193L) followed by ligation into NotI/NcoI digested pCANTAB6 using T4 DNA ligase (New England BioLabs, USA; cat: M0202L) essentially as described by McCafferty et al., 1994.

[0522] 2.4 Identification of Improved Clones from Phage and Ribosome Display Using an Epitope Competition Assay

[0523] Two thousand and twenty four scFv chosen at random from selection rounds 3 and 4 of the targeted mutagenesis approach described in section 2.2, 2.3 and 2.4 were expressed in E. coli to produce unpurified periplasmic scFv. Those scFv capable of competing with C0020187 IgG for binding to recombinant human trimeric ARG2 enzyme (i.e., those scFv that bind at or near the epitope bound by C0020187 IgG) were elucidated in a competition format assay, using the HTRF™ platform. Specifically, fluorescence resonance energy transfer (FRET) was measured between streptavidin cryptate (associated with biotinylated recombinant human trimeric ARG2 enzyme) and anti-human Fc XL665 (associated with C0020187 IgG) in the presence of a single concentration of each unpurified periplasmic test scFv. Successful occupation of the C0020187 IgG epitope on the enzyme by scFv resulted in a reduction in FRET, as measured on a fluorescence plate reader.

[0524] A ‘Maximum’ binding signal was determined by analysing the binding of C0020187 IgG to biotinylated recombinant human trimeric ARG2 enzyme in the absence of competitor scFv. The ‘Sample’ signals were derived from analysing the binding of C0020187 IgG to biotinylated recombinant human trimeric ARG2 enzyme in the presence of a test scFv sample. Finally, a ‘Background’ signal was determined by analysing the fluorescence generated in the absence of C0020187 IgG.

[0525] Unpurified periplasmic scFv were supplied in sample buffer consisting of 200 mM tris base, pH 7.4, 0.5 mM EDTA, and 0.5 M sucrose. 5 μl of each scFv were transferred to the ‘Sample’ wells of a black, shallow, solid bottom, non-binding 384-well assay plate using a liquid handling robot. The remaining reagents (prepared in assay buffer) were added to the assay plate by multichannel pipette in the following order: 5 μl detection cocktail, consisting of 6.6 nM streptavidin cryptate and 40 nM anti-human Fc XL665 (to all wells), 5 μl 12 nM biotinylated recombinant human trimeric ARG2 enzyme (to all wells), 5 μl 16 nM C0020187 IgG (to ‘Sample’ and ‘Maximum’ wells), and 5 μl sample buffer (to background wells). Assay plates were sealed and then incubated overnight at room temperature in the dark, prior to measuring time-resolved fluorescence at 620 and 665 nm emission wavelengths on a fluorescence plate reader.

[0526] Data were analysed by calculating % Delta F values for each sample. % Delta F was determined according to equation 1.

[00002] % Delta F = ( sample 665 nm / 620 nm ratio ) - ( negative control 665 nm / 620 nm ratio ) ( negative control 665 nm / 620 nm ratio ) × 100 Equation 1

[0527] Delta F values were subsequently used to calculate normalised binding values as described in equation 4.

[00003] Normalised data ( % Control ) = % Delta F of sample % Delta F of Maximum binding control × 100 Equation 4

[0528] Unpurified periplasmic scFv demonstrating significant inhibition of C0020187 IgG binding to biotinylated recombinant human trimeric ARG2 enzyme were subjected to DNA sequencing (Osbourn et al., 1996; Vaughan et al., 1996). The scFv found to have unique protein sequences were expressed in E. coli and purified by affinity chromatography followed by buffer exchange.

[0529] The potency of each purified scFv was determined by testing a dilution series of the scFv (typically 4 pM-1200 nM) in the epitope competition assay described above. Data were again analysed by calculating the % Delta F and % Control binding values for each sample.

[0530] ScFv sample concentration was plotted against % Control using scientific graphing software, and any concentration-dependent responses were fitted with non-linear regression curves. IC.sub.50 values were obtained from these analyses (FIG. 8, Table 11).

TABLE-US-00013 TABLE 11 IC.sub.50 values (M) for clones in scFv format in 187 IgG epitope competition assay (FIG. 8) 18° IgG epitope competition assay Clone ID IC50 (M) C0020187 scFv 1.58E−06 C0021017 scFv 1.22E−07 C0021021 scFv 5.87E−08 C0021022 scFv 6.59E−08 C0021032 scFv 6.70E−08 C0021061 scFv 1.01E−07 C0021065 scFv 7.47E−08 C0021089 scFv 1.33E−07 C0021092 scFv 1.30E−07 C0021096 scFv 3.52E−08 C0021097 scFv 2.75E−08 C0021098 scFv 4.83E−08 C0021101 scFv 4.08E−08 C0021118 scFv 4.17E−08 C0021124 scFv 5.05E−08 C0021128 scFv 4.45E−08 C0021129 scFv 4.50E−08 C0021131 scFv 4.57E−08 C0021133 scFv 4.33E−08 C0021135 scFv 5.20E−08 C0021139 scFv 4.01E−08 C0021141 scFv 5.11E−08 C0021142 scFv 5.78E−08

[0531] Reagent/Equipment sources: tris base (Sigma, UK; cat: RDD008), potassium fluoride (VWR chemicals, Belgium; cat: 26820.236), bovine serum albumin solution (Sigma, UK; cat: A7284), C0020187 IgG (produced in-house), biotinylated recombinant human trimeric ARG2 enzyme (produced in-house), Streptavidin cryptate (Cisbio, France; cat: 610SAKLB), anti-Human-IgG-XL665 (Cisbio, France; cat: 61 HFCXLB), 384-well assay plates (Greiner BioOne, Germany; cat: 784076), 384-well dilution plates (Greiner BioOne, Germany; cat: 781280), liquid handling robot (Hamilton Star™, Hamilton, USA), fluorescence plate reader (Pherastar™, BMG Labtech, USA), HTRF technology (Cisbio International, France), graphing/statistical software (Prism, GraphPad USA).

[0532] 2.5 Identification of Improved Clones Using the Enzyme Inhibition Assay

[0533] The unpurified periplasmic scFv that were tested in the epitope competition assay described in Section 2.4 were simultaneously screened for their ability to inhibit enzymatic activity of trimeric human ARG2 in the assay described in section 1.5. C0020187 was also included in this assay, as an unpurified periplasmic scFv, and used as a benchmark against which improved clones could be identified. Improved clones were required to show an increase of 5% or more inhibition over the inhibition observed with C0020187.

[0534] Unpurified periplasmic scFv demonstrating significant improvement over C0020187 IgG were subjected to DNA sequencing (Osbourn et al., 1996; Vaughan et al., 1996). The scFv found to have unique protein sequences were expressed in E. coli and purified by affinity chromatography followed by buffer exchange.

[0535] The potency of each purified scFv was determined by testing a dilution series of the scFv (typically 4 pM-1200 nM) in the enzyme inhibition assay described in section 1.5. Data were again analysed by calculating % Max control values for each sample.

[0536] ScFv sample concentration was plotted against % Max control using scientific graphing software, and any concentration-dependent responses were fitted with non-linear regression curves. IC.sub.50 values were obtained from these analyses (FIG. 9, Table 12).

TABLE-US-00014 TABLE 12 IC.sub.50 values (M) for clones in scFv format in trimeric human ARG2 EIA Trimeric human ARG2 Clone ID EIA IC50 (M) C0020187 scFv 9.64E−07 C0021017 scFv 2.26E−07 C0021021 scFv 1.51E−07 C0021022 scFv 1.06E−07 C0021032 scFv 2.11E−07 C0021061 scFv 1.10E−07 C0021065 scFv 1.43E−07 C0021089 scFv 7.15E−08 C0021092 scFv 1.59E−07 C0021096 scFv 5.78E−08 C0021097 scFv 9.91E−08 C0021098 scFv 1.34E−07 C0021101 scFv 6.48E−08 C0021118 scFv 8.41E−08 C0021124 scFv 3.75E−07 C0021128 scFv 1.69E−07 C0021129 scFv 3.13E−07 C0021131 scFv 2.51E−07 C0021133 scFv 2.81E−07 C0021135 scFv 2.20E−07 C0021139 scFv 1.88E−07 C0021141 scFv 1.09E−07 C0021142 scFv 9.76E−08

[0537] 2.6 Reformatting of Affinity Improved scFv to Human IgG.sub.1

[0538] ScFv of optimised sequence were reformatted by the same procedure described for reformatting of lead clones as described in Section 1.8.

[0539] 2.7 Binding of THP1 Derived ARG2 in Presence of Plasma.

[0540] The panel of improved variant antibodies was tested for binding to cell lysates from THP-1 cells overexpressing human ARG2 and parental THP-1 cell line in presence and absence of human healthy plasma (FIG. 10). The cell lysates were prepared in TBS buffer and the total protein concentration was established by BCA assay (Thermo Scientific, 23227). Human plasma was obtained from NHS BT Cambridge (batch: 15 Aug. 2016).

[0541] Six ARG2 affinity-matured IgGs (C0021022, C0021061, C0021065, C0021092, C0021133 and C0021139) were tested alongside parental clone C0020187 as well as irrelevant IgG control R347 and no IgG control. Briefly, maxisorp white plate (Nunc, 437796) was coated O/N at 4° C. with rabbit anti-human ARG2 antibody (abcam, ab137069) at 1 μg/ml in PBS. Next day, plate was washed with PBS and blocked with Casein blocker (Thermo Scientific, 37528). Cell lysates from THP-1-ARG2 positive cell line and THP-1 parental cell line were diluted in TBS buffer to 1 mg/ml and tested supplemented with 12.5% final concentration of urea depleted human healthy plasma or without plasma. 60 μl of each cell lysate were aliquoted into Greiner PP plate (Greiner, 650201). Recombinant human ARG2-HIS (PSPUR016), prepared at 1 μg/ml in TBS buffer, was used as a positive control and TBS buffer alone or 12.5% plasma in TBS were used as negative controls. In-house ARG2 specific human IgGs and irrelevant R347 IgG (all biotinylated) were added to the cell lysates, recombinant human ARG2 and TBS buffer to a final concentration of 50 μg/ml (no IgG control was also included) and incubated at RT with gentle shaking for 45 min. Blocked ELISA plate was washed with PBS and 50 μl of pre-incubated in the previous step samples was transferred to the ELISA plate and incubated stationary for 90 min at RT. Plate was washed 5 times with PBST (0.1%). 50 μl of Streptavidin-HRP (abcam, ab7403), diluted 1/10000 in casein buffer (1/20 dilution of stock) was added to each well and plate was incubated stationary at RT for 1 hour. After 5 washes with PBST, PICO ELISA substrate (Thermo Scientific, 37070) was prepared following manufacturer's instructions and 100 μl were added to each well. Plate was incubated for 1 min in the dark with gentle shaking and luminescence was read using Envision plate reader. Data were analysed using GraphPad Prism. Results are shown in FIG. 10 for the following:

TABLE-US-00015 1-THP1-Arg2 cell lysate (1 mg/ml) 2-THP1-parental cell lysate (1 mg/ml) 3-THP1-Arg2 cell lysate (1 mg/ml) + 12.5% human healthy plasma (urea depleted) 4-THP1-parental cell lysate (1 mg/ml) + 12.5% human healthy plasma (urea depleted) 5-TBS + 12.5% human healthy plasma (urea depleted) 6-Recombinant human Arg2 PSPUR016 (1 μg/ml in TBS) 7-TBS

[0542] All ARG2 IgGs showed specific binding to ARG2 expressing THP-1 cell lysates and recombinant human ARG2 with affinity-matured clones showing higher positive signal compared to parental C0020187.

[0543] 2.8 Inhibition of THP-1 Derived ARG2 by Improved Variant IgGs

[0544] Anti-ARG2 IgGs were tested for their ability to inhibit mammalian expressed human ARG2 produced in transfected THP-1 cells. To do this cell lysates were prepared from THP-1 cells overexpressing human ARG2 and from wild type THP-1 cells. 350 million cells were suspended in 3 ml tris buffered saline (25 mM Tris+150 mM sodium chloride in dH.sub.2O, pH 7.4) and cell lysates prepared by passing through a 26G needle 20 times. A BCA assay was used to measure the protein concentration in the lysate. To determine the IC.sub.50 values of test antibodies, a dilution series of the test antibodies were created in TBS and 5 μl were added to 10 μl lysate/human plasma mixture (1.15 mg/ml lysate, 25% (v/v) urea depleted human plasma and 20 mM MnCl.sub.2 and incubated for 2 hours at room temperature in a 384 well plate. The enzymatic reaction was started with the addition of 5 μl 100 mM L-arginine substrate and incubated for 1 hour at room temperature. Urea detection reagents, O-Phthaldialdehyde (1.5 mM O-Phthaldialdehyde, 7% H.sub.2SO.sub.4, 0.03% Brij L23) and N-(1-Napthyl)ethylenediamine (1.66 mM N-(1-Napthyl)ethylenediamine, 81 mM Boric acid, 21% H.sub.2SO.sub.4, 0.03% Brij L23) were mixed 1:1 just prior to use and 80 μl/well was added, incubated for 2 hours at room temperature and absorbance at 505 nm was read on a Pherastar plate reader. Antibodies were tested alongside N-Hydroxyl-L-Arginine (a small molecule competitive inhibitor of ARG2) as a positive control and CEA6 (irrelevant isotype control antibody) as a negative control. Data points were plotted and IC.sub.50 values determined using a four parameter fit in GraphPad Prism (FIG. 11, Table 13).

TABLE-US-00016 TABLE 13 IC.sub.50 (M) THP-1 ARG2 THP-1 ARG2 (healthy Inhibitor (no plasma) human plasma) C0021022 IgG 5.81e−9 2.71e−9 C0021061 IgG 6.79e−9 2.90e−9 C0021065 IgG 5.99e−9 2.98e−9 C0021092 IgG 6.56e−9 2.82e−9 C0021139 IgG 5.75e−9 2.02e−9 C0021133 IgG 6.68e−9 3.70e−9 IC.sub.50 values are averaged data from n = 2 experiments.

[0545] 2.9 Restoration of T Cell Proliferation by Improved Variant ARG2 Specific IgGs in the Presence of ARG2

[0546] Anti-ARG2 antibodies were screened for their ability to restore T cell proliferation by inhibiting enzymatic activity of ARG2 and hence, the depletion of L-arginine, which is required for T cell proliferation. This assay served to provide evidence of improved functional efficacy for each affinity-matured antibody in comparison to the parent IgG, C0020187 (FIG. 12).

[0547] Lead optimisation clones were tested to an endpoint treatment time of 96 hours and the BrdU Cell Proliferation Kit (Roche, France; Cat: 11647229001) was used according to the manufacturer's instructions. R347 was used as the irrelevant control. All clones tested n=2.

TABLE-US-00017 TABLE 14 In Presence of rhARG2 In Absence of rhARG2 Top Maximum % Maximum % Maximum % Maximum % Clone ID Format Conc Proliferation Proliferation SD EC.sub.50 Proliferation Proliferation SD EC.sub.50 R347 hlgG1 1.97 μM  −0.5  0.3  >[1.97 μM]  95  5 <[0.0009 μM] C0021022 hlgG1 2.12 μM   77   31     0.132 μM 106 12  <[0.001 μM] C0021061 hlgG1 1.97 μM   83   10     0.113 μM  99  5 <[0.0009 μM] C0021065 hlgG1   2 μM   87    7     0.136 μM 101  7 <[0.0009 μM] C0021092 hlgG1 2.17 μM   77   11     0.116 μM  92  7 <[0.0009 μM] C0021133 hlgG1  1.6 μM   73    8     0.101 μM  90  7 <[0.0007 μM] C0021139 hlgG1 2.17 μM   67   10     0.111 μM  84  9  <[0.001 μM] C0020187 hlgG1   2 μM   68   17      1.07 μM 101 11 <[0.0009 μM]

[0548] Leukocyte cones underwent Ficoll Plaque (GE, Sweden; Cat: 17-1440-02) gradient separation, PBMC's were extracted and pan T cell population isolated by negative selection using the Human T Cell Enrichment Kit (Stemcell Technologies, France; Cat: 19051) according to the manufacturer's instructions.

[0549] 40000 cells/well were seeded in complete growth media (RMPI 1640, 5% Human Serum Albumin) into a 96 well clear TC treated microplate (Greiner-Bio One, Germany; Cat: 655180). T cells were activated by the addition of ImmunoCult CD3/CD28 (Stemcell Technologies, France; Cat: 10971) at a dilution of 1:40 directly into wells and the plate incubated 37° C., 5% CO.sub.2 for 45 minutes.

[0550] To determine EC.sub.50's of test antibodies, a dilution series was created in sterile TBS/NaCl Buffer at 10× the final assay concentration added to the assay plate containing cells. Plate was incubated for 30 minutes at 37° C., 5% CO.sub.2.

[0551] ARG2 was added to relevant wells of the plate at a final concentration of 15 μg/ml. The equivalent volume of ARG2 vehicle and test antibody vehicle was added to relevant control wells. The total volume in each well was 200 μl. Cells were treated with test antibodies for a total of 96 hours at 37° C., 5% CO.sub.2. Antibodies were tested alongside C0020187 (parent IgG) as a positive control and R347 (irrelevant isotype control antibody) as a negative control.

[0552] Assessment of T cell proliferation was performed using the BrdU Cell Proliferation ELISA Kit (Roche, Germany; Cat: 000000011647229001). BrdU labelling reagent was added after 78 hours of antibody treatment and the plate further incubated for 18 hours at 37° C., 5% CO.sub.2. The remainder of the assay was performed according to the manufacturer's instructions.

[0553] Calculated data was expressed as % of control (Equation 3) and graphical plots were constructed using a four parameter fit and EC.sub.50's determined using model 205 in XLFit (IDBS, UK).

[0554] All test sample data was corrected for background (mean of no cell control)


% Control=100*((Test Sample−Mean Positive Control)/(Mean Negative Control−Mean Positive Control))  Equation 3:

[0555] Mean Positive Control=T Cells in absence of ARG2

[0556] Mean Negative Control=T Cells in presence of ARG2

[0557] 2.10 Kinetic Profiling of Affinity Improved Clones as Fabs Using Bio-Layer Interferometry (BLI)

[0558] The affinities of the affinity-matured antibodies to human ARG2 were measured on the OctetRED system as described in section 1.15 using the streptavidin capture method. Typically, an analyte titration range of 1.8 to 120 nM was used. The derived affinities to human ARG2 and cynomolgus ARG2 are shown in Table 15 and 16, respectively.

TABLE-US-00018 TABLE 15 Determination of binding affinities of affinity-matured antibodies, as Fab, to human ARG2 using Bio-Layer Interferometry K.sub.D K.sub.D k.sub.a k.sub.a k.sub.d k.sub.d Ligand Analyte (M) Error (1/Ms) Error (1/s) Error Human C0021021 4.24E−09 4.40E−11 4.73E+05 4.59E+03 2.00E−03 7.36E−06 ARG2 Fab Human C0021022 2.73E−09 2.59E−11 4.12E+05 3.46E+03 1.12E−03 5.01E−06 ARG2 Fab Human C0021032 5.33E−09 5.03E−11 4.27E+05 3.81E+03 2.28E−03 6.99E−06 ARG2 Fab Human C0021061 1.30E−09 5.64E−12 2.71E+05 7.34E+02 3.51E−04 1.20E−06 ARG2 Fab Human C0021065 1.62E−09 1.34E−11 4.09E+05 2.63E+03 6.65E−04 3.46E−06 ARG2 Fab Human C0021092 2.69E−09 2.41E−11 2.80E+05 2.09E+03 7.55E−04 3.76E−06 ARG2 Fab Human C0021096 3.48E−09 3.63E−11 4.41E+05 4.22E+03 1.54E−03 6.37E−06 ARG2 Fab Human C0021097 4.95E−09 3.42E−11 2.95E+05 1.90E+03 1.46E−03 3.68E−06 ARG2 Fab Human C0021101 3.41E−09 3.47E−11 3.14E+05 2.84E+03 1.07E−03 4.93E−06 ARG2 Fab Human C0021118 8.23E−09 5.26E−11 1.39E+05 7.78E+02 1.14E−03 3.53E−06 ARG2 Fab Human C0021128 2.53E−09 8.48E−12 2.66E+05 7.38E+02 6.74E−04 1.27E−06 ARG2 Fab Human C0021133 2.05E−09 6.44E−12 2.19E+05 5.14E+02 4.49E−04 9.32E−07 ARG2 Fab Human C0021139 4.41E−09 1.78E−11 1.98E+05 7.20E+02 8.71E−04 1.50E−06 ARG2 Fab Human C0021141 3.33E−09 3.50E−11 3.26E+05 3.02E+03 1.08E−03 5.35E−06 ARG2 Fab Human C0021142 2.77E−09 2.81E−11 3.99E+05 3.54E+03 1.10E−03 5.48E−06 ARG2 Fab

TABLE-US-00019 TABLE 16 Determination of binding affinities of a smaller panel of antibodies to cynomolgus ARG2 using Bio-Layer Interferometry K.sub.D K.sub.D k.sub.a k.sub.a k.sub.d k.sub.d Ligand Analyte (M) Error (1/Ms) Error (1/s) Error Cyno C0021022 1.66E−09 1.82E−11 7.06E+05 6.79E+03 1.17E−03 6.10E−06 ARG2 Fab Cyno C0021061 9.53E−10 5.20E−12 3.10E+05 9.14E+02 2.96E−04 1.36E−06 ARG2 Fab Cyno C0021065 1.27E−09 1.33E−11 6.17E+05 5.22E+03 7.82E−04 4.90E−06 ARG2 Fab Cyno C0021092 2.05E−09 1.93E−11 3.54E+05 2.68E+03 7.26E−04 4.09E−06 ARG2 Fab Cyno C0021128 1.77E−09 6.94E−12 4.37E+05 1.40E+03 7.71E−04 1.76E−06 ARG2 Fab Cyno C0021133 1.67E−09 5.69E−12 3.28E+05 8.32E+02 5.49E−04 1.24E−06 ARG2 Fab Cyno C0021139 2.63E−09 1.02E−11 2.75E+05 8.91E+02 7.24E−04 1.54E−06 ARG2 Fab

[0559] 2.11 Testing for Binding to Human ARG1

[0560] The binding of affinity-matured antibodies to human ARG1 was also tested on the OctetRED system using a screening assay which stably captures His-tagged ARG2 as the ligand on an anti-His surface. The Fabs were typically tested in an analyte range of 1.8 to 120 nM, with an association time of 5 minutes and a dissociation time of 10 minutes. Sensors were regenerated using 10 mM glycine pH 1.5 after each cycle. The results are shown in Table 17.

TABLE-US-00020 TABLE 17 Testing the binding of a smaller panel of lead antibodies, as Fab, to human ARG1 using Bio-Layer Interferometry Ligand Analyte Results Human ARG1 C0021022 Fab No binding observed Human ARG1 C0021061 Fab No binding observed Human ARG1 C0021065 Fab No binding observed Human ARG1 C0021092 Fab No binding observed Human ARG1 C0021128 Fab No binding observed Human ARG1 C0021133 Fab No binding observed Human ARG1 C0021139 Fab No binding observed

Example 3—Generation and Characterisation of Second-Generation Affinity-Matured ARG2 Leads (Pool Maturation by Ribosome Display)

[0561] 3.1 Production of 2.sup.nd Generation Affinity-Matured Leads

[0562] Second-generation error-prone libraries were built based on the scFv constructs on a pool of the top antibody candidates from the previous selection cascades. Error-prone PCR was used to introduce random mutations into the scFv region of the constructs, and the resulting libraries were used in ribosome display selections as described in Example 2. The resulting selection outputs were sub-cloned and screened as periplasmic preparations/crude lysates in a second-generation epitope competition assay. The hits were sequenced, and lead candidates were chosen based on sequence diversity and hit values. A panel of Fabs were produced and kinetically profiled using Bio-Layer Interferometry (BLI) on the Octet RED96 to rank the candidates based on binding affinities to human ARG2.

[0563] 3.2 Identification of Improved Clones from Second Generation Error-Prone Library Selections (Ribosome Display) Using an Epitope Competition Assay

[0564] One thousand three hundred and twenty scFv chosen at random from selection rounds 2 and 3 of the error-prone mutagenesis approach described in section 2.2 and 2.3 were expressed in bacteria to produce unpurified periplasmic scFv. Those scFv capable of binding recombinant human trimeric ARG2 enzyme via the same epitope as C0021133 IgG were elucidated in a competition format assay, using the HTRF™ platform. Specifically, fluorescence resonance energy transfer (FRET) was measured between streptavidin cryptate (associated with biotinylated recombinant human trimeric ARG2 enzyme) and anti-human Fc XL665 (associated with C0021133 IgG) in the presence of a single concentration of each unpurified periplasmic test scFv. Successful occupation of the C0021133 IgG epitope on the enzyme by scFv resulted in a reduction in FRET, as measured on a fluorescence plate reader.

[0565] A ‘Maximum’ binding signal was determined by analysing the binding of C0021133 IgG to biotinylated recombinant human trimeric ARG2 enzyme in the absence of competitor scFv. The ‘Sample’ signals were derived from analysing the binding of C0021133 IgG to biotinylated recombinant human trimeric ARG2 enzyme in the presence of a test scFv sample. Finally, a ‘Background’ signal was determined by analysing the fluorescence generated in the absence of C0021133 IgG.

[0566] Unpurified periplasmic scFv were supplied in sample buffer consisting of 200 mM tris base, pH 7.4, 0.5 mM EDTA, and 0.5 M sucrose. 5 μl of each scFv were transferred to the ‘Sample’ wells of a black, shallow, solid bottom, non-binding 384-well assay plate using a liquid handling robot. The remaining reagents (prepared in assay buffer) were added to the assay plate by multichannel pipette in the following order: 5 μl detection cocktail, consisting of 6.6 nM streptavidin cryptate and 40 nM anti-human Fc XL665 (to all wells), 5 μl 12 nM biotinylated recombinant human trimeric ARG2 enzyme (to all wells), 5 μl 8 nM C0021133 IgG (to ‘Sample’ and ‘Maximum’ wells), and 5 μl sample buffer (to background wells). Assay plates were sealed and then incubated overnight at room temperature in the dark, prior to measuring time-resolved fluorescence at 620 and 665 nm emission wavelengths on a fluorescence plate reader.

[0567] Data were analysed by calculating % Delta F values for each sample. % Delta F was determined according to equation 1.

[0568] Equation 1:

[00004] % Delta F = ( sample 665 nm / 620 nm ratio ) - ( negative control 665 nm / 620 nm ratio ) ( negative control 665 nm / 620 nm ratio ) × 100

[0569] Delta F values were subsequently used to calculate normalised binding values as described in equation 4.

[00005] Normalised data ( % Control ) = % Delta F of sample % Delta F of Maximum binding control × 100 Equation 4

[0570] Unpurified periplasmic scFv demonstrating significant inhibition of C0021133 IgG binding to biotinylated recombinant human trimeric ARG2 enzyme were subjected to DNA sequencing (Osbourn et al., 1996; Vaughan et al., 1996). The scFv found to have unique protein sequences were expressed as IgG and Fab.

[0571] Reagent/Equipment sources: tris base (Sigma, UK; cat: RDD008), potassium fluoride (VWR chemicals, Belgium; cat: 26820.236), bovine serum albumin solution (Sigma, UK; cat: A7284), C0020187 IgG (produced in-house), biotinylated recombinant human trimeric ARG2 enzyme (produced in-house), Streptavidin cryptate (Cisbio, France; cat: 610SAKLB), anti-Human-IgG-XL665 (Cisbio, France; cat: 61 HFCXLB), 384-well assay plates (Greiner BioOne, Germany; cat: 784076), 384-well dilution plates (Greiner BioOne, Germany; cat: 781280), liquid handling robot (Hamilton Star™, Hamilton, USA), fluorescence plate reader (Pherastar™, BMG Labtech, USA), HTRF technology (Cisbio International, France), graphing/statistical software (Prism, GraphPad USA).

[0572] 3.3 Identification of Improved Clones from Second Generation Error-Prone Library Selections (Ribosome Display) Using the Enzyme Inhibition Assay

[0573] The unpurified periplasmic scFv that were tested in the epitope competition assay described in section 2.4 were simultaneously screened for their ability to inhibit enzymatic activity of trimeric human ARG2 in the assay described in section 1.5. C0021133 was also included in this assay, as unpurified periplasmic scFv, and used as a benchmark against which improved clones could be identified. Improved clones were required to show an increase of 5% or more inhibition over the inhibition observed with C0021133.

[0574] Unpurified periplasmic scFv demonstrating significant improvement over C0021133 IgG were subjected to DNA sequencing (Osbourn et al., 1996; Vaughan et al., 1996). The scFv found to have unique protein sequences were expressed as IgG (section 1.8).

[0575] Anti-ARG2 IgGs were tested for their ability to inhibit to mammalian expressed human ARG2 produced in transfected THP-1 cells. To do this cell lysates were prepared from THP-1 cells overexpressing human ARG2 and from wild type THP-1 cells. 350 million cells were suspended in 3 ml tris buffered saline (25 mM Tris+150 mM sodium chloride in dH.sub.2O, pH 7.4) and cell lysates prepared by passing through a 26G needle 20 times. A BCA assay was used to measure the protein concentration in the lysate. To determine IC.sub.50s of test antibodies, a dilution series of the test antibodies were created in TBS and 5 μl were added to 10 μl lysate (1.19 mg/ml lysate, 20 mM MnCl.sub.2, 50 mM Tris HCl in MilliQ, pH 7.4) and incubated for 2 h at room temperature in a 384 well plate. The enzymatic reaction was started with the addition of 5 μl 100 mM L-arginine substrate and incubated for 1 hour at room temperature. Urea detection reagents, O-Phthaldialdehyde (1.5 mM O-Phthaldialdehyde, 7% H.sub.2SO.sub.4, 0.03% Brij L23) and N-(1-Napthyl)ethylenediamine (1.66 mM N-(1-Napthyl)ethylenediamine, 81 mM Boric acid, 21% H.sub.2SO.sub.4, 0.03% Brij L23) were mixed 1:1 just prior to use and 80 μl/well were added, incubated for 1 hour at room temperature and absorbance at 505 nm was read on a Pherastar plate reader. Antibodies were tested alongside N-Hydroxyl-L-arginine (a small molecule competitive inhibitor of ARG2) as a positive control and CEA6 (irrelevant isotype control antibody) as a negative control (FIG. 13, Table 18). Data points were plotted and IC.sub.50 values were determined using a four parameter fit in GraphPad Prism.

TABLE-US-00021 TABLE 18 THP-1 lysate ARG2 Clone ID EIA IC50 (M) C0021144 1.09E−08 C0021158 5.36E−09 C0021180 4.59E−09 C0021155 9.64E−09 C0021177 5.17E−09 C0021181 6.93E−09 C0021133 7.38E−09 C0021061 5.81E−09 (First generation lead) NHLA 4.75E−06 R347 IgG Inactive

[0576] 3.4 Restoration of T Cell Proliferation by Improved Variant ARG2 Specific IgGs in the Presence of ARG2

[0577] Anti-ARG2 antibodies were screened for their ability to restore T cell proliferation by inhibiting enzymatic activity of ARG2 and hence, the depletion of the L-arginine, which is required for T cell proliferation. This assay served to provide evidence of improved functional efficacy for each affinity-matured antibody in comparison to the parent IgG, C0020187 (FIG. 14, Table 19). R347 was used as the irrelevant control. All clones tested n=2. Reference section 2.9 for methodology.

TABLE-US-00022 TABLE 19 In Presence of rhARG2 In Absence of rhARG2 Top Maximum % Maximum % Maximum % Maximum % Clone ID Format Conc Proliferation Proliferation SD EC.sub.50 Proliferation Proliferation SD EC.sub.50 R347 hlgG1 2 μM   −0.5  2 >[2 μM] 93  7 <[0.0009 μM] C0020187 hlgG1 2 μM    61   21 >[2 μM] 97  6 <[0.0009 μM] C0021061 hlgG1 2 μM   110   23 0.149 μM 93  9 <[0.0009 μM] C0021158 hlgG1 2 μM    90   15 0.157 μM 94  7 <[0.0009 μM] C0021177 hlgG1 2 μM    84   22 0.086 μM 90  7 <[0.0009 μM] C0021180 hlgG1 2 μM    91   12 0.137 μM 96 12 <[0.0009 μM]

[0578] 3.5 Kinetic Profiling of Second-Generation Antibodies as Fabs Using Bio-Layer Interferometry (BLI)

[0579] The affinities of the second-generation antibodies to human ARG2 were measured on the OctetRED system. A screening assay which stably captures His-tagged ARG2 as the ligand on an anti-His surface was utilised to screen the second-generation candidates as Fabs at an analyte range of 1.8 to 120 nM, with an association time of 5 minutes and a dissociation time of 10 minutes. Sensors were regenerated using 10 mM glycine pH 1.5 after each cycle. Based on this assay, six candidates with estimated affinities in the sub-nanomolar range were identified, and they were further profiled using an extended assay which is more suitable for antibodies of high affinities. In the extended assay, the association and dissociation times were extended to 10 and 40 minutes respectively, using a lower Fab analyte titration range of 0.47 to 30 nM, on a streptavidin surface which captures bio-ARG2 as the ligand. The sensorgrams were reference subtracted and fitted to the 1:1 binding model to estimate their binding affinities using the Octet analysis software. The derived kinetic parameters are shown in Table 20.

TABLE-US-00023 TABLE 20 Determination of binding affinities of second-generation antibodies, as Fab, to human ARG2 using Bio-Layer Interferometry K.sub.D K.sub.D k.sub.a k.sub.a k.sub.d k.sub.d Ligand Analyte (M) Error (1/Ms) Error (1/s) Error Human C0021144 3.38E−10  <1.0E−12 1.95E+05 2.28E+02 6.59E−05  <1.0E−07 ARG2 Fab Human C0021155 3.58E−10  <1.0E−12 1.59E+05 1.74E+02 5.67E−05  <1.0E−07 ARG2 Fab Human C0021158 1.73E−10  <1.0E−12 2.62E+05 2.35E+02 4.54E−05  <1.0E−07 ARG2 Fab Human C0021177 1.73E−10  <1.0E−12 2.02E+05 2.04E+02 3.51E−05  <1.0E−07 ARG2 Fab Human C0021180 4.37E−10    1.485E−12 2.78E+05 7.40E+02 1.22E−04    2.565E−07 ARG2 Fab Human C0021181 2.88E−10  <1.0E−12 1.45E+05 1.24E+02 4.17E−05  <1.0E−07 ARG2 Fab

[0580] The affinities of some of these antibodies to cynomolgus ARG2 were determined using the same assay, and the derived kinetic parameters are shown in Table 21.

TABLE-US-00024 TABLE 21 Determination of binding affinities of a smaller panel of second-generation antibodies to cyno ARG2 using Bio-Layer Interferometry K.sub.D K.sub.D k.sub.a k.sub.a k.sub.d k.sub.d Ligand Analyte (M) Error (1/Ms) Error (1/s) Error Cyno C0021158 1.08E−10  <1.0E−12 4.29E+05 4.50E+02 4.64E−05    1.039E−07 ARG2 Fab Cyno C0021177 7.54E−11  <1.0E−12 4.14E+05 4.21 E+02 3.12E−05  <1.0E−07 ARG2 Fab Cyno C0021180 3.53E−10    1.187E−12 3.81E+05 1.00E+03 1.35E−04    2.822E−07 ARG2 Fab Cyno C0021181 1.73E−10  <1.0E−12 2.57E+05 2.19E+02 4.43E−05  <1.0E−07 ARG2 Fab

[0581] 3.6 Testing IgG Binding to Human ARG1

[0582] Binding of the second-generation antibodies to human ARG was also tested on the OctetRED system using a screening assay which stably captures His-tagged ARG2 as the ligand on an anti-His surface. The Fabs were tested as analyte up to 120 nM, with an association time of 5 minutes and a dissociation time of 10 minutes. Sensors were regenerated using 10 mM glycine pH 1.5 after each cycle. The results are shown in Table 22.

TABLE-US-00025 TABLE 22 Testing the binding of second-generation antibodies, as Fab, to human ARG1 using Bio-Layer Interferometry Ligand Analyte Results Human ARG1 C0021144 Fab No binding observed Human ARG1 C0021155 Fab No binding observed Human ARG1 C0021158 Fab No binding observed Human ARG1 C0021177 Fab No binding observed Human ARG1 C0021180 Fab No binding observed Human ARG1 C0021181 Fab No binding observed

[0583] 3.7 Understanding the Mechanism of Action of ARG2 Specific IgGs on the Enzyme ARG2

[0584] The mechanism of action of the lead identification clone C0021158 IgG was investigated using the human ARG2 (trimer) enzyme inhibition assay as well as isothermal titration calorimetry.

[0585] The enzyme inhibition assay is described in section 1.5 and is a biochemical assay that measures production of urea, the product of L-arginine turnover by ARG2. To investigate the mechanism of action of C0021158 IgG, four point titrations of C0021158 IgG (1000, 100, 30 and 10 nM) were set up in the presence of 11 concentrations of arginine (250, 200, 150, 100, 62.5, 37.5, 25, 12.5, 8.5, 5, 5 and 2.5 mM) and the reaction allowed to proceed for 80, 60, 45, 30, 15 or 5 minutes before the addition of the urea detection reagents O-Phthaldialdehyde and N-(1-Napthyl)ethylenediamine.

[0586] Raw data from each separate concentration of C0021158 IgG was plotted as a function of time for each concentration of arginine and fitted using a linear fit (GraphPad Prism) to derive initial velocities (slope values).

[0587] Initial velocity data was plotted against arginine concentration for each concentration of C0021158 IgG (FIG. 15A). Each trace was fitted to the Michaelis-Menten model (Y=V.sub.max*X/(K.sub.m+X)) in GraphPad Prism to derive maximum velocity (V.sub.max) and enzyme/substrate affinity (K.sub.m) values at each inhibitor concentration (Table 23).

TABLE-US-00026 TABLE 23 V.sub.max (AU ms.sup.−1) K.sub.m (mM)  1 μM 00021158 IgG 103.4  9.98e−11 100 nM 00021158 IgG 112.8  0.59  30 nM 00021158 IgG 89.23  1.71e−10  10 nM 00021158 IgG 148.5  1.64 No inhibitor 537.8 13.78

[0588] The mechanism of action of enzyme inhibitors can be broadly divided into competitive, uncompetitive and non-competitive and can be identified as such based on their effects on K.sub.m and V.sub.max.

[0589] A competitive inhibitor binds only to free enzyme, often at the active site, causing the affinity of the enzyme for the substrate to be reduced (increased K.sub.m) with no change to the maximum enzyme rate (V.sub.max).

[0590] An uncompetitive inhibitor binds exclusively to the enzyme-substrate complex yielding an inactive enzyme-substrate-inhibitor complex. The enzyme's affinity for the substrate is increased (K.sub.m is decreased) and the maximum enzyme rate (V.sub.max) is decreased.

[0591] A non-competitive inhibitor binds equally well to free enzyme and enzyme-substrate complex. The enzyme's affinity for the substrate (K.sub.m) is unchanged and the maximum enzyme rate (V.sub.max) is decreased.

[0592] In the case of C0021158 IgG inhibitor V.sub.max decreased in the presence of C0021158 IgG inhibitor, ruling out a competitive mode of action and pointing towards an uncompetitive or a non-competitive mode of action. To distinguish non-competitive from uncompetitive modes of action the effect on K.sub.m must be assessed. Unfortunately, the initial velocity/arginine concentration plots had an unusual profile where, in the presence of inhibitor, the initial anticipated increase in initial velocity is followed by a drop as arginine concentration increases. This uncharacteristic profile led to poor fitting of the data making it difficult to derive an accurate K.sub.m. The lack of accurate K.sub.m data means C0021158 IgG cannot be assigned as uncompetitive or non-competitive. It is only possible to state that the IgG inhibitor is ‘not competitive’.

[0593] To assess the accessibility of the ARG2 active site, we analysed binding of the ARG2 small-molecule inhibitor S-(2-Boronoethyl)-L-cysteine hydrochloride (BEC) by isothermal titration calorimetry (ITC) using a VP ITC (MicroCal) set to 25° C. (FIG. 15B). BEC is an arginine analogue that binds to the active site of ARG2. First, volumes of 10 μl of a solution containing 0.75 mM BEC were added to 20 μM of ARG2 (monomer concentration). The resulting thermogram was integrated using NITPIC and the binding isotherm was fitted with SEDPHAT using a one-binding site model. In a second experiment, volumes of 10 μl of 0.50 mM BEC were added to a solution containing a pre-incubated 1:1 molar mixture of C0021158 fab and ARG2 (both 20 μM, incubation 1 h at 20° C.). The thermogram was integrated using NITPIC, however, the resulting heats of injection were in the range of the background suggesting drastically reduced binding of BEC to ARG2 in the presence of C0021158 fab. Together with the EIA data, this suggests that C0021158 fab prevents the substrate from binding to ARG2 as an allosteric inhibitor.

[0594] 3.8 Germlining and De-Risking of Lead Antibodies

[0595] Antibodies derived from selection outputs during the lead optimisation phase can often contain spontaneous mutations in the framework regions which deviate from germline sequences. As a measure to potentially decrease immunogenicity in vivo, such mutations can be reverted to germline sequences in lead candidates. For antibody clone C0021142, an amino acid residue in the VL Framework 3 region was reverted to germline during the IgG conversion process (C0021142 IgG). Similarly, an amino acid residue in the VH framework 4 region was reverted to germline sequences during the IgG conversion process (C0021158 IgG). The IgG and Fab versions of these antibody clones would carry these sequences. Furthermore, C0021158 was further germlined in the VL framework 3 region to produce a fully-germlined (fgl) version, named C0021158fgl. In further molecular engineering, a predicted mid-risk deamidation site was also engineered out of C0021158 to produce a de-risked (dr) version, named C0021158dr. Finally, a version of C0021158 which was fully germlined and de-risked was produced, named C0021158fgl2.

[0596] 3.9 Inhibition of THP-1 Derived ARG2 by Second Generation Improved Variant IgGs

[0597] Second generation improved variant anti-ARG2 IgGs were tested for their ability to inhibit mammalian expressed human ARG2 produced in transfected THP-1 cells. Methods for this assay are described in section 2.8. Results are shown in FIG. 16 and Table 24.

TABLE-US-00027 TABLE 24 THP-1 ARG2 Clone ID EIA IC50 (M) C0020187gG 6.49E−07 C0021158 gG 2.30E−09 C0021158-fgl2 IgG 3.00E−09 NHLA 1.29E−05 R347 IgG inactive

[0598] 3.10 Demonstration of Release of ARG2 from Cancer Cell Lines

[0599] In this study 25 cancer cell lines were chosen to represent various disease indications. Based on ARG2 expression in culture media as described below (Table 25), a panel of cell lines from three disease indications viz., prostate, sarcoma and ovarian cancer were chosen for further assessment. These cell lines were obtained either from ATCC, ECACC or Essen Biosciences.

[0600] Serum-starvation treatment: The cell lines were grown in 35 ml of providers recommended media (for details see table below*) in a T175 cm.sup.2 flask in 37° C. humidified incubator with 5% CO.sub.2 until the cells were >70% confluent. Cells were washed with 25 ml of 1×DPBS (Gibco, ref. 14190-094) and replaced with 35 ml of serum-starved medium (i.e. growth media devoid of serum). 48 h later, medium on top of the cells (now referred to as Cell Conditioned Medium or CCM) was collected in a 50 ml Falcon tube and centrifuged at 300×g at 4° C. to harvest floating/dead cells. CCM on top of the cell pellet was collected in a separate 50 ml Falcon tube and filtered through 0.22 μm Millipore Express® filters (Millipore, cat. SCGP00525) to remove cell debris. The filtered CCM was stored on ice for concentration.

[0601] Adherent cells were trypsinised with 5 ml of TrypLE-Express (Gibco, cat. 12604-013) for up to 5 minutes in 37° C. incubator. 25 ml of pre-warmed medium was added when cells appeared rounded/detached under the microscope, and gently mixed to obtain single cell suspension. Transferred cells to the Falcon tube containing harvested cells from CCM and gently mixed. The cells were collected by centrifugation at 300×g at 4° C. for 5 min. Removed supernatant, resuspended cells in 30 ml of 1×DPBS. Cell count and viability was determined using Trypan Blue staining (Invitrogen, cat. T10282) and Countess® II Automated cell counter (Life Technologies) by following manufacturers' protocol.

[0602] Concentration of CCM: The filtered CCM was concentrated by centrifugation using Amicon® Ultra-15 filter (Millipore, ref. UCF901096). 10 ml of 1×DPBS was added to pre-soak the filter and centrifuged at 4000 rpm at 20° C. for 8 min. Filtrate collected in the receptacle tube was discarded. CCM was added to the tube, centrifuged at 4000 rpm at 20° C. for 6-8 min. This step was repeated, filtrate was discarded and CCM was added each time until ˜700 μl of concentrated CCM (˜50× concentrated) remained on the filter. Concentrated CCM was collected in a pre-labelled microfuge tube, 1× Protease Halt inhibitor (ThermoFisher, cat. 1861281) was added to it and mixed well. The concentrated CCM was either at stored at −20° C. or processed directly for immunoprecipitation.

[0603] Immunoprecipitation (IP) and Western blotting (WB): The volume of concentrated CCM corresponding to 5×10.sup.6 cells was determined. CCM was diluted in 550 μl of wash buffer (1×TBS, 1.5 M NaCl, 0.25 M tris pH 7.4, 0.05% Tween-20). Similarly, 25 ng of recombinant human ARG1 and ARG2 protein which would serve as negative and positive control were diluted separately in wash buffer. For each IP reaction, 2 μl of ARG2 PAD antibody (Cloud Clone Corp, ref. PAD796Hu01) was diluted in 50 μl of wash buffer and added to IP tube. IP reaction tubes were left on a rotator at 11 rpm at 4° C. overnight. Next day, 25 μl of Dynabeads™ (M-280 Sheep Anti-Rabbit IgG, Invitrogen, 11203D) were washed twice with 1 ml of wash buffer. Beads were resuspended in 50 μl of wash buffer and added to each IP tube. Left tubes on a rotator, 11 rpm at room temperature for 2 h. The magnet was used to remove the liquid. The beads were washed twice with 500 μl of wash buffer.

[0604] Suspended IP beads in 15 μl 1× NuPAGE LDS sample loading buffer (Invitrogen, cat. NP0007) were incubated at room temperature for 20 min. IP beads were heated to 90° C. for 10 min and loaded onto a NuPAGE™ 4-12% Bis-Tris gel (Invitrogen, cat. NPO322BOX). Also loaded were protein marker comprising a mix of 7 μl Pre-stained protein standards (Invitrogen, LC5800) and 2 μl MagicMark™ XP (Invitrogen, LC5602). Gels were run in 1× NuPAGE™ MES SDS running buffer (Invitrogen, cat. NP0002) at 200 V, 500 mA for 35 min. Resolved proteins were transferred to PVDF membranes (Invitrogen, cat. IB24001) using iBlot® 2 (Invitrogen) at 20 V for 1 min, 23V for 4 min and 25V for 2 min. Membranes were blocked in 5% Milk-TBS-Tween20 for 1 h at room temperature on a roller at 22 rpm. ARG2 MAD antibody (Cloud Clone Corp, ref. MAD796Hu21) was diluted to 1:1000 in 5 ml of 5% Milk-TBS-Tween20 and left on roller at 4° C. overnight. Membranes were washed three times with 1×TBS-Tween20 (˜5 min each time). Anti-Mouse (Fc specific)-HRP conjugated antibody (Sigma cat. A2254) was diluted to 1:2000 in 5 ml of 5% Milk-TBS-Tween20 and incubated with mouse-HRP antibody for 1 h at room temperature. The membranes were washed three times with 1×TBS-T-Tween20. The blots were developed using ECL Prime detection reagent (GE Healthcare, RPN2232) following manufacturer's protocol.

[0605] Chemiluminescent images were captured on Gel Imager (ChemiDoc-It.sup.2). Final set of images were inverted for colour on ImageJ and annotated.

[0606] Out of the various cell lines tested, ARG2 immunoprecipitated from a variety of cell lines (Table 25) including from CCM of LNCaP, A673 and A2780-Cis cell lines (FIG. 17).

TABLE-US-00028 TABLE 25 Relative levels of ARG2 released into cell culture media (CCM) by different cancer cell lines. ARG2 in CCM was detected by Immunoprecipitation (IP-WB), ‘+’ indicates presence of ARG2, ‘+++’ indicates high levels of ARG2, ‘+/−’ ARG2 presence could not be unambiguously established and ‘−’ no ARG2 was detected. ARG2 detected S. No. Cell Line Disease Indication by IP-WB 1 A673 Sarcoma +++ 2 HT-1080 Sarcoma − 3 Saos-2 Sarcoma + 4 U2-OS Sarcoma − 5 SKOV-3 Ovarian − 6 OVCAR-3 Ovarian +/− 7 A2780-Parental Ovarian + 8 A2780-Cis Ovarian +++ 9 A2780-ADR Ovarian + 10 DU145 Prostate − 11 LNCaP Prostate +++ 12 PC3 Prostate − 13 PNT2* Prostate* − 14 AGS Gastric + 15 HuTu-80 Gastric + 16 KATO-III Gastric + 17 NCI-N87 Gastric − 18 SNU-1 Gastric − 19 SNU-5 Gastric +/− 20 SNU-16 Gastric + 21 DX3 Skin +/− 22 HPAF-II Pancreatic +/− 23 MDA-MB-231 Breast − 24 K562 Haematopoietic and Lymphoid − 25 KMS11 Haematopoietic and Lymphoid + 26 HL-60 Haematopoietic and Lymphoid +/− *Cell line derived from normal prostate epithelium

TABLE-US-00029 TABLE 26 Composition of growth media for culturing cell lines. Cell Lines Composition of growth media including supplements A673, DMEM (Gibco, ref. 31053-044) + 1x GlutaMAX ™ (Gibco, PNT2, ref. 35050-038) + 1 mM sodium pyruvate (Gibco, ref. DX3, 11360-070) + 10% FBS (Gibco, ref. 16170-078) MDA- MB-231 LNCaP, 1x RPMI ATCC Modification (Gibco, ref. A10491-01) + NCI-N87, 10% FBS SNU-1, SNU-16 HT-1080.sup.$, Hams Nutrient Mix F12 (Sigma, ref. 51615C) + 10% FBS + PC3, .sup.$0.5 μg/ml Puromycin AGS Saos-2.sup.#, McCoy’s 5A with GlutaMAX ™ (Gibco, ref. 36600-21) + U2-OS, 10% FBS/15% FBS SKOV-3 A2780-Par, RPMI Medium 1640 (Gibco, ref. 32404-014) + 1x KMS11, GlutaMAX ™ + 10% FBS + A2780- 1 μM Cisplatin (Millipore, ref. 232120)/1 μM Doxorubicin Cis.sup.£ (Sigma, ref. D1515) A2780- ADR.sup.¥ OVCAR-3 1x RPMI ATCC Modification + Recombinant human Insulin (Sigma, ref. 19278, added 0.0798 μl/ml of media) + 20% FBS DU-145, MEM (Gibco, ref. 51200) + 1x GlutaMAX ™ + 1 mM HPAF-II, sodium pyruvate + 1x MEM Non-essential amino acid HuTu-80 solution (Gibco, ref. 11140-035) + 10% FBS SNU-5, IMDM (Gibco, ref. 12440-053) + 20% FBS/10% FBS KATO-III, K562, HL-60.sup.Δ

[0607] 3.11 Binding of 1.sup.st and 2.sup.nd Generation IgGs (C0021061 and C0021158) to ARG2 from Cancer Cell Lines

[0608] In this experiment the presence of ARG2 in CCM samples was validated using commercial ARG2 ELISA kit (Cloud-Clone Corp., cat. SED796Hu). Additionally, the protocol was modified to include 1.sup.st generation IgG C0021061 and 2.sup.nd generation IgG C0021158 as detection antibodies to confirm binding of ARG2 IgG's to ARG2 expressed from cancer cell lines (FIG. 18).

[0609] The commercial kit is a 96-well plate pre-coated with anti-ARG2, which uses sandwich ELISA to quantify ARG2 in samples. Standards, biotinylated detection antibody, detection, substrate, and stop reagents are all provided in the kit. The concentrated CCM samples from LNCaP, A673 and A2780-Cis cells which showed ARG2 expression (as described above, FIG. 17) and a media control were diluted 1:1 in 1×DPBS. 100 μl of diluted CCM/media control was used for each well of kit and ELISA was performed following manufacturer's protocol. Each sample was run in duplicate. In parallel, CCM/media control samples were also included to test for binding of C0021061 and C0021158 to ARG2 in CCM samples. For this, while all steps were same as the manufacturer's protocol, instead of using kit-provided biotinylated detection antibody (PAD), biotinylated-C0021061/-C0021158/-irrelevant IgG control R347 at 10 μg/ml were used. At the end of the assay, absorbance at 450 nm was read out on PheraStar (BMG). The absorbance values of standards were used to make standard curve and was used to interpolate ARG2 levels in CCM samples (where PAD detection antibody supplied with the kit was used). Similarly, absorbance reads from wells that received C0021061 and C0021158 were used to infer.sub.11 and 2.sup.nd generation ARG2 IgGs (C0021061 and C0021158 respectively) bind to ARG2 in CCM samples (FIG. 18).

[0610] 3.12. Co-Crystallisation of Human ARG2 with ARG2 Binding Fabs C0021158 and C0021181 to Elucidate Epitope/Paratope Contact Residues

[0611] The construct used for crystal trials was ARG2 (23-354) containing a C-terminal Gly.sub.3 linker and His.sub.10-tag (ARG2+C0020187, SEQ ID NO: 355: huARG2-His10) or a simple C-terminal His.sub.6-tag (ARG2+C0021181 and ARG2+C0021158, SEQ ID NO: 357: huARG2-His.sub.6). Crystals suitable for structure determination were obtained using the sitting drop methodology. For ARG2+C0020187, 0.2 μl of complex solution (2.0 mg/ml, ARG2:Fab=3:1, purified by gel filtration) were mixed with 0.1 μl of crystallisation solution containing 2 M (NH.sub.4).sub.2SO.sub.4. Round, disc-shaped crystals (60×60×20 μm) appeared after 2 days. For ARG2+C0021181, 0.5 μl of complex solution (6.3 mg/ml) were mixed with 0.5 μl of a crystallisation solution containing 100 mM MMT (malic acid:MES:tris=1:2:2) pH 5.0, 20% glycerol, 10% PEG4000, 15 mM NaNO.sub.3, 15 mM Na.sub.2HPO.sub.4, 15 mM (NH.sub.4).sub.2SO.sub.4. Hexagonal disc-shaped crystals (100×100×20 μm) appeared after 2 days and reached their final size after a week. For ARG2+C0021158, 0.25 μl of complex solution (7.0 mg/ml, containing 20% diluted microseeds of an ARG2+C0021181 crystal) were mixed with 0.25 μl of a crystallisation solution containing 2 M (NH.sub.4).sub.2SO.sub.4. Crystals of irregular shape (60×60×60 μm) appeared after 2 days. For the ARG2+C0020187 and ARG2+C0021158 crystals, 3 M (NH.sub.4).sub.2SO.sub.4 and 5% glycerol were added for cryo-protection, after which the crystals were cryo-cooled by plunging them into liquid N.sub.2. Data sets were collected at DLS, beamline i04-1 (ARG2+C0020187) or BESSY II, HZB, beamline MX-14-1 (ARG2+C0021181 and ARG2+C0021158). The crystals of ARG2+C0020187 diffracted up to 3.25 Å in space group P 6.sub.5 2 2 with unit cell parameters a=b=138 Å, c=551 Å. The crystals of ARG2+C0021181 diffracted up to 2.9 Å in space group P 3 2 1 with unit cell parameters a=b=150 Å, c=111 Å, and exhibited twinning with fractions 0.50/0.50. The crystals of ARG2+C0021158 diffracted up to 2.4 Å in space group H 3 with unit cell parameters a=b=149 Å, c=123 Å, and exhibited twinning with fractions 0.80/0.20.

[0612] 3.13 Structure Solution and Refinement

[0613] The structures were solved by molecular replacement using Phaser in the CCP4 program suite using the reported structure of ARG2 (PDB-ID 4HZE) and previously solved high-resolution structures of the individual Fabs in the molecular replacement search. For ARG2+C0020187 the asymmetric unit contained three copies each of ARG2 and the Fab, respectively, with the C.sub.L and C.sub.H domains being present in different orientations, one of pair which was poorly defined in the electron density. For ARG2+C0021181 and ARG2+C0021158 the asymmetric units contained one copy of ARG2 and one copy of the Fab, however for ARG2+C0021181 only the V.sub.L and V.sub.H domains of the Fab were well defined, with C.sub.L and C.sub.H domains most likely being present in two orientations (reflected by the increased B factor and overall worse electron density). Automated and manual refinement was then performed by alternating between using REFMAC5 (with twin- and TLS refinement turned on towards finalising the structures for ARG2+C0021181 and ARG2+C0021158) and COOT, respectively. Final R/R.sub.free values of the ARG2+C0020187, ARG2+C0021181 and the ARG2+C0021158 structures are 0.30/0.36, 0.27/0.32 and 0.25/0.28, respectively (FIG. 19).

TABLE-US-00030 TABLE 27 Table indicating the percentage surface area of solvent accessible residues within ARG2 that become buried upon complexation with C0021181. ASA is the solvent accessible surface area of residues. BSA is the buried (solvent inaccessible) surface area. ΔG is the predicted solvation free energy gained upon formation of the ARG2-C0021181 interface for each residue. ARG2 H-bond/ ASA BSA ΔG % Interface residue salt bridge (Å.sup.2) (Å.sup.2) (kcal/mol) buried to Fab GLN37 |H|  79.8  40.8   0.1  51% V.sub.H LYS38 |HS| 154.2  60.1   0.1  39% V.sub.H LYS40 |  |  47.3  17.7   0.2  37% V.sub.H GLY41 |  |   1.0   1.0   0.0 100% V.sub.H HIS44 |H| 119.3  79.3 −0.4  66% V.sub.H ALA47 |  |  44.9   5.7   0.1  13% V.sub.H ALA48 |  |  18.4   5.5   0.1  30% V.sub.H GLU51 |S| 149.7  30.5 −0.4  20% V.sub.H ASP79 |  |  89.1   7.8 −0.1   9% V.sub.H ASP80 |  |  80.0  44.9   0.2  56% V.sub.H + V.sub.L LEU81 |  | 132.9 132.9   1.9 100% V.sub.H + V.sub.L TYR82 |  | 130.6  94.1   1.4  72% V.sub.H + V.sub.L ASN84 |H|  48.3  26.5   0.1  55% V.sub.H LEU85 |  |  97.8  94.5   1.5  97% V.sub.H + V.sub.L ILE86 |  |  65.9  46.6   0.7  71% V.sub.H + V.sub.L PRO299 |  |  36.7  34.6   0.3  95% V.sub.H GLN300 |H| 122.8  94.4   0.1  77% V.sub.H ALA302 |  |  23.5  11.3 −0.1  48% V.sub.H THR303 |  | 121.5   5.2   0.0   4% V.sub.H SER304 |  |  56.2  14.4   0.2  26% V.sub.H GLU305 |  | 131.9  34.5   0.4  26% V.sub.H ALA308 |  |  19.4   7.2   0.1  37% V.sub.H total: 1°°1.2 889.°  6.°  50%

TABLE-US-00031 TABLE 28 Table indicating the percentage surface area of solvent accessible residues within ARG2 that become buried upon complexation with C0021158. ASA is the solvent accessible surface area of residues. BSA is the buried (solvent inaccessible) surface area. ΔG is the predicted solvation free energy gained upon formation of the ARG2-C0021158 interface for each residue. ARG2 H-bond/ ASA BSA ΔG % Interface residue salt bridge (Å.sup.2) (Å.sup.2) (kcal/mol) buried to Fab PRO32 |  |   19.0    13.1    0.2   69% V.sub.H GLN37 |H|  104.9    60.0  −0.1   57% V.sub.H LYS38 |H|  174.3    44.7    0.6   26% V.sub.H LYS40 |  |   57.4    35.7    0.4   62% V.sub.H GLY41 |  |    5.4     3.6    0.1   67% V.sub.H GLU43 |  |   34.8    28.3  −0.2   81% V.sub.H HIS44 |H|  113.8   103.2  −0.1   91% V.sub.H ALA47 |  |   41.9    18.7    0.3   45% V.sub.H ALA48 |  |   20.6     7.8    0.1   38% V.sub.H GLU51 |S|  153.6    38.0  −0.5   25% V.sub.H ASP70 |  |   64.9     0.3    0.0    1% V.sub.H SER72 |  |   88.9    17.9    0.3   20% V.sub.H PHE73 |  |   28.8    11.1  −0.1   39% V.sub.H THR74 |  |   73.6    10.4  −0.1   14% V.sub.H PRO75 |  |    4.8     0.3    0.0    7% V.sub.H LYS78 |  |  115.21  16.64  −0.42  14% V.sub.L ASP79 |S|   94.0    25.6  −0.3   27% V.sub.H ASP80 |  |   58.2    44.0    0.0   76% V.sub.H + V.sub.L LEU81 |  |  136.5   136.5    2.0  100% V.sub.H + V.sub.L TYR82 |  |  134.8    98.9    1.3   73% V.sub.H + V.sub.L ASN84 |H|   41.5    32.5  −0.1   78% V.sub.H LEU85 |  |   82.2    80.9    1.3   98% V.sub.H ILE86 |  |   77.9    54.6    0.9   70% V.sub.H + V.sub.L PRO299 |  |   29.6    25.9    0.3   87% V.sub.H GLN300 |H|  108.6    75.7    0.0   70% V.sub.H GLU305 |  |  126.1     6.4    0.1    5% V.sub.H ALA308 |  |   21.5     9.5    0.2   44% V.sub.H total: 2012.6  1000.3    6.2   50%

TABLE-US-00032 TABLE 29 Table indicating the percentage surface area of solvent accessible residues within ARG2 that become buried upon complexation with C0020187 over all three protomers in the asymmetric unit of the crystal structure. The numbers after the residue show in how many of the three protomers the residue is involved in the interface. ASA is the solvent accessible surface area of residues. BSA is the buried (solvent inaccessible) surface area. ΔG is the predicted solvation free energy gained upon formation of the ARG2-C0020187 interface for each residue. ASA, BSA and ΔG are averages of the protomers in which they occur and H-bonds are indicated if at least one of the protomers allows for one to be formed. ARG2 H-bond/ ASA BSA ΔG % Interface residue salt bridge (Å.sup.2) (Å.sup.2) (kcal/mol) buried to Fab GLN35 2/3 |  |   32.3  13.7 −0.2 42% V.sub.H GLY36 1/3 |  |   23.8   0.3   0.0  1% V.sub.H GLN37 3/3 |H|  118.7  24.4 −0.2 21% V.sub.H LYS38 3/3 |  |  170.6  36.0   0.3 21% V.sub.H ARG39 2/3 |H|   65.8  21.4 −0.3 33% V.sub.H LYS78 2/3 |H|  156.9  16.1 −0.1 10% V.sub.L ASP79 1/3 |  |   75.7   3.9   0.0  5% V.sub.H + V.sub.L ASP80 3/3 |H|   80.6  27.2   0.0 34% V.sub.H + V.sub.L LEU81 3/3 |  |  109.1  85.8   1.0 79% V.sub.H + V.sub.L TYR82 3/3 |  |  133.4 108.8   1.2 82% V.sub.H ASN84 3/3 |H|   58.1  39.0 −0.3 67% V.sub.H LEU85 3/3 |  |  115.2  72.5   0.8 63% V.sub.H + V.sub.L ILE86 3/3 |  |   74.8  47.9   0.8 64% V.sub.H LEU152 3/3 |H|  123.8  23.7 −0.1 19% V.sub.H THR153 3/3 |  |   56.7  15.2   0.0 27% V.sub.H THR154 3/3 |H|   45.0  14.7   0.1 33% V.sub.H SER155 3/3 |H|   82.7  60.5   0.4 73% V.sub.H SER156 3/3 |H|   51.9  21.8   0.1 42% V.sub.H GLY157 3/3 |H|   35.6  22.2   0.2 62% V.sub.H LEU178 1/3 |  |   53.3   7.2   0.1 14% V.sub.H PRO179 3/3 |  |   72.3  16.7   0.3 23% V.sub.H total: total: 1° 36.3 6° 8.9   3.9 39% V.sub.H

[0614] 3.14 Size-Exclusion Chromatography to Analyse ARG2-Fab Binding Stoichiometry

[0615] ARG2 and Fabs were analysed at concentrations of 8 μM (referring to monomers) in SEC buffer containing 25 mM tris at pH 7.4 and 150 mM NaCl. ARG2-Fab complexes were formed by mixing both ARG2 and Fabs at concentrations of 8 μM (referring to monomers) in SEC buffer and incubation on ice for 1 h. For size-exclusion chromatography, 500 μl of sample were injected into a 100 μl loop connected to a Superose 6 Increase 10/300 GL column (GE Healthcare) which was mounted to an AKTAexpress FPLC system (GE Healthcare). The column was equilibrated in SEC buffer, and SEC was performed at a flow rate of 0.5 ml/min. Molecular-weight estimates are based on the retention volumes seen for β-amylase, bovine serum albumin and carbonic anhydrase, which were analysed on the same FPLC system under identical conditions.

[0616] 3.15 Dynamic Light Scattering to Analyse ARG2-Fab Complex Sizes

[0617] ARG2 and Fabs were analysed at concentrations of 8 μM (referring to monomers) in buffer containing 25 mM tris at pH 7.4 and 150 mM NaCl (FIG. 23). ARG2-Fab complexes were formed by mixing both ARG2 and Fabs at concentrations of 8 μM (referring to monomers) and incubation on ice for 1 h. Dynamic light scattering (DLS) was performed on a Zetasizer Ultra (Malvern Panalytical) using multiangle DLS. Data was collected in a 3×3 mm cuvette (Hellma Analytics) using a sample volume of 30 μl. Volume weighted size-distributions were corrected for refractive index, viscosity, and background scatter of the buffer by the instrument software.

CITATION LIST

[0618] 1. Ash, D. E., Structure and function of arginases. J Nutr, 2004. 134(10 Suppl): p. 2760S-2764S; discussion 2765S-2767S. [0619] 2. Balkwill, F., K. A. Charles, and A. Mantovani, Smoldering and polarized inflammation in the initiation and promotion of malignant disease. Cancer Cell, 2005. 7(3): p. 211-7. [0620] 3. Bannister, D., et al., Parallel, high-throughput purification of recombinant antibodies for in vivo cell assays. Biotechnol Bioeng, 2006. 94(5): p. 931-7. [0621] 4. Bivalacqua, T. J., et al., Evaluation of nitric oxide synthase and arginase in the induction of a Peyronie's-like condition in the rat. J Androl, 2001. 22(3): p. 497-506. [0622] 5. Bron, L., et al., Prognostic value of arginase-II expression and regulatory T-cell infiltration in head and neck squamous cell carcinoma. Int J Cancer, 2013. 132(3): p. E85-93. [0623] 6. Bronte, V., et al., Boosting antitumor responses of T lymphocytes infiltrating human prostate cancers. J Exp Med, 2005. 201(8): p. 1257-68. [0624] 7. Caldwell, R. B., et al., Arginase: an old enzyme with new tricks. Trends Pharmacol Sci, 2015. 36(6): p. 395-405. [0625] 8. Caldwell, R. W., et al., Arginase: A Multifaceted Enzyme Important in Health and Disease. Physiol Rev, 2018. 98(2): p. 641-665. [0626] 9. Christianson, D. W., Arginase: structure, mechanism, and physiological role in male and female sexual arousal. Acc Chem Res, 2005. 38(3): p. 191-201. [0627] 10. Clackson, T. and H. B. Lowman, Phage display: a practical approach. Practical approach series. 2004: Oxford. [0628] 11. Costa, H., et al., Human cytomegalovirus may promote tumour progression by upregulating arginase-2. Oncotarget, 2016. 7(30): p. 47221-47231. [0629] 12. Di Costanzo, L., et al., Crystal structure of human arginase I at 1.29-A resolution and exploration of inhibition in the immune response. Proc Natl Acad Sci USA, 2005. 102(37): p. 13058-63. [0630] 13. Dunand-Sauthier, I., et al., Repression of arginase-2 expression in dendritic cells by microRNA-155 is critical for promoting T cell proliferation. J Immunol, 2014. 193(4): p. 1690-700. [0631] 14. Durante, W., F. K. Johnson, and R. A. Johnson, Arginase: a critical regulator of nitric oxide synthesis and vascular function. Clin Exp Pharmacol Physiol, 2007. 34(9): p. 906-11. [0632] 15. Gannon, P. O., et al., Androgen-regulated expression of arginase 1, arginase 2 and interleukin-8 in human prostate cancer. PLoS One, 2010. 5(8): p. e12107. [0633] 16. Groves, M. A. and J. K. Osbourn, Applications of ribosome display to antibody drug discovery. Expert Opin Biol Ther, 2005. 5(1): p. 125-35. [0634] 17. Hanes, J., L. Jermutus, and A. Pluckthun, Selecting and evolving functional proteins in vitro by ribosome display. Methods Enzymol, 2000. 328: p. 404-30. [0635] 18. Hanes, J. and A. Pluckthun, In vitro selection and evolution of functional proteins by using ribosome display. Proc Natl Acad Sci USA, 1997. 94(10): p. 4937-42. [0636] 19. Hawkins, R. E., S. J. Russell, and G. Winter, Selection of phage antibodies by binding affinity. Mimicking affinity maturation. J Mol Biol, 1992. 226(3): p. 889-96. [0637] 20. Hecker, M., et al., Inhibition of arginase by NG-hydroxy-L-arginine in alveolar macrophages: implications for the utilization of L-arginine for nitric oxide synthesis. FEBS Lett, 1995. 359(2-3): p. 251-4. [0638] 21. Ino, Y., et al., Arginase II expressed in cancer-associated fibroblasts indicates tissue hypoxia and predicts poor outcome in patients with pancreatic cancer. PLoS One, 2013. 8(2): p. e55146. [0639] 22. Jayaraman, P., et al., Tumor-expressed inducible nitric oxide synthase controls induction of functional myeloid-derived suppressor cells through modulation of vascular endothelial growth factor release. J Immunol, 2012. 188(11): p. 5365-76. [0640] 23. Jenkinson, C. P., W. W. Grody, and S. D. Cederbaum, Comparative properties of arginases. Comp Biochem Physiol B Biochem Mol Biol, 1996. 114(1): p. 107-32. [0641] 24. Kabat, E. A. and T. T. Wu, Identical V region amino acid sequences and segments of sequences in antibodies of different specificities. Relative contributions of VH and VL genes, minigenes, and complementarity-determining regions to binding of antibody-combining sites. J Immunol, 1991. 147(5): p. 1709-19. [0642] 25. Kim, S. H., et al., Impact of I-Arginine Metabolism on Immune Response and Anticancer Immunotherapy. Front Oncol, 2018. 8: p. 67. [0643] 26. Lewis, N. D., et al., Immune evasion by Helicobacter pylori is mediated by induction of macrophage arginase II. J Immunol, 2011. 186(6): p. 3632-41. [0644] 27. Maarsingh, H., et al., Arginase strongly impairs neuronal nitric oxide-mediated airway smooth muscle relaxation in allergic asthma. Respir Res, 2006. 7: p. 6. [0645] 28. Mantovani, A., et al., Macrophage polarization: tumor-associated macrophages as a paradigm for polarized M2 mononuclear phagocytes. Trends Immunol, 2002. 23(11): p. 549-55. [0646] 29. McCafferty, J., et al., Selection and rapid purification of murine antibody fragments that bind a transition-state analog by phage display. Appl Biochem Biotechnol, 1994. 47(2-3): p. 157-71; discussion 171-3. [0647] 30. Ming, X. F., et al., Arginase II Promotes Macrophage Inflammatory Responses Through Mitochondrial Reactive Oxygen Species, Contributing to Insulin Resistance and Atherogenesis. J Am Heart Assoc, 2012. 1(4): p. e000992. [0648] 31. Miraki-Moud, F., et al., Arginine deprivation using pegylated arginine deiminase has activity against primary acute myeloid leukemia cells in vivo. Blood, 2015. 125(26): p. 4060-8. [0649] 32. Monu, N. R. and A. B. Frey, Myeloid-derived suppressor cells and anti-tumor T cells: a complex relationship. Immunol Invest, 2012. 41(6-7): p. 595-613. [0650] 33. Morris, S. M., Jr., Arginine metabolism: boundaries of our knowledge. J Nutr, 2007. 137(6 Suppl 2): p. 1602S-1609S. [0651] 34. Muenst, S., et al., The immune system and cancer evasion strategies: therapeutic concepts. J Intern Med, 2016. 279(6): p. 541-62. [0652] 35. Mumenthaler, S. M., et al., Expression of arginase II in prostate cancer. Int J Oncol, 2008. 32(2): p. 357-65. [0653] 36. Munder, M., et al., Suppression of T-cell functions by human granulocyte arginase.

[0654] Blood, 2006. 108(5): p. 1627-34. [0655] 37. Munn, D. H. and V. Bronte, Immune suppressive mechanisms in the tumor microenvironment. Curr Opin Immunol, 2016. 39: p. 1-6. [0656] 38. Mussai, F., et al., Acute myeloid leukemia creates an arginase-dependent immunosuppressive microenvironment. Blood, 2013. 122(5): p. 749-58. [0657] 39. Mussai, F., et al., Arginine dependence of acute myeloid leukemia blast proliferation: a novel therapeutic target. Blood, 2015. 125(15): p. 2386-96. [0658] 40. Mussai, F., et al., Neuroblastoma Arginase Activity Creates an Immunosuppressive Microenvironment That Impairs Autologous and Engineered Immunity. Cancer Res, 2015. 75(15): p. 3043-53. [0659] 41. Odri, G. A., et al., Zoledronic acid as a new adjuvant therapeutic strategy for Ewing's sarcoma patients. Cancer Res, 2010. 70(19): p. 7610-9. [0660] 42. Osbourn, J. K., et al., Generation of a panel of related human scFv antibodies with high affinities for human CEA. Immunotechnology, 1996. 2(3): p. 181-96. [0661] 43. Pandey, D., et al., OxLDL triggers retrograde translocation of arginase2 in aortic endothelial cells via ROCK and mitochondrial processing peptidase. Circ Res, 2014. 115(4): p. 450-9. [0662] 44. Persic, L., et al., An integrated vector system for the eukaryotic expression of antibodies or their fragments after selection from phage display libraries. Gene, 1997. 187(1): p. 9-18. [0663] 45. Polat, M. F., et al., Elevated serum arginase activity levels in patients with breast cancer. Surg Today, 2003. 33(9): p. 655-61. [0664] 46. Rabinovich, G. A., D. Gabrilovich, and E. M. Sotomayor, Immunosuppressive strategies that are mediated by tumor cells. Annu Rev Immunol, 2007. 25: p. 267-96. [0665] 47. Rodriguez, P. C., et al., Arginase I production in the tumor microenvironment by mature myeloid cells inhibits T-cell receptor expression and antigen-specific T-cell responses. Cancer Res, 2004. 64(16): p. 5839-49. [0666] 48. Rodriguez, P. C., et al., Regulation of T cell receptor CD3zeta chain expression by L-arginine. J Biol Chem, 2002. 277(24): p. 21123-9. [0667] 49. Rotondo, R., et al., Arginase 2 is expressed by human lung cancer, but it neither induces immune suppression, nor affects disease progression. Int J Cancer, 2008. 123(5): p. 1108-16. [0668] 50. Sabio, G., et al., Glu-256 is a main structural determinant for oligomerisation of human arginase I. FEBS Lett, 2001. 501(2-3): p. 161-5. [0669] 51. Sankaralingam, S., H. Xu, and S. T. Davidge, Arginase contributes to endothelial cell oxidative stress in response to plasma from women with preeclampsia. Cardiovasc Res, 2010. 85(1): p. 194-203. [0670] 52. Schier, R., et al., Isolation of high-affinity monomeric human anti-c-erbB-2 single chain Fv using affinity-driven selection. J Mol Biol, 1996. 255(1): p. 28-43. [0671] 53. Setty, B. A., et al., Hypoxic Proliferation of Osteosarcoma Cells Depends on Arginase II. Cell Physiol Biochem, 2016. 39(2): p. 802-13. [0672] 54. Singh, R., et al., Proteomic identification of mitochondrial targets of arginase in human breast cancer. PLoS One, 2013. 8(11): p. e79242. [0673] 55. Sousa, M. S., et al., Arginase 2 and nitric oxide synthase: Pathways associated with the pathogenesis of thyroid tumors. Free Radic Biol Med, 2010. 49(6): p. 997-1007. [0674] 56. Steggerda, S. M., et al., Inhibition of arginase by CB-1158 blocks myeloid cell-mediated immune suppression in the tumor microenvironment. J Immunother Cancer, 2017. 5(1): p. 101. [0675] 57. Thompson, J., et al., Affinity maturation of a high-affinity human monoclonal antibody against the third hypervariable loop of human immunodeficiency virus: use of phage display to improve affinity and broaden strain reactivity. J Mol Biol, 1996. 256(1): p. 77-88. [0676] 58. Thompson, J. D., D. G. Higgins, and T. J. Gibson, CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res, 1994. 22(22): p. 4673-80. [0677] 59. Timosenko, E., A. V. Hadjinicolaou, and V. Cerundolo, Modulation of cancer-specific immune responses by amino acid degrading enzymes. Immunotherapy, 2017. 9(1): p. 83-97. [0678] 60. Umansky, V., et al., Interactions among myeloid regulatory cells in cancer. Cancer Immunol Immunother, 2018. [0679] 61. Vaughan, T. J., et al., Human antibodies with sub-nanomolar affinities isolated from a large non-immunized phage display library. Nat Biotechnol, 1996. 14(3): p. 309-14. [0680] 62. Xu, W., et al., Increased arginase II and decreased NO synthesis in endothelial cells of patients with pulmonary arterial hypertension. FASEB J, 2004. 18(14): p. 1746-8. [0681] 63. Xue, J., L. D. Nelin, and B. Chen, Hypoxia induces arginase II expression and increases viable human pulmonary artery smooth muscle cell numbers via AMPKalpha1 signaling. Am J Physiol Lung Cell Mol Physiol, 2017. 312(4): p. L568-L578. [0682] 64. Yaiw, K. C., et al., Human cytomegalovirus induces upregulation of arginase II: possible implications for vasculopathies. Basic Res Cardiol, 2014. 109(2): p. 401. [0683] 65. Yepuri, G., et al., Positive crosstalk between arginase-II and S6K1 in vascular endothelial inflammation and aging. Aging Cell, 2012. 11(6): p. 1005-16. [0684] 66. Yu, Y., et al., p38 mitogen-activated protein kinase is involved in arginase-II-mediated eNOS-uncoupling in obesity. Cardiovasc Diabetol, 2014. 13: p. 113. [0685] 67. Zaytouni, T., et al., Critical role for arginase 2 in obesity-associated pancreatic cancer. Nat Commun, 2017. 8(1): p. 242. [0686] 68. Zhao, H., et al., Molecular evolution by staggered extension process (StEP) in vitro recombination. Nat Biotechnol, 1998. 16(3): p. 258-61.

[0687] Sequence Listing Free Text

TABLE-US-00033 Sequence ID Clone Name Sequence Type 1 C0020065 VH DNA 2 C0020065 VH PRT 3 C0020065 CDR1 PRT 4 C0020065 CDR2 PRT 5 C0020065 CDR3 PRT 6 C0020065 VL DNA 7 C0020065 VL PRT 8 C0020065 CDR1 PRT 9 C0020065 CDR2 PRT 10 C0020065 CDR3 PRT 11 C0020187 VH DNA 12 C0020187 VH PRT 13 C0020187 CDR1 PRT 14 C0020187 CDR2 PRT 15 C0020187 CDR3 PRT 16 C0020187 VL DNA 17 C0020187 VL PRT 18 C0020187 CDR1 PRT 19 C0020187 CDR2 PRT 20 C0020187 CDR3 PRT 21 C0021017 VH DNA 22 C0021017 VH PRT 23 C0021017 CDR1 PRT 24 C0021017 CDR2 PRT 25 C0021017 CDR3 PRT 26 C0021017 VL DNA 27 C0021017 VL PRT 28 C0021017 CDR1 PRT 29 C0021017 CDR2 PRT 30 C0021017 CDR3 PRT 31 C0021021 VH DNA 32 C0021021 VH PRT 33 C0021021 CDR1 PRT 34 C0021021 CDR2 PRT 35 C0021021 CDR3 PRT 36 C0021021 VL DNA 37 C0021021 VL PRT 38 C0021021 CDR1 PRT 39 C0021021 CDR2 PRT 40 C0021021 CDR3 PRT 41 C0021022 VH DNA 42 C0021022 VH PRT 43 C0021022 CDR1 PRT 44 C0021022 CDR2 PRT 45 C0021022 CDR3 PRT 46 C0021022 VL DNA 47 C0021022 VL PRT 48 C0021022 CDR1 PRT 49 C0021022 CDR2 PRT 50 C0021022 CDR3 PRT 51 C0021032 VH DNA 52 C0021032 VH PRT 53 C0021032 CDR1 PRT 54 C0021032 CDR2 PRT 55 C0021032 CDR3 PRT 56 C0021032 VL DNA 57 C0021032 VL PRT 58 C0021032 CDR1 PRT 59 C0021032 CDR2 PRT 60 C0021032 CDR3 PRT 61 C0021061 VH DNA 62 C0021061 VH PRT 63 C0021061 CDR1 PRT 64 C0021061 CDR2 PRT 65 C0021061 CDR3 PRT 66 C0021061 VL DNA 67 C0021061 VL PRT 68 C0021061 CDR1 PRT 69 C0021061 CDR2 PRT 70 C0021061 CDR3 PRT 71 C0021065 VH DNA 72 C0021065 VH PRT 73 C0021065 CDR1 PRT 74 C0021065 CDR2 PRT 75 C0021065 CDR3 PRT 76 C0021065 VL DNA 77 C0021065 VL PRT 78 C0021065 CDR1 PRT 79 C0021065 CDR2 PRT 80 C0021065 CDR3 PRT 81 C0021089 VH DNA 82 C0021089 VH PRT 83 C0021089 CDR1 PRT 84 C0021089 CDR2 PRT 85 C0021089 CDR3 PRT 86 C0021089 VL DNA 87 C0021089 VL PRT 88 C0021089 CDR1 PRT 89 C0021089 CDR2 PRT 90 C0021089 CDR3 PRT 91 C0021092 VH DNA 92 C0021092 VH PRT 93 C0021092 CDR1 PRT 94 C0021092 CDR2 PRT 95 C0021092 CDR3 PRT 96 C0021092 VL DNA 97 C0021092 VL PRT 98 C0021092 CDR1 PRT 99 C0021092 CDR2 PRT 100 C0021092 CDR3 PRT 101 C0021096 VH DNA 102 C0021096 VH PRT 103 C0021096 CDR1 PRT 104 C0021096 CDR2 PRT 105 C0021096 CDR3 PRT 106 C0021096 VL DNA 107 C0021096 VL PRT 108 C0021096 CDR1 PRT 109 C0021096 CDR2 PRT 110 C0021096 CDR3 PRT 111 C0021097 VH DNA 112 C0021097 VH PRT 113 C0021097 CDR1 PRT 114 C0021097 CDR2 PRT 115 C0021097 CDR3 PRT 116 C0021097 VL DNA 117 C0021097 VL PRT 118 C0021097 CDR1 PRT 119 C0021097 CDR2 PRT 120 C0021097 CDR3 PRT 121 C0021098 VH DNA 122 C0021098 VH PRT 123 C0021098 CDR1 PRT 124 C0021098 CDR2 PRT 125 C0021098 CDR3 PRT 126 C0021098 VL DNA 127 C0021098 VL PRT 128 C0021098 CDR1 PRT 129 C0021098 CDR2 PRT 130 C0021098 CDR3 PRT 131 C0021101 VH DNA 132 C0021101 VH PRT 133 C0021101 CDR1 PRT 134 C0021101 CDR2 PRT 135 C0021101 CDR3 PRT 136 C0021101 VL DNA 137 C0021101 VL PRT 138 C0021101 CDR1 PRT 139 C0021101 CDR2 PRT 140 C0021101 CDR3 PRT 141 C0021118 VH DNA 142 C0021118 VH PRT 143 C0021118 CDR1 PRT 144 C0021118 CDR2 PRT 145 C0021118 CDR3 PRT 146 C0021118 VL DNA 147 C0021118 VL PRT 148 C0021118 CDR1 PRT 149 C0021118 CDR2 PRT 150 C0021118 CDR3 PRT 151 C0021124 VH DNA 152 C0021124 VH PRT 153 C0021124 CDR1 PRT 154 C0021124 CDR2 PRT 155 C0021124 CDR3 PRT 156 C0021124 VL DNA 157 C0021124 VL PRT 158 C0021124 CDR1 PRT 159 C0021124 CDR2 PRT 160 C0021124 CDR3 PRT 161 C0021128 VH DNA 162 C0021128 VH PRT 163 C0021128 CDR1 PRT 164 C0021128 CDR2 PRT 165 C0021128 CDR3 PRT 166 C0021128 VL DNA 167 C0021128 VL PRT 168 C0021128 CDR1 PRT 169 C0021128 CDR2 PRT 170 C0021128 CDR3 PRT 171 C0021129 VH DNA 172 C0021129 VH PRT 173 C0021129 CDR1 PRT 174 C0021129 CDR2 PRT 175 C0021129 CDR3 PRT 176 C0021129 VL DNA 177 C0021129 VL PRT 178 C0021129 CDR1 PRT 179 C0021129 CDR2 PRT 180 C0021129 CDR3 PRT 181 C0021131 VH DNA 182 C0021131 VH PRT 183 C0021131 CDR1 PRT 184 C0021131 CDR2 PRT 185 C0021131 CDR3 PRT 186 C0021131 VL DNA 187 C0021131 VL PRT 188 C0021131 CDR1 PRT 189 C0021131 CDR2 PRT 190 C0021131 CDR3 PRT 191 C0021133 VH DNA 192 C0021133 VH PRT 193 C0021133 CDR1 PRT 194 C0021133 CDR2 PRT 195 C0021133 CDR3 PRT 196 C0021133 VL DNA 197 C0021133 VL PRT 198 C0021133 CDR1 PRT 199 C0021133 CDR2 PRT 200 C0021133 CDR3 PRT 201 C0021135 VH DNA 202 C0021135 VH PRT 203 C0021135 CDR1 PRT 204 C0021135 CDR2 PRT 205 C0021135 CDR3 PRT 206 C0021135 VL DNA 207 C0021135 VL PRT 208 C0021135 CDR1 PRT 209 C0021135 CDR2 PRT 210 C0021135 CDR3 PRT 211 C0021139 VH DNA 212 C0021139 VH PRT 213 C0021139 CDR1 PRT 214 C0021139 CDR2 PRT 215 C0021139 CDR3 PRT 216 C0021139 VL DNA 217 C0021139 VL PRT 218 C0021139 CDR1 PRT 219 C0021139 CDR2 PRT 220 C0021139 CDR3 PRT 221 C0021141 VH DNA 222 C0021141 VH PRT 223 C0021141 CDR1 PRT 224 C0021141 CDR2 PRT 225 C0021141 CDR3 PRT 226 C0021141 VL DNA 227 C0021141 VL PRT 228 C0021141 CDR1 PRT 229 C0021141 CDR2 PRT 230 C0021141 CDR3 PRT 231 C0021142 VH DNA 232 C0021142 VH PRT 233 C0021142 CDR1 PRT 234 C0021142 CDR2 PRT 235 C0021142 CDR3 PRT 236 C0021142 VL DNA 237 C0021142 VL PRT 238 C0021142 CDR1 PRT 239 C0021142 CDR2 PRT 240 C0021142 CDR3 PRT 241 C0021142 IgG VH DNA 242 C0021142 IgG VH PRT 243 C0021142 IgG CDR1 PRT 244 C0021142 IgG CDR2 PRT 245 C0021142 IgG CDR3 PRT 246 C0021142 IgG VL DNA 247 C0021142 IgG VL PRT 248 C0021142 IgG CDR1 PRT 249 C0021142 IgG CDR2 PRT 250 C0021142 IgG CDR3 PRT 251 C0021144 VH DNA 252 C0021144 VH PRT 253 C0021144 CDR1 PRT 254 C0021144 CDR2 PRT 255 C0021144 CDR3 PRT 256 C0021144 VL DNA 257 C0021144 VL PRT 258 C0021144 CDR1 PRT 259 C0021144 CDR2 PRT 260 C0021144 CDR3 PRT 261 C0021155 VH DNA 262 C0021155 VH PRT 263 C0021155 CDR1 PRT 264 C0021155 CDR2 PRT 265 C0021155 CDR3 PRT 266 C0021155 VL DNA 267 C0021155 VL PRT 268 C0021155 CDR1 PRT 269 C0021155 CDR2 PRT 270 C0021155 CDR3 PRT 271 C0021158 VH DNA 272 C0021158 VH PRT 273 C0021158 CDR1 PRT 274 C0021158 CDR2 PRT 275 C0021158 CDR3 PRT 276 C0021158 VL DNA 277 C0021158 VL PRT 278 C0021158 CDR1 PRT 279 C0021158 CDR2 PRT 280 C0021158 CDR3 PRT 281 C0021158 IgG VH DNA 282 C0021158 IgG VH PRT 283 C0021158 IgG CDR1 PRT 284 C0021158 IgG CDR2 PRT 285 C0021158 IgG CDR3 PRT 286 C0021158 IgG VL DNA 287 C0021158 IgG VL PRT 288 C0021158 IgG CDR1 PRT 289 C0021158 IgG CDR2 PRT 290 C0021158 IgG CDR3 PRT 291 C0021158 dr VH DNA 292 C0021158 dr VH PRT 293 C0021158 dr CDR1 PRT 294 C0021158 dr CDR2 PRT 295 C0021158 dr CDR3 PRT 296 C0021158 dr VL DNA 297 C0021158 dr VL PRT 298 C0021158 dr CDR1 PRT 299 C0021158 dr CDR2 PRT 300 C0021158 dr CDR3 PRT 301 C0021158 fgl VH DNA 302 C0021158 fgl VH PRT 303 C0021158 fgl CDR1 PRT 304 C0021158 fgl CDR2 PRT 305 C0021158 fgl CDR3 PRT 306 C0021158 fgl VL DNA 307 C0021158 fgl VL PRT 308 C0021158 fgl CDR1 PRT 309 C0021158 fgl CDR2 PRT 310 C0021158 fgl CDR3 PRT 311 C0021158 fgl2 VH DNA 312 C0021158 fgl2 VH PRT 313 C0021158 fgl2 CDR1 PRT 314 C0021158 fgl2 CDR2 PRT 315 C0021158 fgl2 CDR3 PRT 316 C0021158 fgl2 VL DNA 317 C0021158 fgl2 VL PRT 318 C0021158 fgl2 CDR1 PRT 319 C0021158 fgl2 CDR2 PRT 320 C0021158 fgl2 CDR3 PRT 321 C0021177 VH DNA 322 C0021177 VH PRT 323 C0021177 CDR1 PRT 324 C0021177 CDR2 PRT 325 C0021177 CDR3 PRT 326 C0021177 VL DNA 327 C0021177 VL PRT 328 C0021177 CDR1 PRT 329 C0021177 CDR2 PRT 330 C0021177 CDR3 PRT 331 C0021180 VH DNA 332 C0021180 VH PRT 333 C0021180 CDR1 PRT 334 C0021180 CDR2 PRT 335 C0021180 CDR3 PRT 336 C0021180 VL DNA 337 C0021180 VL PRT 338 C0021180 CDR1 PRT 339 C0021180 CDR2 PRT 340 C0021180 CDR3 PRT 341 C0021181 VH DNA 342 C0021181 VH PRT 343 C0021181 CDR1 PRT 344 C0021181 CDR2 PRT 345 C0021181 CDR3 PRT 346 C0021181 VL DNA 347 C0021181 VL PRT 348 C0021181 CDR1 PRT 349 C0021181 CDR2 PRT 350 C0021181 CDR3 PRT

[0688] ARG2 Amino Acid Sequences

TABLE-US-00034 SEQ ID NO: 351 N-terminal Avi tag AGLNDIFEAQKIEWHE SEQ ID NO: 352 Avi-huARG1-His10 MAGLNDIFEAQKIEWHEGGGMSAKSRTIGIIGAPFSKGQPRGGVEEGPTV LRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDIN TPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLS FDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKGGGHHHHH HHHHH SEQ ID NO: 353 Avi-huARG2-His10 MAGLNDIFEAQKIEWHEGGGVHSVAVIGAPFSQGQKRKGVEHGPAAIREA GLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEV VSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPL TTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVD PPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDI DAFDPTLAPATGTPVVGGLTYRHGMYIAEEIHNTGLLSALDLVEVNPQLA TSEEEAKTTANLAVDVIASSFGQTKEGGHIVYDQLPTPSSPDESENQARV RIGGGHHHHHHHHHH SEQ ID NO: 354 Avi-huARG2-His10 Monomer MAGLNDIFEAQKIEWHEGGGVHSVAIVGAPFSRGQKKLGVEYGPAAIREA GLLKRLSRLGCHLKDFGDLSFTNVPQDDPYNNLVVYPRSVGLANQELAEV VSRAVSGGYSCVTMGGDHSLAIGTIIGHARHRPDLCVIWVDAHADINTPL TTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPNIVYIGLRDVE PPEHFILKNYDIQYFSMREIDRLGIQKVMEQTFDRLIGKRQRPIHLSFDI DAFDPKLAPATGTPVVGGLTYRQGVYITEEIHNTGLLSALDLVEVNPHLA TSEEEAKATARLAVDVIASSFGQTREGGHIVYDHLPTPSSPHESENEECV RIGGGHHHHHHHHHH SEQ ID NO: 355 huARG2-His10 MVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDL SFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHS LAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLREL QDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRD IDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGL TYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIAS SFGQTREGGHIVYDQLPTPSSPDESENQARVRIGGGHHHHHHHHHH SEQ ID NO: 356 Avi-cynoARG2-His10 MAGLNDIFEAQKIEWHEGGGVHSVAVIGAPFSQGQKRKGVEHGPAAIREA GLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEV VSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPL TTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSPSIVYIGLRDVD PPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIGKRQRPIHLSFDI DAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLA TSEEEAKTTANLAVDVIASSFGQTREGGHIVYGQLPTPSSPDESENQARV RIGGGHHHHHHHHHH SEQ ID NO: 357 huARG2-His6 MVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDL SFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHS LAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLREL QDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRD IDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGL TYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIAS SFGQTREGGHIVYDQLPTPSSPDESENQARVRIHHHHHH