ANTIBODIES FOR MODULATING BINDING BETWEEN LRP AND WISE
20190194314 ยท 2019-06-27
Inventors
Cpc classification
C07K2317/30
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C12N5/163
CHEMISTRY; METALLURGY
A61K39/001102
HUMAN NECESSITIES
International classification
Abstract
The present invention provides, inter alia, antibodies that modulate binding between Lrp5 and WISE or Lrp6 and WISE, but do not modulate binding between Lrp4 and WISE. Also provided are pharmaceutical compositions and kits containing such antibodies. Further provided are methods for preventing WISE binding to Lrp5 or Lrp6, but not WISE binding to Lrp4.
Claims
1. An antibody that modulates binding between Lrp5 and WISE or Lrp6 and WISE, but does not modulate binding between Lrp4 and WISE.
2. The antibody according to claim 1, wherein the antibody prevents binding between Lrp5 and WISE or Lrp6 and WISE.
3. The antibody according to claim 1, wherein the antibody binds specifically to Lrp5 or Lrp6.
4. The antibody according to claim 1, wherein the antibody binds specifically to Lrp5.
5. The antibody according to claim 1, wherein the antibody binds specifically to Lrp6.
6. The antibody according to claim 1, wherein the Lrp4, Lrp5, and Lrp6 are human.
7. The antibody according to claim 1, wherein the antibody is monoclonal.
8. The antibody according to claim 1, wherein the antibody is human, humanized, or chimeric.
9. The antibody according to claim 3, wherein the antibody specifically binds to Lrp5 or Lrp6 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-39.
10. The antibody according to claim 9, wherein the antibody specifically binds to Lrp5 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-15.
11. The antibody according to claim 9, wherein the antibody specifically binds to Lrp6 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-3 and 16-27.
12. The antibody according to claim 9, wherein the antibody specifically binds to Lrp5 or Lrp6 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-3 and 28-39.
13. The antibody according to claim 3, wherein the antibody specifically binds to Lrp5 or Lrp6 within a sequence selected from the group consisting of SEQ ID NOs:40-48.
14. A pharmaceutical composition comprising an antibody of claim 1 and at least one pharmaceutically acceptable excipient or diluent.
15. A method for preventing WISE binding to Lrp5 or Lrp6, but not WISE binding to Lrp4, comprising contacting Lrp5 or Lrp6 with an agent that binds to Lrp5 or Lrp6 but not Lrp4.
16. The method according to claim 15, wherein the agent is an antibody.
17. The method according to claim 16, wherein the antibody is monoclonal.
18. The method according to claim 16, wherein the antibody specifically binds to Lrp5 or Lrp6 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-39.
19. The method according to claim 16, wherein antibody specifically binds to Lrp5 or Lrp6 within a sequence selected from the group consisting of SEQ ID NOs:40-48.
20. A method for preventing human WISE from binding to human Lrp5 or human Lrp6 comprising contacting human WISE with a monoclonal antibody, which antibody specifically binds to human Lrp5 or human Lrp6 but not to human Lrp4.
21. The method according to claim 20, wherein the antibody specifically binds to human Lrp5 or human Lrp6 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-39.
22. The method according to claim 20, wherein the antibody specifically binds to human Lrp5 or human Lrp6 within a sequence selected from the group consisting of SEQ ID NOs:40-48.
23. A kit comprising an antibody according to claim 1.
24. A kit to modulate binding between Lrp5 and WISE or Lrp6 and WISE, but not Lrp4 and WISE comprising a pharmaceutical composition according to claim 14.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0019] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION OF THE INVENTION
[0036] One embodiment of the present invention is an antibody that modulates binding between Lrp5 and WISE or Lrp6 and WISE, but does not modulate binding between Lrp4 and WISE.
[0037] As used herein, an antibody encompasses naturally occurring immunoglobulins as well as non-naturally occurring immunoglobulins, including, for example, single chain antibodies, chimeric antibodies (e.g., humanized murine antibodies) and heteroconjugate antibodies (e.g., bispecific antibodies), as well as antigen-binding fragments thereof, (e.g., Fab, F(ab).sub.2, Fab, Fv, and rlgG). See also, e.g., Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, Ill.); Kuby, J., Immunology, 3rd Ed., W. H. Freeman & Co., New York (1998). The term antibody also includes bivalent or bispecific molecules, diabodies, triabodies, and tetrabodies. Bivalent and bispecific molecules are described in, e.g., Kostelny et al. (1992) J Immunol 148:1547, Pack and Pluckthun (1992) Biochemistry 31:1579, Hollinger et al., 1993, supra, Gruber et al. (1994) J Immunol:5368, Zhu et al. (1997) Protein Sci 6:781, Hu et al. (1996) Cancer Res. 56:3055, Adams et al. (1993) Cancer Res. 53:4026, and McCartney, et al. (1995) Protein Eng. 8:301. Non-naturally occurring antibodies can be constructed using solid phase peptide synthesis, can be produced recombinantly, or can be obtained, for example, by screening combinatorial libraries consisting of variable heavy chains and variable light chains as described by Huse et al., Science 246:1275-1281 (1989), which is incorporated herein by reference. These and other methods of making, for example, chimeric, humanized, CDR-grafted, single chain, and bifunctional antibodies, are well known to those skilled in the art (Winter and Harris, Immunol. Today 14:243-246 (1993); Ward et al., Nature 341:544-546 (1989); Harlow and Lane, supra, 1988; Hilyard et al., Protein Engineering: A practical approach (IRL Press 1992); Borrabeck, Antibody Engineering, 2d ed. (Oxford University Press 1995); each of which is incorporated herein by reference).
[0038] The term antibody includes both polyclonal and monoclonal antibodies. The term monoclonal antibody, as used herein, refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic epitope. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of antibodies directed against (or specific for) different epitopes. The modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al., Nature 256: 495 (1975), or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature 352: 624-628 (1991) and Marks et al., J. Mol. Biol. 222: 581-597 (1991), for example.
[0039] Typically, an antibody has a heavy and a light chain. Each heavy and light chain contains a constant region and a variable region, (the regions are also known as domains). Light and heavy chain variable regions contain four framework regions interrupted by three hypervariable regions, also called complementarity-determining regions or CDRs. The extent of the framework regions and CDRs have been defined. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three dimensional space.
[0040] The CDRs are primarily responsible for binding to an epitope of an antigen. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located. Thus, a V.sub.H CDR3 is located in the variable domain of the heavy chain of the antibody, whereas a V.sub.L CDR1 is the CDR1 from the variable domain of the light chain of the antibody. As used herein, V.sub.H refers to the variable region of an immunoglobulin heavy chain of an antibody, including the heavy chain of an Fv, scFv, or Fab. V.sub.L refers to the variable region of an immunoglobulin light chain, including the light chain of an Fv, scFv, dsFv or Fab.
[0041] The phrase single chain Fv or scFv refers to an antibody in which the variable domains of the heavy chain and of the light chain of a traditional two chain antibody have been joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.
[0042] For application in man, it is often desirable to reduce immunogenicity of antibodies originally derived from other species, like mouse. This can be done by construction of chimeric antibodies, or by a process called humanization. In this context, a chimeric antibody is understood to be an antibody comprising a domain (e.g. a variable domain) derived from one species (e.g. mouse) fused to a domain (e.g. the constant domains) derived from a different species (e.g. human).
[0043] As used herein, the term humanized antibody refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol 2:593-596 (1992)). Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
[0044] Furthermore, technologies have been developed for creating antibodies based on sequences derived from the human genome, for example by phage display or using transgenic animals (WO 90/05144; D. Marks, H. R. Hoogenboom, T. P. Bonnert, J. McCafferty, A. D. Griffiths and G. Winter (1991) By-passing immunisation. Human antibodies from V-gene libraries displayed on phage. J. Mol. Biol., 222, 581-597; Knappik et al., J. Mol. Biol. 296: 57-86, 2000; S. Carmen and L. Jermutus, Concepts in antibody phage display. Briefings in Functional Genomics and Proteomics 2002 1(2):189-203; Lonberg N, Huszar D. Human antibodies from transgenic mice. Int Rev Immunol. 1995; 13(1):65-93.; Bruggemann M, Taussig M J. Production of human antibody repertoires in transgenic mice. Curr Opin Biotechnol. 1997 August; 8(4):455-8.). Such antibodies are human antibodies in the context of the present invention.
[0045] Epitope or antigenic determinant refers to a site on an antigen to which an antibody binds. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in an unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996). A preferred method for epitope mapping is surface plasmon resonance.
[0046] The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers, those containing modified residues, and non-naturally occurring amino acid polymers.
[0047] The term amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
[0048] The phrase binds specifically or specific binding refers to a binding reaction between two molecules that is at least two times the background and more typically more than 10 to 100 times background molecular associations under physiological conditions. When using one or more detectable binding agents that are proteins, specific binding is determinative of the presence of the protein, in a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein sequence, thereby identifying its presence.
[0049] Specific binding to an antibody under such conditions requires an antibody that is selected for its specificity for a particular protein. This selection may be achieved by subtracting out antibodies that cross-react with other molecules. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity). Methods of determining binding affinity and specificity are well known in the art (see, for example, Harlow and Lane, Antibodies: A laboratory manual (Cold Spring Harbor Laboratory Press, 1988); Friefelder, Physical Biochemistry: Applications to biochemistry and molecular biology (W. H. Freeman and Co. 1976)).
[0050] Furthermore, a binding agent can interfere with the specific binding of a receptor, for example, an Lrp such as Lrp5 or Lrp6, and its ligand, for example, WISE, by various mechanism, including, for example, by binding to the ligand binding site, thereby interfering with ligand binding; by binding to a site other than the ligand binding site of the receptor, but sterically interfering with ligand binding to the receptor; by binding the receptor and causing a conformational or other change in the receptor, which interferes with binding of the ligand; or by other mechanisms. Similarly, the agent can bind to or otherwise interact with the ligand to interfere with its specifically interacting with the receptor. For purposes of the methods disclosed herein, an understanding of the mechanism by which the interference occurs is not required and no mechanism of action is proposed. An Lrp5 or Lrp6 antibody is characterized by having specific binding activity (K.sub.a) for an Lrp5 or Lrp6 of at least about 10.sup.5 mol.sup.?1, 10.sup.6 mol.sup.?1 or greater, preferably 10.sup.7 mol.sup.?1 or greater, more preferably 10.sup.8 mol.sup.?1 or greater, and most preferably 10.sup.9 mol.sup.?1 or greater. The binding affinity of an antibody can be readily determined by one of ordinary skill in the art, for example, by Scatchard analysis (Scatchard, Ann. N.Y. Acad. Sci. 51: 660-72, 1949).
[0051] As used herein, modulate, modulates, modulating, or other grammatical variations thereof means to change.
[0052] Non-limiting representative protein sequences for Lrp5 are listed in SEQ ID NOs.53-56, and the corresponding cDNAs are listed in SEQ ID NOs:383-386. Preferably, the Lrp5 is human (such as SEQ ID NO:54, a mature form or an isoform thereof). As used herein, the mature form of a protein means the form after post-translational processing, including the removal of signal sequences, which, in the case of the Lrps, are the approximately 20 N-terminal amino acids. As used herein isoform means an alternative form of a protein resulting from differential transcription of the relevant gene either from an alternative promoter or an alternate splicing site.
[0053] Non-limiting representative protein sequences for Lrp6 are listed in SEQ ID NOs:57-60, and the corresponding cDNAs are listed in SEQ ID NOs. 387-390. Preferably, the Lrp6 is human such as SEQ ID NO:58, a mature form or an isoform thereof).
[0054] Non-limiting representative protein sequences for WISE are listed in SEQ ID NOs:61-64, and the corresponding cDNAs are listed in SEQ ID NOs:391-394. Preferably, the WISE is human (such as SEQ ID NO:62, a mature form or an isoform thereof).
[0055] Non-limiting representative protein sequences for Lrp4 are listed in SEQ ID NOs:49-52, and the corresponding cDNAs are listed in SEQ ID NOs:379-382. Preferably, the Lrp4 is human such as SEQ ID NO:50, a mature form or an isoform thereof).
[0056] In one aspect of this embodiment, the antibody prevents binding between Lrp5 and WISE or Lrp6 and WISE. For example, the antibody may specifically bind to Lrp5 or Lrp6 at one or more sequences selected from the group consisting of SEQ ID NOs: 1-39, such as one or more of SEQ ID NOs: 1-15, one or more of SEQ ID NOs: 1-3 and 16-27, or one or more of SEQ ID NOs: 1-3 and 28-39. Preferably, the antibody binds specifically to Lrp5. In another preferred embodiment, the antibody binds specifically to Lrp6.
[0057] The details of SEQ ID NOs:1-39 are listed below.
TABLE-US-00001 (SEQIDNO:1) HVTGASSSSSSSTK (SEQIDNO:2) ISLDTPDFTDIVLQ (SEQIDNO:3) VIIDQLPDLMGLKA Lrp5 (SEQIDNO:16) IEVANLNGTSRK Lrp6 (SEQIDNO:28) IEVSNLDGSLRK Consensus (SEQIDNO:4) IEVXNLXGXXRK Lrp5 (SEQIDNO:17) AGAEEVLLLAR Lrp6 (SEQIDNO:29) DGATELLLLAR Consensus (SEQIDNO:5) XGAXEXLLLAR Lrp5 (SEQIDNO:18) ISLDTPDFTDIVLQVDDIR Lrp6 (SEQIDNO:30) ISLDTPDFTDIVLQLEDIR Consensus (SEQIDNO:6) ISLDTPDFTDIVLQXXDIR Lrp5 (SEQIDNO:19) ANLDGQERR Lrp6 (SEQIDNO:31) AALDGSDRV Consensus (SEQIDNO:7) AXLDGXXRX Lrp5 (SEQIDNO:20) ISLETNNNDVAIPLTGVK Lrp6 (SEQIDNO:32) ISLETNNNNVAIPLTGVK Consensus (SEQIDNO:8) ISLETNNNXVAIPLTGVK Lrp5 (SEQIDNO:21) EASALDFDVSNNH Lrp6 (SEQIDNO:33) EASALDFDVTNDR Consensus (SEQIDNO:9) EASALDFDVXNXX Lrp5 (SEQIDNO:22) IYWTDVSLKT Lrp6 (SEQIDNO:34) IYWTDISLKT Consensus (SEQIDNO:10) IYWTDXSLKT Lrp5 (SEQIDNO:23) AIVVNAER Lrp6 (SEQIDNO:35) AVVVNPEK Consensus (SEQIDNO:11) AXVVNXEX Lrp5 (SEQIDNO:24) RIESCDLSGANR Lrp6 (SEQIDNO:36) RIESSDLSGANR Consensus (SEQIDNO:12) RIESXDLSGANR Lrp5 (SEQIDNO:25) CASGQCVLI Lrp6 (SEQIDNO:37) CANGQCIGK Consensus (SEQIDNO:13) CAXGQCXXX Lrp5 (SEQIDNO:26) CDSFPDCIDG Lrp6 (SEQIDNO:38) CDHNVDCSDK Consensus (SEQIDNO:14) CDXXXCDXDX Lrp5 (SEQIDNO:27) NHVTGASSSSSSSTK Lrp6 (SEQIDNO:39) AHVTGASSSSSSSTK Consensus (SEQIDNO:15) XHVTGASSSSSSSTK
[0058] In another aspect of this embodiment, the antibody specifically binds to Lrp5 or Lrp6 within a sequence selected from the group consisting of SEQ ID NOs:40-48. For example, such an antibody may specifically bind to Lrp5 or Lrp6 at SEQ ID NOs:65-378. It is noted that SEQ ID NOs: 46 and 47 contain the amino acid sequences just before the transmembrane domain of Lrp5 and Lrp6, respectively. The identified portions of the Lrp5 and Lrp6 are very similar to each other, but are very different from the sequence of Lrp4 (see
[0059] The details of SEQ ID NOs:40-48 are listed below.
TABLE-US-00002 Lrp5 (SEQIDNO:40) ERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTN Lrp6 (SEQIDNO:41) ERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSN Consensus (SEQIDNO:42) ERVHKXXAXRXVIIDQLPDLMGLKAXNVXXVXGXN Lrp5 (SEQIDNO:43) RISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKT Lrp6 (SEQIDNO:44) RISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKT Consensus (SEQIDNO:45) RISLETNNNXVAIPLTGVKEASALDFDVXXNXIYWTDXSLKT Lrp5 (SEQIDNO:46) KGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGA WRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQD RSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDEL Lrp6 (SEQIDNO:47) KGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVA WRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDK SDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDDEL Consensus (SEQIDNO:48) KGDGTXRCSCPXHLVLLQXXLXCGEPPTCSPXQFXCXTGEIDCIPXA WRCDGFXECXDXSDEXXCPVCSXXQFXCAXGQCXDXXLRCXGXAXCQDX SDEXXCXXLCLXXQFRCAXGQCXXXXXXCDXXXDCXDXSDEL
[0060] In another aspect of this embodiment, Lrp4, Lrp5, and Lrp6 are human.
[0061] In an additional aspect of this embodiment, the antibody is monoclonal.
[0062] In a further aspect of this embodiment, the antibody is human, humanized, or chimeric.
[0063] Another embodiment of the present invention is a pharmaceutical composition. This pharmaceutical composition comprises an antibody of the present invention such as, e.g., an antibody that modulates binding between Lrp5 and WISE or Lrp6 and WISE, but does not modulate binding between Lrp4 and WISE, and at least one pharmaceutically acceptable excipient or diluent.
[0064] A further embodiment of the present invention is a method for preventing WISE binding to Lrp5 or Lrp6, but not WISE binding to Lrp4, comprising contacting Lrp5 or Lrp6 with an agent that binds to Lrp5 or Lrp6 but not Lrp4.
[0065] A binding agent according to the present invention may be an antibody, or non-immunoglobulin antibody mimics, sometimes called scaffold proteins, may be based on the genes of protein A, the lipocalins, a fibronectin domain, an ankyrin consensus repeat domain, and thioredoxin (Skerra, Current Opinion in Biotechnology 2007, 18(4): 295-304). A preferred embodiment in the context of the present invention are designed ankyrin repeat proteins (DARPin's; Steiner et al., J Mol Biol. 2008 Oct. 24; 382(5): 1211-27; Stumpp M T, Amstutz P. Curr Opin Drug Discov Devel. 2007 March; 10(2):153-9). Preferably, the agent is an antibody. More preferably, the antibody is monoclonal.
[0066] In one aspect of this embodiment, the agent is an antibody that specifically binds to Lrp5 or Lrp6. Preferred binding sites are as disclosed herein.
[0067] An additional embodiment of the present invention is a method for preventing human WISE from binding to human Lrp5 or human Lrp6 comprising contacting human WISE with a monoclonal antibody, which antibody specifically binds to human Lrp5 or human Lrp6 but not to human Lrp4. Preferred binding sites are as disclosed herein.
[0068] A further embodiment of the present invention is a kit. This kit comprises one or more of the antibodies of the present invention.
[0069] In the present invention, an effective amount or a therapeutically effective amount of a compound or composition disclosed herein is an amount of such compound or composition that is sufficient to effect beneficial or desired results as described herein when administered to a subject. Effective dosage forms, modes of administration, and dosage amounts may be determined empirically, and making such determinations is within the skill of the art. It is understood by those skilled in the art that the dosage amount will vary with the route of administration, the rate of excretion, the duration of the treatment, the identity of any other drugs being administered, the age, size, and species of mammal, e.g., human patient, and like factors well known in the arts of medicine and veterinary medicine. In general, a suitable dose of a composition according to the invention will be that amount of the composition, which is the lowest dose effective to produce the desired effect. The effective dose of a compound or composition of the present invention may be administered as two, three, four, five, six or more sub-doses, administered separately at appropriate intervals throughout the day.
[0070] A suitable, non-limiting example of a dosage of antibody in the compositions disclosed herein is from about 0.1 mg/kg to about 150 mg/kg per day, such as from about 0.5 mg/kg to about 50 mg/kg per day, including from about 1 mg/kg to about 100 mg/kg per day. Other representative dosages of such agents include about 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 1.5 mg/kg, 2 mg/kg, 2.5 mg/kg, 3 mg/kg, 3.5 mg/kg, 4 mg/kg, 4.5 mg/kg, 5 mg/kg, 5.5 mg/kg, 6 mg/kg, 6.5 mg/kg, 7 mg/kg, 7.5 mg/kg, 8 mg/kg, 8.5 mg/kg, 9 mg/kg, 9.5 mg/kg, 10 mg/kg, 11 mg/kg, 12 mg/kg, 13 mg/kg, 14 mg/kg, 15 mg/kg, 16 mg/kg, 17 mg/kg, 18 mg/kg, 19 mg/kg, 20 mg/kg, 21 mg/kg, 22 mg/kg, 23 mg/kg, 24 mg/kg, 25 mg/kg, 26 mg/kg, 27 mg/kg, 28 mg/kg, 29 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, 55 mg/kg, 60 mg/kg, 65 mg/kg, 70 mg/kg, 75 mg/kg, 80 mg/kg, 85 mg/kg, 90 mg/kg, 95 mg/kg, 100 mg/kg, 110 mg/kg, 120 mg/kg, 130 mg/kg, 140 mg/kg, and 150 mg/kg per day. The effective dose of antibody in the compositions disclosed herein maybe administered as two, three, four, five, six or more sub-doses, administered separately at appropriate intervals throughout the day.
[0071] A composition of the present invention may be administered in any desired and effective manner: for oral ingestion, or as an ointment or drop for local administration to the eyes, or for parenteral or other administration in any appropriate manner such as intraperitoneal, subcutaneous, topical, intradermal, inhalation, intrapulmonary, rectal, vaginal, sublingual, intramuscular, intravenous, intraarterial, intrathecal, or intralymphatic. Further, a composition of the present invention may be administered in conjunction with other treatments. A composition of the present invention maybe encapsulated or otherwise protected against gastric or other secretions, if desired.
[0072] The compositions of the invention comprise one or more active ingredients i.e., antibodies of the present invention, in admixture with one or more pharmaceutically-acceptable carriers and, optionally, one or more other compounds, drugs, ingredients and/or materials. Regardless of the route of administration selected, the agents/compounds of the present invention are formulated into pharmaceutically-acceptable dosage forms by conventional methods known to those of skill in the art. See, e.g., Remington, The Science and Practice of Pharmacy (21.sup.st Edition, Lippincott Williams and Wilkins, Philadelphia, Pa.).
[0073] Pharmaceutically acceptable carriers are well known in the art (see, e.g., Remington, The Science and Practice of Pharmacy (21.sup.st Edition, Lippincott Williams and Wilkins, Philadelphia, Pa.) and The National Formulary (American Pharmaceutical Association, Washington, D.C.)) and include sugars (e.g., lactose, sucrose, mannitol, and sorbitol), starches, cellulose preparations, calcium phosphates (e.g., dicalcium phosphate, tricalcium phosphate and calcium hydrogen phosphate), sodium citrate, water, aqueous solutions (e.g., saline, sodium chloride injection, Ringer's injection, dextrose injection, dextrose and sodium chloride injection, lactated Ringer's injection), alcohols (e.g., ethyl alcohol, propyl alcohol, and benzyl alcohol), polyols (e.g., glycerol, propylene glycol, and polyethylene glycol), organic esters (e.g., ethyl oleate and tryglycerides), biodegradable polymers (e.g., polylactide-polyglycolide, poly(orthoesters), and poly(anhydrides)), elastomeric matrices, liposomes, microspheres, oils (e.g., corn, germ, olive, castor, sesame, cottonseed, and groundnut), cocoa butter, waxes (e.g., suppository waxes), paraffins, silicones, talc, silicylate, etc. Each pharmaceutically acceptable carrier used in a pharmaceutical composition of the invention must be acceptable in the sense of being compatible with the other ingredients of the formulation and not injurious to the subject. Carriers suitable for a selected dosage form and intended route of administration are well known in the art, and acceptable carriers for a chosen dosage form and method of administration can be determined using ordinary skill in the art.
[0074] The compositions of the invention may, optionally, contain additional ingredients and/or materials commonly used in pharmaceutical compositions. These ingredients and materials are well known in the art and include (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and silicic acid; (2) binders, such as carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, hydroxypropylmethyl cellulose, sucrose and acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, sodium starch glycolate, cross-linked sodium carboxymethyl cellulose and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as cetyl alcohol and glycerol monostearate; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, and sodium lauryl sulfate; (10) suspending agents, such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth; (11) buffering agents; (12) excipients, such as lactose, milk sugars, polyethylene glycols, animal and vegetable fats, oils, waxes, paraffins, cocoa butter, starches, tragacanth, cellulose derivatives, polyethylene glycol, silicones, bentonites, silicic acid, talc, salicylate, zinc oxide, aluminum hydroxide, calcium silicates, and polyamide powder; (13) inert diluents, such as water or other solvents; (14) preservatives; (15) surface-active agents; (16) dispersing agents; (17) control-release or absorption-delaying agents, such as hydroxypropylmethyl cellulose, other polymer matrices, biodegradable polymers, liposomes, microspheres, aluminum monostearate, gelatin, and waxes; (18) opacifying agents; (19) adjuvants; (20) wetting agents; (21) emulsifying and suspending agents; (22), solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan; (23) propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane; (24) antioxidants; (25) agents which render the formulation isotonic with the blood of the intended recipient, such as sugars and sodium chloride; (26) thickening agents; (27) coating materials, such as lecithin; and (28) sweetening, flavoring, coloring, perfuming and preservative agents. Each such ingredient or material must be acceptable in the sense of being compatible with the other ingredients of the formulation and not injurious to the subject. Ingredients and materials suitable for a selected dosage form and intended route of administration are well known in the art, and acceptable ingredients and materials for a chosen dosage form and method of administration may be determined using ordinary skill in the art.
[0075] Compositions of the present invention suitable for parenteral administrations comprise one or more agent(s)/compound(s) in combination with one or more pharmaceutically-acceptable sterile isotonic aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain suitable antioxidants, buffers, solutes which render the formulation isotonic with the blood of the intended recipient, or suspending or thickening agents. Proper fluidity can be maintained, for example, by the use of coating materials, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. These compositions may also contain suitable adjuvants, such as wetting agents, emulsifying agents and dispersing agents. It may also be desirable to include isotonic agents. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption.
[0076] Pharmaceutical compositions may be prepared by mixing the antibody having the desired degree of purity with optional physiologically acceptable carriers, excipients, stabilizers, surfactants, buffers and/or tonicity agents. Acceptable carriers, excipients and/or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid, glutathione, cysteine, methionine and citric acid; preservatives (such as ethanol, benzyl alcohol, phenol, m-cresol, pchlor-m-cresol, methyl or propyl parabens, benzalkonium chloride or combinations thereof); amino acids such as arginine, glycine, ornithine, lysine, histidine, glutamic acid, aspartic acid, isoleucine, leucine, alanine, phenylalanine, tyrosine, tryptophan, methionine, serine, proline and combinations thereof; monosaccharides, disaccharides and other carbohydrates; low molecular weight (less than about 10 residues) polypeptides; proteins, such as gelatin or serum albumin; chelating agents such as EDTA; sugars such as trehalose, sucrose, lactose, glucose, mannose, maltose, galactose, fructose, sorbose, raffinose, glucosamine, N-Methylglucosamine (so-called Meglumine), galactosamine and neuraminic acid; and/or non-ionic surfactants such as Tween, Brij Pluronics, Triton-X or polyethylene glycol (PEG).
[0077] The pharmaceutical composition may be in a liquid form, a lyophilized form or a liquid form reconstituted from a lyophilized form, wherein the lyophilized preparation is to be reconstituted with a sterile solution prior to administration. The standard procedure for reconstituting a lyophilized composition is to add back a volume of pure water (typically equivalent to the volume removed during lyophilization), however, solutions comprising antibacterial agents also may be used for the production of pharmaceutical compositions for parenteral administration; see also Chen (1992) Drug Dev Ind Pharm 18, 1311-54.
[0078] Exemplary antibody concentrations in the pharmaceutical composition may range from about 1 mg/mL to about 200 mg/ml or from about 50 mg/mL to about 200 mg/mL, or from about 150 mg/mL to about 200 mg/mL. For clarity reasons, it is emphasized that the concentrations as indicated herein relate to the concentration in a liquid or in a liquid that is accurately reconstituted from a solid form.
[0079] An aqueous formulation of the antibody may be prepared in a pH-buffered solution, e.g., at pH ranging from about 4.0 to about 7.0, or from about 5.0 to about 6.0, or alternatively about 5.5. Examples of buffers that are suitable for a pH within this range include phosphate-, histidine-, citrate-, succinate-, acetate-buffers and other organic acid buffers. The buffer concentration can be from about 1 mM to about 100 mM, or from about 5 mM to about 50 mM, depending, e.g., on the buffer and the desired tonicity of the formulation.
[0080] A tonicity agent may be included in the antibody formulation to modulate the tonicity of the formulation. Exemplary tonicity agents include sodium chloride, potassium chloride, glycerin and any component from the group of amino acids, sugars as well as combinations thereof. Preferably, the aqueous formulation is isotonic, although hypertonic or hypotonic solutions may be suitable. The term isotonic denotes a solution having the same tonicity as some other solution with which it is compared, such as a physiological salt solution and the blood serum. Tonicity agents may be used in an amount of about 5 mM to about 350 mM, in particular in an amount of 105 mM to 305 nM.
[0081] A surfactant may also be added to the antibody formulation to reduce aggregation of the formulated antibody and/or minimize the formation of particulates in the formulation and/or reduce adsorption. Exemplary surfactants include polyoxyethylensorbitan fatty acid esters (Tween), polyoxyethylene alkyl ethers (Brij), alkylphenylpolyoxyethylene ethers (Triton-X), polyoxyethylene-polyoxypropylene copolymer (Poloxamer, Pluronic), and sodium dodecyl sulphate (SDS). Preferred polyoxyethylenesorbitan-fatty acid esters are polysorbate 20, (sold under the trademark Tween 20?) and polysorbate 80 (sold under the trademark Tween 80?). Preferred polyethylene-polypropylene copolymers are those sold under the names Pluronic? F68 or Poloxamer 188?. Preferred Polyoxyethylene alkyl ethers are those sold under the trademark Brij?. Exemplary concentrations of surfactant may range from about 0.001% to about 1% w/v.
[0082] A lyoprotectant may also be added in order to protect the labile active ingredient (e.g. a protein) against destabilizing conditions during the lyophilization process. For example, known lyoprotectants include sugars (including glucose and sucrose); polyols (including mannitol, sorbitol and glycerol); and amino acids (including alanine, glycine and glutamic acid). Lyoprotectants are generally used in an amount of about 10 mM to 500 nM.
[0083] In one embodiment, the formulation contains the above-identified agents (i.e. antibody, surfactant, buffer, stabilizer and/or tonicity agent) and is essentially free of one or more preservatives, such as ethanol, benzyl alcohol, phenol, m-cresol, p-chlor-m-cresol, methyl or propyl parabens, benzalkonium chloride, and combinations thereof. In another embodiment, a preservative may be included in the formulation, e.g., at concentrations ranging from about 0.001 to about 2% (w/v).
[0084] Compositions of the present invention suitable for oral administration may be in the form of capsules, cachets, pills, tablets, powders, granules, a solution or a suspension in an aqueous or non-aqueous liquid, an oil-in-water or water-in-oil liquid emulsion, an elixir or syrup, a pastille, a bolus, an electuary or a paste. These formulations may be prepared by methods known in the art, e.g., by means of conventional pan-coating, mixing, granulation or lyophilization processes.
[0085] Solid dosage forms for oral administration (capsules, tablets, pills, dragees, powders, granules and the like) may be prepared, e.g., by mixing the active ingredient(s) with one or more pharmaceutically-acceptable carriers and, optionally, one or more fillers, extenders, binders, humectants, disintegrating agents, solution retarding agents, absorption accelerators, wetting agents, absorbents, lubricants, and/or coloring agents. Solid compositions of a similar type maybe employed as fillers in soft and hard-filled gelatin capsules using a suitable excipient. A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared using a suitable binder, lubricant, inert diluent, preservative, disintegrant, surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine. The tablets, and other solid dosage forms, such as dragees, capsules, pills and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art. They may also be formulated so as to provide slow or controlled release of the active ingredient therein. They may be sterilized by, for example, filtration through a bacteria-retaining filter. These compositions may also optionally contain opacifying agents and may be of a composition such that they release the active ingredient only, or preferentially, in a certain portion of the gastrointestinal tract, optionally, in a delayed manner. The active ingredient can also be in microencapsulated form.
[0086] Liquid dosage forms for oral administration include pharmaceutically-acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. The liquid dosage forms may contain suitable inert diluents commonly used in the art. Besides inert diluents, the oral compositions may also include adjuvants, such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming and preservative agents. Suspensions may contain suspending agents.
[0087] Compositions of the present invention for rectal or vaginal administration may be presented as a suppository, which maybe prepared by mixing one or more active ingredient(s) with one or more suitable nonirritating carriers which are solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active compound. Compositions of the present invention which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such pharmaceutically-acceptable carriers as are known in the art to be appropriate.
[0088] Dosage forms for the topical or transdermal administration include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, drops and inhalants. The active agent(s)/compound(s) may be mixed under sterile conditions with a suitable pharmaceutically-acceptable carrier. The ointments, pastes, creams and gels may contain excipients. Powders and sprays may contain excipients and propellants.
[0089] In some cases, in order to prolong the effect of a drug (e.g., pharmaceutical formulation), it is desirable to slow its absorption from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material having poor water solubility.
[0090] The rate of absorption of the active agent/drug then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally-administered agent/drug may be accomplished by dissolving or suspending the active agent/drug in an oil vehicle. Injectable depot forms may be made by forming microencapsule matrices of the active ingredient in biodegradable polymers. Depending on the ratio of the active ingredient to polymer, and the nature of the particular polymer employed, the rate of active ingredient release can be controlled. Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue. The injectable materials can be sterilized for example, by filtration through a bacterial-retaining filter.
[0091] The formulations may be presented in unit-dose or multi-dose sealed containers, for example, ampules and vials, and may be stored in a lyophilized condition requiring only the addition of the sterile liquid carrier, for example water for injection, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the type described above.
[0092] The following examples are provided to further illustrate the methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
EXAMPLES
Example 1
Materials and Methods
Mouse Strains
[0093] Lrp4.sup.mdig, Lrp4.sup.mitt, Lrp4.sup.mte, Wise, TopGal, Lrp5, Lrp6, Ctnnb1.sup.fx, K14cre, Ptch1.sup.Lacz and R26-floxstop-LacZ mice were described previously (DasGupta and Fuchs, 1999; Milenkovic et al., 1999; Soriano, 1999; Dassule et al., 2000; Pinson et al., 2000; Brault et al., 2001; Kato et al., 2002; Simon-Chazottes et al., 2006; Weatherbee et al., 2006; Ahn et al., 2010; Ferrer-Vaguer et al., 2010). All experiments involving mice were approved by the Institutional Animal Care and Use Committee of the Stowers Institute for Medical Research (Protocol 2010-0062).
Generation of Lrp4-LacZ, K14-tTA , TCF-tTA and tetO-Wise Transgenic Mice
[0094] For Lrp4-LacZ BAC reporter, a mouse BAC clone, RP23-276H15, was modified to contain an 134 kb genomic region which covers the whole Lrp4 coding region and neighboring upstream (36 kb) and downstream (44 kb) sequences using the bacterial recombination technology (Lee et al., 2001). LacZ was then inserted in-frame into the first coding exon of Lrp4. The K14-tTA was generated by inserting the K14 promoter (Ahn et al., 2010) and a synthetic intron (IVS) (Clontech) upstream of VP22-tTA-SV40pA (Gossen and Bujard, 1992). For TCF-tTA, the K14 promoter of K14-tTA was removed except the basal promoter region (?120 to +13) and replaced with the multiple TCF binding sites from TOPFLASH vector (Millipore). To make tetO-Wise, G-CaMP2 of tetO-G-CaMP2 (He et al., 2008) was replaced with a Wise ORF, and then IRES-eGFP was subcloned between Wise and SV40pA. Transgenic founders were generated by pro-nuclear injection of linearized constructs into C57BI/10J xCBA-F1 embryos.
Generation of Wise-LacZ and K14-Wise Transgenic Mice
[0095] The Wise-LacZ construct was generated by inserting a LacZ-SV40pA in-frame into the first coding exon of Wise in the 24 kb EcoR I-Sal I genomic fragment from a mouse BAC clone, RP23-98E22. Three of five Wise-LacZ lines mimicked the known expression pattern of Wise in the skin appendages and used for this study (
[0096] The K14-Wise construct has been previously described (Ahn et al., 2010). Two of the 9 K14-Wise transgenic founders showed severely deformed limbs and hair loss (data not shown). By in vitro fertilization using sperm from one of the founders, transgenic progeny which phenocopied their parents were generated (
?-Gal Staining, In Situ Hybridization and BrdU Analysis
[0097] To detect ?-Galactosidase activity, embryos were fixed in either 0.1% paraformaldehyde/0.2% glutaraldehyde (E11.5-E13.5) or 4% paraformaldehyde (PFA) (E14.0 or older) for 30-60 minutes on ice. After several washes in phosphate buffered saline, samples were stained in X-Gal for 4-20 hours at 4? C. or at room temperature. Whole-mount in situ hybridization was performed with embryos fixed in 4% PFA overnight according to standard protocols using DIG-labeled anti-sense riboprobes. Histological samples were paraffin-embedded after post-fixation in 4% PFA, sectioned at 8 ?m and counterstained with nuclear fast red. For analysis of cell proliferation and cell death, embryos were harvested 2 hours after intraperitoneal injection of BrdU (50 ?g/g body weight) into pregnant females, sectioned and stained with a mouse anti-BrdU antibody (Amersham), a mouse E-cadherin antibody (BD Biosciences), or a rabbit caspase 3 antibody (Cell Signaling).
Confocal Microscopy and Cell Counting
[0098] Fluorescent images were obtained by the LSM 710 confocal microscope (Carl Zeiss). Nuclei with fluorescence above basal level were counted using the Imaris software (Bitplane).
Example 2
Abnormal Development of the Mammary Glands in Lrp4 Mutant Mice
[0099] Lrp4 is known to be expressed in placodes of skin appendages such as mammary glands, hair follicles and vibrissae (Weatherbee et al., 2006; Fliniaux et al., 2008). Thus, potential roles for Lrp4 in development of these tissues were examined. Mice homozygous for null alleles of Lrp4 (Lrp4.sup.mitt and Lrp4.sup.mte) die after birth, but mice homozygous for a hypomorphic allele (Lrp4.sup.mdig) survive to reach adulthood (Simon-Chazottes et al., 2006; Weatherbee et al., 2006). The analyses of both Lrp4.sup.mitt/mdig and Lrp4.sup.mdig/mdig females revealed a variety of abnormalities in the number, position and morphology of nipples (
Example 3
Lrp4 is Essential for Patterning of the Mammary Placodes
[0100] The mammary defects in Lrp4 mutants suggest that Lrp4 plays a role in embryonic mammary development. The number and position of the nipples and associated mammary glands is primarily determined around embryonic day 12 (E12) when the mammary placodes develop (Cowin and Wysolmerski, 2010). The TopGal reporter mouse line (DasGupta and Fuchs, 1999) was used to follow the progress of mammary development and to monitor changes in the activity of Wnt/?-catenin signaling (
[0101] In Lrp4.sup.mdig/mdig embryos, TopGal expressing cells were more loosely organized around the developing placodes at E12.0 suggesting that placode assembly was delayed (compare
[0102] Whether the abnormal mammary patterning in Lrp4 mutants is associated with changes in the number of mammary epithelial cells was investigated using the TCF/LEF:H2B-GFP reporter, which marks mammary placodes similar to TopGal (Ferrer-Vaquer et al., 2010). Confocal imaging of the placode 2/3 region revealed a 40% increase in the total number of GFP-expressing cells (
Example 4
Reduced Proliferation of the Misplaced Mammary Epithelial Cells Causes Placode Fusion
[0103] Although mammary placodes #2 and 3 were developmentally delayed and morphologically abnormal in Lrp4 mutants, they were centered at fairly normal positions at E12.0 (
[0104] With respect to cell death, in control mice, a small number of apoptotic cells were observed mostly around the neck of the buds, but not in the interplacodal epithelium (
Example 5
Reduction in the Dosage of the Lrp5 And Lrp6 Wnt Co-Receptors Ameliorates the Lrp4 Mutant Defects in Limb and Mammary Patterning
[0105] To examine which signaling pathways were misregulated in the mammary placodes of Lrp4 mutants, placodes 2 and 3 were dissected from E12.5 embryos and expression analysis was performed using qPCR assays designed for components of Wnt, FGF, TGF?/BMP and Eda pathways (FIG. 16). Differential expression of genes in Wnt (Dkk1, Dkk4 and Lef1) and TGF?/BMP (Bmp3, Msx1 and Msx2) pathways suggests that signaling activity of the two pathways is changed in Lrp4 mutants.
[0106] The increased number and abnormal distribution of cells expressing the Wnt reporters (
[0107] It has been shown that embryonic mammary development is delayed or severely impaired in Lrp5.sup.?/? and Lrp6.sup.?/? mice, respectively, in association with reduced Wnt signaling activity. (Lindvall et al., 2006; Lindvall et al., 2009). Therefore, whether reduced doses of Lrp5 and Lrp6 can rescue the mammary defects of Lrp4 mutants was investigated (
Example 6
Lrp4 Facilitates Placode Formation and Restricts Mammary Fate by Inhibiting Wnt/B-Catenin Signaling
[0108] Whether the normal timing of placode initiation is restored in Lrp4.sup.mdig/mdig;Lrp5.sup.+/?;Lrp6.sup.+/? mice was investigated. Indeed, the compound mutants displayed placodes with almost normal morphology and size with few TopGal-expressing cells in the interplacodal region at E12.5 (
[0109] To further explore a role for Wnt/?-catenin signaling in controlling the number of mammary epithelial cells, the ?-catenin gene (Ctnnb1) was inactivated in the epithelium after placode initiation using a conditional allele of ?-catenin combined with a Cre line driven by a Keratin 14 promoter (K14cre). K14cre can induce recombination in a subset of epithelial cells along the mammary line at E11.5-E12.0 (
[0110] Whether inactivation of ?-catenin has effects on the Lrp4 mutant phenotypes was tested (
Example 7
Lrp4 is Required for Development of Hair and Vibrissal Follicles
[0111] Whether the findings in mammary gland development reflect related roles for Lrp4 in other skin appendages was investigated. Primary hair follicles were marked by Wnt10b transcripts at E14.5 in control mice, but in the Lrp4 mutant skin, Wnt10b was undetectable (
[0112] Groups of vibrissae develop in different regions of the mouse head (Yamakado and Yohro, 1979), and supernumerary vibrissal follicles were observed for each group in Lrp4 mutants (
Example 8
Wise is Required for Development of Mammary Glands and Vibrissae
[0113] Because Wise is a potential ligand for Lrp4 and mice deficient for Wise or Lrp4 displayed similar tooth defects, roles for Wise in the mammary glands and other skin appendages were investigated. Earlier studies have shown that in developing skin appendages Wise is excluded from the epithelial signaling centers where Lrp4 is expressed (Laurikkala et al., 2003; Weatherbee et al., 2006). During mammary placode formation, Lrp4 was expressed in the placodal epithelial cells similar to Lef-1 while Wise expression was strong in the surrounding epithelial and mesenchymal cells (
[0114] In Wise-null females, changes in the position and number of nipples were observed (
[0115] In addition to the mammary defects, Wise-null mice displayed supernumerary vibrissal follicles with a frequency lower than that of Lrp4.sup.mitt/mitt mice (
Example 9
Reduction in the Dosage of Lrp5 and B-Catenin Ameliorates the Wise-Null Mammary Phenotypes
[0116] Whether changes in Wnt/?-catenin signaling account for the Wise-null mammary defects were tested genetically. Wise-null mice were crossed with Lrp5 mutants to generate double homozygous mutants. It was found that removing both copies of Lrp5 significantly rescues the abnormal spacing and ectopic TopGal expression of Wise-null mammary buds (
Example 10
Over-Expression of Wise Reduces the Number of Mammary Epithelial Cells
[0117] To complement and validate predicted roles for Wise based on loss-of-function analyses, whether over-expression of Wise using the Keratin 14 promoter (K14-Wise) (Ahn et al., 2010) can reduce the number of placodal epithelial cells was investigated. K14-Wise embryos showed defects in development of hair/vibrissal follicles, mammary placodes and limbs with reduced TopGal expression (
[0118] Using a strong (#32) or a moderate (#87) K14-tTA driver, the mammary defects of the K14-Wise embryos were reproduced (
Example 11
Wise Requires Lrp4 to Exert its Function In Vivo
[0119] The overall similarities in skin defects and elevated Wnt signaling in Lrp4 and Wise mutants raise the question of whether Lrp4 and Wise act through a common or parallel pathways. To genetically test this idea, combinatorial mutants of the two genes were generated. No mammary defect was observed in transheterozygotes, and defects in double homozygous mutants were indistinguishable from those of Lrp4.sup.mdig/mdig g mice during embryonic mammary development (
[0120] Considering the close genetic interaction of both genes with the components of Wnt/?-catenin pathway, this lack of synergy or additive effect between the two mutants suggests that Lrp4 and Wise may be acting on the same pathway to inhibit Wnt/?-catenin signaling and Lrp4 acts downstream of Wise. Alternatively, it is possible that Lrp4 and Wise function independent of each other, but Lrp4 has a larger role in modulating the level of signaling activity. To distinguish between these possibilities, Wise was over-expressed in Lrp4 mutants. Elevated Wise expression would rescue the Lrp4 mutant phenotypes if Wise and Lrp4 function primarily in an independent manner. However, over-expression of Wise resulted in no changes in the limb and mammary defects of Lrp4 mutants (
[0121] The genetic analyses have revealed that Lrp4 and Wise play stage-specific roles for proper patterning and morphogenesis of the murine mammary glands and other skin appendages through their ability to modulate Wnt/?-catenin signaling. Lrp4 has an early role in facilitating placode initiation and together Lrp4 and Wise have later roles in induction and/or maintenance of precursor cells. Through loss-, gain-of-function and epistasis analyses, it was found that Wise requires Lrp4 to exert its activity. Together the data suggest a model whereby Wise and Lrp4 work in concert to modulate the activity of Wnt signaling though a common mechanism. These findings have important implications for a mechanistic understanding of how Wnt antagonists participate in the precise control of Wnt signaling to regulate cellular processes involved in ectodermal placode formation.
Example 12
Lrp4 and Wise Control Patterning of the Mammary Placodes
[0122] Development of mammary glands provides an opportunity to study spatiotemporal patterning of ectodermal organs since multiple placodes form along the mammary lines in a fairly well-defined order. The analyses of Lrp4 and Wise mutant mice have provided insight on the cellular processes that control the transition from stretches of thickened epithelium into precisely spaced placodes.
[0123] First, initiation of the placodes requires assembly of the precursor cells. In Lrp4 mutants, even when comparable numbers of cells were present around the site of placode formation, they were loosely assembled with a smaller degree of invagination compared with those of control mice. This delay in placode assembly suggests that Lrp4 normally facilitates aggregation of the precursor cells.
[0124] Second, the number of the precursor cells needs to be tightly controlled for proper morphogenesis of individual placodes and maintenance of spacing between them. The significant increase in the number of Wnt reporter-positive cells in Lrp4 and Wise mutants suggests that both Lrp4 and Wise have a role in limiting the mammary fate to a defined number of epithelial cells. This may be achieved by suppressing maintenance of mammary fate in existing precursor cells or by blocking induction of new precursor cells as mammary epithelial cells tend to proliferate at a very low rate.
[0125] In addition, migration of the mammary precursor cells may play an important role in placode initiation and morphogenesis. The sustained presence of the precursor cells in the interplacodal regions of Lrp4 and Wise mutants suggest that these cells fail to migrate to the normal sites of placode formation. These ectopic precursor cells then interfere with morphogenesis of normal placodes and give rise to supernumerary placodes. The extent of migration along the mammary line is not well characterized. It is possible that cell movement is limited to cells near the sites of placode formation and cells farther away from the placodes lose their potential to become mammary epithelial cells.
[0126] Disruption in any of the above processes would lead to defects in the number, morphogenesis and position of the mammary placodes. Mutant phenotypes suggest that initially Lrp4 is predominantly required for assembly of the placodes, and later both Lrp4 and Wise play a role in the number of the precursor cells (
Example 13
Lrp4 and Wise are Required for Development of Other Skin Appendages
[0127] Consistent with the idea that the molecular mechanisms for early morphogenesis are shared among the skin appendages, both Lrp4 and Wise mutants display similar abnormalities in patterning of hair and vibrissal follicles with stronger defects observed in Lrp4 mutants. Interestingly, the formation of supernumerary vibrissal follicles is preceded by delayed placode morphogenesis with a broader distribution of the Wnt-active precursor cells in Lrp4 mutants. A delay in placode formation was also observed in the primary hair follicles of Lrp4 mutants. These delays are reminiscent of the defects observed during the mammary placode formation. Focalization of the epithelial precursor cells and associated Wnt activity are commonly seen during the formation of the skin placodes as well as AER (Mikkola and Millar, 2006; Fernandez-Teran and Ros, 2008). It is possible that Lrp4 and Wise modulate Wnt signaling in those precursor cells to control cellular processes such as cell movement, cell shape change, cell-cell adhesion and cell proliferation, which are important for patterning and morphogenesis of the skin placodes (Jamora et al., 2003).
Example 14
Lrp4 and Wise Inhibit Wnt/B-Catenin Pathway During Mammary Development
[0128] The data showed that the mammary defects of Lrp4 and Wise mutants can be rescued by reducing the dose of Lrp5/6 and ?-catenin. This genetic interaction indicates that elevated Wnt/?-catenin signaling is responsible for the mammary defects and suggests that Lrp4 and Wise directly antagonize Wnt/?-catenin signaling instead of acting indirectly via another signaling pathway. This is consistent with the previous studies which provided genetic evidence that Wise functions as a Wnt inhibitor in tooth development (Munne et al., 2009; Ahn et al., 2010).
[0129] The genetic analyses also demonstrate that Wnt/?-catenin signaling is essential for induction and/or maintenance of mammary precursor cells, but its activity needs to be tightly controlled to achieve a proper number of these cells (
Example 15
Wise Requires Lrp4 to Modulate Wnt/B-Catenin Signaling
[0130] Similar to other LDL receptor-related proteins, Lrp4 is implicated in regulating different signaling pathways (May et al., 2007; Willnow et al., 2007). With its multiple ligand binding motifs in the extracellular domain, Lrp4 has the ability to bind in vitro to secreted Wnt and Bmp antagonists (Ohazama et al., 2008; Choi et al., 2009). Interestingly, in both humans and mice Lrp4 mutations phenocopy defects caused by deficiency of individual Wnt antagonists in a tissue-specific manner. For example, limb defects of Lrp4 mutants are similar to those of Dkk1 mutant mice (MacDonald et al., 2004), and bone overgrowth of human patients with LRP4 mutations is reminiscent of bone defects caused by SOST and Dkk1 mutations (Balemans et al., 2001; Morvan et al., 2006). Lastly, Lrp4 and Wise mutant mice share defects in tooth, mammary glands and other skin appendages (Ohazama et al., 2008; this study). These observations imply that interplay between Lrp4 and the Wnt antagonists may play an important role in modulating Wnt/?-catenin signaling in many developmental and physiological contexts.
[0131] While genetic evidence for such interplay has been lacking, the observation that Wise gain-of-function phenotypes depend on Lrp4 in various tissue contexts provides important insight on this issue. Based on loss- and gain-of-function analyses in this study, without being bound by a particular theory, it is believed that Lrp4 and Wise act through a common mechanism where Lrp4 lies downstream of Wise in the pathway leading to inhibition of Wnt/?-catenin signaling (
DOCUMENTS
[0132] Ahn, Y., Sanderson, B. W., Klein, O. D. and Krumlauf, R. (2010) Inhibition of Wnt signaling by Wise (Sostdc1) and negative feedback from Shh controls tooth number and patterning, Development 137(19): 3221-31. [0133] Balemans, W., Ebeling, M., Patel, N., Van Hul, E., Olson, P., Dioszegi, M., Lacza, C., Wuyts, W., Van Den Ende, J., Willems, P. et al. (2001) Increased bone density in sclerosteosis is due to the deficiency of a novel secreted protein (SOST), Human Molecular Genetics 10(5): 537-43. [0134] Balinsky, B. I. (1950) On the prenatal growth of the mammary gland rudiment in the mouse, Journal of Anatomy 84(3): 227-35. [0135] Boras-Granic, K., Chang, H., Grosschedl, R. and Hamel, P. A. (2006) Lef1 is required for the transition of Wnt signaling from mesenchymal to epithelial cells in the mouse embryonic mammary gland, Developmental Biology 295(1): 219-31. [0136] Brault, V., Moore, R., Kutsch, S., Ishibashi, M., Rowitch, D. H., McMahon, A. P., Sommer, L., Boussadia, O. and Kemler, R. (2001) Inactivation of the beta-catenin gene by Wnt1-Cre-mediated deletion results in dramatic brain malformation and failure of craniofacial development, Development 128(8): 1253-64. [0137] Choi, H. Y., Dieckmann, M., Herz, J. and Niemeier, A. (2009) Lrp4, a novel receptor for Dickkopf 1 and sclerostin, is expressed by osteoblasts and regulates bone growth and turnover in vivo, PLoS One 4(11): e7930. [0138] Chu, E. Y., Hens, J., Andl, T., Kairo, A., Yamaguchi, T. P., Brisken, C., Glick, A., Wysolmerski, J. J. and Millar, S. E. (2004) Canonical WNT signaling promotes mammary placode development and is essential for initiation of mammary gland morphogenesis, Development 131(19): 4819-29. [0139] Cowin, P. and Wysolmerski, J. (2010) Molecular mechanisms guiding embryonic mammary gland development, Cold Spring Harb Perspect Biol 2(6): a003251. [0140] DasGupta, R. and Fuchs, E. (1999) Multiple roles for activated LEF/TCF transcription complexes during hair follicle development and differentiation, Development 126(20): 4557-68. [0141] Dassule, H. R., Lewis, P., Bei, M., Maas, R. and McMahon, A. P. (2000) Sonic hedgehog regulates growth and morphogenesis of the tooth, Development 127(22): 4775-85. [0142] Dietrich, M. F., van der Weyden, L., Prosser, H. M., Bradley, A., Herz, J. and Adams, D. J. (2010) Ectodomains of the LDL receptor-related proteins LRP1b and LRP4 have anchorage independent functions in vivo, PLoS One 5(4): e9960. [0143] Duchesne, A., Gautier, M., Chadi, S., Grohs, C., Floriot, S., Gallard, Y., Caste, G., Ducos, A. and Eggen, A. (2006) Identification of a doublet missense substitution in the bovine LRP4 gene as a candidate causal mutation for syndactyly in Holstein cattle, Genomics 88(5): 610-21. [0144] Ferrer-Vaquer, A., Piliszek, A., Tian, G., Aho, R. J., Dufort, D. and Hadjantonakis, A. K. (2010). A sensitive and bright single-cell resolution live imaging reporter of Wnt/?-catenin signaling in the mouse. BMC Dev. Biol. 10, 121.
[0145] Fernandez-Teran, M. and Ros, M. A. (2008) The Apical Ectodermal Ridge: morphological aspects and signaling pathways, International Journal of Developmental Biology 52(7): 857-71. [0146] Fliniaux, I., Mikkola, M. L., Lefebvre, S. and Thesleff, I. (2008) Identification of dkk4 as a target of Eda-A1/Edar pathway reveals an unexpected role of ectodysplasin as inhibitor of Wnt signalling in ectodermal placodes, Developmental Biology 320(1): 60-71. [0147] Gossen, M. and Bujard, H. (1992) Tight control of gene expression in mammalian cells by tetracycline-responsive promoters, Proceedings of the National Academy of Sciences of the United States of America 89(12): 5547-51. [0148] He, J., Ma, L., Kim, S., Nakai, J. and Yu, C. R. (2008) Encoding gender and individual information in the mouse vomeronasal organ, Science 320(5875): 535-8. [0149] Herz, J. and Bock, H. H. (2002) Lipoprotein receptors in the nervous system, Annual Review of Biochemistry 71: 405-34. [0150] Holmen, S. L., Giambernardi, T. A., Zylstra, C. R., Buckner-Berghuis, B. D., Resau, J. H., Hess, J. F., Glatt, V., Bouxsein, M. L., Ai, M., Warman, M. L. et al. (2004) Decreased BMD and limb deformities in mice carrying mutations in both Lrp5 and Lrp6, Journal of Bone and Mineral Research 19: 2033-40. [0151] Howard, B. and Ashworth, A. (2006) Signalling pathways implicated in early mammary gland morphogenesis and breast cancer, PLoS Genetics 2(8): e112.
[0152] Itasaki, N., Jones, C. M., Mercurio, S., Rowe, A., Domingos, P. M., Smith, J. C. and Krumlauf, R. (2003) Wise, a context-dependent activator and inhibitor of Wnt signalling, Development 130(18): 4295-305. [0153] Iwatsuki, K., Liu, H. X., Gronder, A., Singer, M. A., Lane, T. F., Grosschedl, R., Mistretta, C. M. and Margolskee, R. F. (2007) Wnt signaling interacts with Shh to regulate taste papilla development, Proceedings of the National Academy of Sciences of the United States of America 104(7): 2253-8. [0154] Jamora, C., DasGupta, R., Kocieniewski, P. and Fuchs, E. (2003) Links between signal transduction, transcription and adhesion in epithelial bud development, Nature 422(6929): 317-22. [0155] Johnson, E. B., Hammer, R. E. and Herz, J. (2005) Abnormal development of the apical ectodermal ridge and polysyndactyly in Megf7-deficient mice, Human Molecular Genetics 14(22): 3523-38. [0156] Johnson, E. B., Steffen, D. J., Lynch, K. W. and Herz, J. (2006) Defective splicing of Megf7/Lrp4, a regulator of distal limb development, in autosomal recessive mulefoot disease, Genomics 88(5): 600-9. [0157] Karner, C. M., Dietrich, M. F., Johnson, E. B., Kappesser, N., Tennert, C., Percin, F., Wollnik, B., Carroll, T. J. and Herz, J. (2010) Lrp4 regulates initiation of ureteric budding and is crucial for kidney formationa mouse model for Cenani-Lenz syndrome, PLoS One 5(4): e10418. [0158] Kato, M., Patel, M. S., Levasseur, R., Lobov, I., Chang, B. H., Glass, D. A., 2nd, Hartmann, C., Li, L., Hwang, T. H., Brayton, C. F. et al. (2002) Cbfa1-independent decrease in osteoblast proliferation, osteopenia, and persistent embryonic eye vascularization in mice deficient in Lrp5, a Wnt coreceptor, Journal of Cell Biology 157(2): 303-14. [0159] Kim, N., Stiegler, A. L., Cameron, T. O., Hallock, P. T., Gomez, A. M., Huang, J. H., Hubbard, S. R., Dustin, M. L. and Burden, S. J. (2008) Lrp4 is a receptor for Agrin and forms a complex with MuSK, Cell 135(2): 334-42. [0160] Krishnan, V., Bryant, H. U., MacDougald, O. A. (2006) Regulation of bone mass by Wnt signaling J Clin Invest. 116(5):1202-1209. [0161] Laurikkala, J., Kassai, Y., Pakkasjarvi, L., Thesleff, I. and Itoh, N. (2003) Identification of a secreted BMP antagonist, ectodin, integrating BMP, FGF, and SHH signals from the tooth enamel knot, Developmental Biology 264(1): 91-105. [0162] Lee, E. C., Yu, D., Martinez de Velasco, J., Tessarollo, L., Swing, D. A., Court, D. L., Jenkins, N. A. and Copeland, N. G. (2001) A highly efficient Escherichia coli-based chromosome engineering system adapted for recombinogenic targeting and subcloning of BAC DNA, Genomics 73(1): 56-65. [0163] Lee, M. Y., Racine, V., Jagadpramana, P., Sun, L., Yu, W., Du, T., Spencer-Dene, B., Rubin, N., Le, L., Ndiaye, D. et al. (2011) Ectodermal Influx and Cell Hypertrophy Provide Early Growth for All Murine Mammary Rudiments, and Are Differentially Regulated among Them by Gli3, PLoS One 6(10): e26242. [0164] Leupin, O., Piters, E., Halleux, C., Hu, S., Kramer, I., Morvan, F., Bouwmeester, T., Schirle, M., Bueno-Lozano, M., Fuentes, F. J. et al. (2011) Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function, Journal of Biological Chemistry 286(22): 19489-500. [0165] Li, X., Zhang, Y., Kang, H., Liu, W., Liu, P., Zhang, J., Harris, S. E. and Wu, D. (2005) Sclerostin binds to LRP5/6 and antagonizes canonical Wnt signaling, Journal of Biological Chemistry 280(20): 19883-7. [0166] Li, Y., Pawlik, B., Elcioglu, N., Aglan, M., Kayserili, H., Yigit, G., Percin, F., Goodman, F., Nurnberg, G., Cenani, A. et al. (2010) LRP4 Mutations Alter Wnt/?-Catenin Signaling and Cause Limb and Kidney Malformations in Cenani-Lenz Syndrome, American Journal of Human Genetics 86(5): 696-706. [0167] Lindvall, C., Evans, N. C., Zylstra, C. R., Li, Y., Alexander, C. M. and Williams, B. O. (2006) The Wnt signaling receptor Lrp5 is required for mammary ductal stem cell activity and Wnt1-induced tumorigenesis, Journal of Biological Chemistry 281(46): 35081-7. [0168] Lindvall, C., Zylstra, C. R., Evans, N., West, R. A., Dykema, K., Furge, K. A. and Williams, B. O. (2009) The Wnt co-receptor Lrp6 is required for normal mouse mammary gland development, PLoS One 4(6): e5813. [0169] Lintern, K. B., Guidato, S., Rowe, A., Saldanha, J. W. and Itasaki, N. (2009) Characterization of wise protein and its molecular mechanism to interact with both Wnt and BMP signals, Journal of Biological Chemistry 284(34): 23159-68. [0170] MacDonald, B. T., Adamska, M. and Meisler, M. H. (2004) Hypomorphic expression of Dkk1 in the doubleridge mouse: dose dependence and compensatory interactions with Lrp6, Development 131(11): 2543-52.
[0171] MacDonald, B. T., Tamai, K. and He, X. (2009) Wnt/beta-catenin signaling: components, mechanisms, and diseases, Developmental Cell 17(1): 9-26. [0172] May, P., Woldt, E., Matz, R. L. and Boucher, P. (2007) The LDL receptor-related protein (LRP) family: an old family of proteins with new physiological functions, Annals of Medicine 39(3): 219-28. [0173] Mikkola, M. L. and Millar, S. E. (2006) The mammary bud as a skin appendage: unique and shared aspects of development, Journal of Mammary Gland Biology and Neoplasia 11(3-4): 187-203. [0174] Milenkovic, L., Goodrich, L. V., Higgins, K. M. and Scott, M. P. (1999) Mouse patched1 controls body size determination and limb patterning, Development 126(20): 4431-40. [0175] Morvan, F., Boulukos, K., Clement-Lacroix, P., Roman Roman, S., Suc-Royer, I., Vayssiere, B., Ammann, P., Martin, P., Pinho, S., Pognonec, P. et al. (2006) Deletion of a single allele of the Dkk1 gene leads to an increase in bone formation and bone mass, Journal of Bone and Mineral Research 21(6): 934-45. [0176] Munne, P. M., Tummers, M., Jarvinen, E., Thesleff, I. and Jernvall, J. (2009) Tinkering with the inductive mesenchyme: Sostdc1 uncovers the role of dental mesenchyme in limiting tooth induction, Development 136(3): 393-402. [0177] Narhi, K., Tummers, M., Ahtiainen, L., Itoh, N., Thesleff, I. and Mikkola, M. L. (2012) Sostdc1 defines the size and number of skin appendage placodes, Developmental Biology 364(2): 149-61.
[0178] Ohazama, A., Johnson, E. B., Ota, M. S., Choi, H. J., Porntaveetus, T., Oommen, S., Itoh, N., Eto, K., Gritli-Linde, A., Herz, J. et al. (2008) Lrp4 modulates extracellular integration of cell signaling pathways in development, PLoS One 3(12): e4092. [0179] Pinson, K. I., Brennan, J., Monkley, S., Avery, B. J. and Skarnes, W. C. (2000) An LDL-receptor-related protein mediates Wnt signalling in mice., Nature 407: 535-538. [0180] Pispa, J. and Thesleff, I. (2003) Mechanisms of ectodermal organogenesis, Developmental Biology 262(2): 195-205. [0181] Propper, A. Y. (1978) Wandering epithelial cells in the rabbit embryo milk line. A preliminary scanning electron microscope study, Developmental Biology 67(1): 225-31. [0182] Robinson, G. W. (2007) Cooperation of signalling pathways in embryonic mammary gland development, Nature Reviews Genetics 8(12): 963-72. [0183] Schmidt-Ullrich, R. and Paus, R. (2005) Molecular principles of hair follicle induction and morphogenesis, BioEssays 27(3): 247-61. [0184] Semenov, M., Tamai, K. and He, X. (2005) SOST is a ligand for LRP5/LRP6 and a Wnt signaling inhibitor, Journal of Biological Chemistry 280(29): 26770-5. [0185] Semenov, M. V., Tamai, K., Brott, B. K., Kuhl, M., Sokol, S. and He, X. (2001) Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6, Current Biology 11(12): 951-61. [0186] Simon-Chazottes, D., Tutois, S., Kuehn, M., Evans, M., Bourgade, F., Cook, S., Davisson, M. T. and Guenet, J. L. (2006) Mutations in the gene encoding the low-density lipoprotein receptor LRP4 cause abnormal limb development in the mouse, Genomics 87(5): 673-7. [0187] Soriano, P. (1999) Generalized lacZ expression with the ROSA26 Cre reporter strain, Nature Genetics 21(1): 70-1. [0188] van Genderen, C., Okamura, R. M., Farinas, I., Quo, R. G., Parslow, T. G., Bruhn, L. and Grosschedl, R. (1994) Development of several organs that require inductive epithelial-mesenchymal interactions is impaired in LEF-1-deficient mice, Genes & Development 8(22): 2691-703. [0189] Veltmaat, J. M., Van Veelen, W., Thiery, J. P. and Bellusci, S. (2004) Identification of the mammary line in mouse by Wnt10b expression, Developmental Dynamics 229(2): 349-56. [0190] Weatherbee, S. D., Anderson, K. V. and Niswander, L. A. (2006) LDL-receptor-related protein 4 is crucial for formation of the neuromuscular junction, Development 133(24): 4993-5000. [0191] Willnow, T. E., Hammes, A. and Eaton, S. (2007) Lipoproteins and their receptors in embryonic development: more than cholesterol clearance, Development 134(18): 3239-49. [0192] Yamakado, M. and Yohro, T. (1979) Subdivision of mouse vibrissae on an embryological basis, with descriptions of variations in the number and arrangement of sinus hairs and cortical barrels in BALB/c (nu/+; nude, nu/nu) and hairless (hr/hr) strains, American Journal of Anatomy 155(2): 153-73. [0193] Zhang, B., Luo, S., Wang, Q., Suzuki, T., Xiong, W. C. and Mei, L. (2008) LRP4 serves as a coreceptor of agrin, Neuron 60(2): 285-97.
[0194] Zhou, C. J., Wang, Y. Z., Yamagami, T., Zhao, T., Song, L. and Wang, K. (2010) Generation of Lrp6 conditional gene-targeting mouse line for modeling and dissecting multiple birth defects/congenital anomalies, Developmental Dynamics 239(1): 318-26.
[0195] All documents cited in this application are hereby incorporated by reference as if recited in full herein.
[0196] Although illustrative embodiments of the present invention have been described herein, it should be understood that the invention is not limited to those described, and that various other changes or modifications may be made by one skilled in the art without departing from the scope or spirit of the invention.