FUSION PROTEINS COMPRISING AN ALDOLASE ENZYME JOINED TO A MALTOSE BINDING PROTEIN
20190194638 · 2019-06-27
Inventors
- Pedro CLAPÉS SABORIT (Barcelona, ES)
- Karel HERNÁNDEZ SÁNCHEZ (Barcelona, ES)
- Jesús JOGLAR TAMARGO (Barcelona, ES)
- Jordi BUJONS VILÁS (Barcelona, ES)
- Wolf-Dieter FESSNER (Darmstadt, DE)
- Pablo DOMÍNGUEZ DE MARÍA (Las Palmas de Gran Canaria, ES)
Cpc classification
C07K2319/24
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention refers to an enzyme consisting of a fusion protein particularly useful as shown through-out the present invention for carrying out the carbon-carbon bond-forming reaction known as the aldol Reaction, preferably for carrying out an aldol reaction by using aldehydes as substrates and preferably pyruvate or a salt thereof, for producing hydroxyketoacids. Said enzyme is made by binding an aldolase to a maltose binding protein. The enzymes display full activity under highly denaturing substrate loadings (aldehydes, >1 M).
Claims
1. A composition comprising a fusion protein which in turn comprises a 2-keto-3-deoxy-
2. The composition of claim 1, wherein said aldolase is bound to the MBP through a peptide linker having from 3 to 50 amino acids in length.
3. The composition of claim 1 or 2, wherein the MBP forming part of the fusion protein is the MBP of SEQ ID NO 8 or a variant thereof, wherein the term variant is understood as a protein exhibiting at least 80% sequence identity with the MBP having amino acid sequence SEQ ID NO 8.
4. The composition of claim 3, wherein the aldolase enzyme forming part of the fusion protein is the 2-keto-3-deoxy-
5. The composition of any of claims 1 to 4, wherein said composition further comprises any of the following components: protein divalent metals, preferably Mg.sup.2+, Co.sup.2+ and/or Ni.sup.2+, additional enzymes such as reductases, decarboxylases or transaminases such as the transaminase Prozomix TA051 (preferably in the form of a lyophilized cell free extract powder) or any combination thereof.
6. A fusion or chimeric gene coding for the fusion protein of any of claims 1 to 5.
7. A plasmid or vector comprising the fusion or chimeric gene of claim 6.
8. A prokaryotic or eukaryotic microorganism modified, transformed, transduced or transfected with the fusion gene plasmid or vector of any of claim 6 or 7.
9. Use of the composition of any of claims 1 to 5, for producing hydroxyketoacids by carrying out an aldol reaction by using as substrates aldehydes and an -ketoacid, preferably pyruvate or a salt thereof.
10. A method for the synthesis of hydroxyketoacids of formula I comprising an aldol reaction of at least a compound of formula VI to VII catalyzed by the fusion protein as defined in any of claims 1 to 4 or by the composition as defined in any of claims 1 to 5, according to the following reaction scheme: ##STR00022## or any stereoisomers, salts or solvates thereof; wherein R.sub.1 is selected from H, (C.sub.1-C.sub.6)alkyl, (C.sub.0-C.sub.3)alkylaryl, (CH.sub.2).sub.mOCH.sub.2aryl, wherein m is an integer number from 1 to 6, and substituents of formula II, III or IV: ##STR00023## R.sub.2 is selected from H, OH, and (C.sub.1-C.sub.6)alkyl; R.sub.3 is selected from H, (C.sub.1-C.sub.8)alkyl, and (C.sub.0-C.sub.3)alkylaryl; R.sub.4 is selected from H and PG, wherein PG is a protecting group selected from benzyloxycarbonyl (Cbz), tert-butyloxycarbonyl (Boc), phenylacetyl (PheAc), fluoren-9-ylmethoxycarbonyl (Fmoc), acetyl (Ac), benzyl (Bn), and benzoyl (Bz); R.sub.5 and R.sub.6 are selected independently from H, OH and (C.sub.1-C.sub.3)alkyl; and wherein the alkyl and aryl moieties in R.sub.1, R.sub.2 and R.sub.3 are optionally substituted with one or two groups selected independently from halogen, OR, NHR, NRR being R and R selected from H and a (C.sub.1-C.sub.3)alkyl.
11. The method of claim 10, wherein compound VI is formaldehyde, compound VII is pyruvate or a salt thereof and compound I is 4-hydroxy-2-oxobutanoic acid or a salt thereof.
12. The method of claim 11, wherein each of the reactants are present in a concentration greater than 1 M.
13. The method of any of claims 10 to 12, which further comprises the additional step of: ii) an enzymatic reaction to obtain compounds of formula V ##STR00024## wherein R.sub.1 is selected from H, (C.sub.1-C.sub.6)alkyl, (C.sub.0-C.sub.3)alkylaryl, (CH.sub.2).sub.mOCH.sub.2aryl, wherein m is an integer number from 1 to 6, and substituents of formula II, III or IV ##STR00025## R.sub.2 is selected from H, OH, and (C.sub.1-C.sub.6)alkyl; R.sub.3 is selected from H, (C.sub.1-C.sub.8)alkyl, and a (C.sub.0-C.sub.3)alkylaryl; R.sub.4 is selected from H and PG, wherein PG is a protecting group selected from benzyloxycarbonyl (Cbz), tert-butyloxycarbonyl (Boc), phenylacetyl (PheAc), fluoren-9-ylmethoxycarbonyl (Fmoc), acetyl (Ac), benzyl (Bn), and benzoyl (Bz); R.sub.5 and R.sub.6 are selected independently from H, OH and (C.sub.1-C.sub.3)alkyl; R.sub.7 is selected from H, OH, CO, NRR; R.sub.8 is selected from H, COOR.sub.S, CONH.sub.2, CH.sub.2OH, CHO; R.sub.9 is H, (C.sub.1-0.sub.5)alkyl, aryl; wherein the alkyl and aryl moieties in R.sub.1 to R.sub.9 are optionally substituted with one or two groups selected independently from halogen, OR, NHR, NRR; R and R are independently H or (C.sub.1-C.sub.3)alkyl.
14. The method of claim 13, wherein the reaction to obtain compounds V is a non-enzymatic reaction such as a reduction, reductive amination, lactonization, lactamization, or cyclization reaction.
15. The method of any of claim 13 or 14, wherein compound V is homoserine, preferably L-homoserine.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0007]
[0008]
[0009]
[0010]
DETAILED DESCRIPTION OF THE INVENTION
[0011] Definitions
[0012] Percentage of sequence identity, as used herein, is determined by comparing two optimally aligned sequences over a comparison window, where the fragment of the polynucleotide or amino acid sequence in the comparison window may comprise additions or deletions (e.g., gaps or overhangs) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Add. APL. Math. 2:482 (1981), by the homology alignment algorithm of Needleman and Wunsch J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman Proc. Natl. Acad. Sci. (USA) 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, PASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection. Given that two sequences have been identified for comparison, GAP and BESTFIT are preferably employed to determine their optimal alignment. Typically, the default values of 5.00 for gap weight and 0.30 for gap weight length are used.
[0013] In the context of the present invention, the term aldolase is understood as any class of enzyme that reversibly catalyzes the cleavage of carbon-carbon bonds.
[0014] As used herein, the term Class II aldolase is understood as established according to the classification scheme that divides aldolases into Class I and Class II as developed by Marsh and Lebherz 1992.
[0015] As used herein, the term Class II pyruvate-dependent aldolase enzyme is understood as an aldolase that needs a divalent metal cofactor to be catalytically active and utilize pyruvate or other -ketoacid derivatives as nucleophilic components in aldol reactions.
[0016] As used herein, the term 2-keto-3-deoxy-
[0017] In the context of the present invention, the term fusion protein is understood as a protein made from a fusion gene, which is created by joining complete or parts of two or more individual genes that originally coded for separate proteins linked or not through a peptide spacer sequence. Fusion genes may occur naturally in the body by transfer of DNA between chromosomes. Fusion genes and proteins can also be made in the laboratory by combining genes or parts of genes from the same or different organisms. Translation of this fusion gene results in a single or multiple polypeptides with functional properties derived from each of the original proteins.
[0018] As used herein, the term fusion gene is understood as a gene made by joining complete or parts of two or more individual genes that originally coded for separate proteins linked or not through a peptide spacer sequence. Fusion genes can be made in the laboratory by combining genes or parts of genes from the same or different organisms.
[0019] In the context of the present invention, SED ID NO 2 is understood as a gene sequence (gi|388476123:c2363515-2362712 Escherichia coli str. K-12 substr. W3110, complete genome).
TABLE-US-00001 Genesequence (SEQIDNO2) ATGAACGCATTATTAAGCAATCCCTTTAAAGAACGTTTACGCAAGGGCG AAGTGCAAATTGGTCTGTGGTTAAGCTCAACGACTGCCTATATGGCAGA AATTGCCGCCACTTCTGGTTATGACTGGTTGCTGATTGACGGGGAGCAC GCGCCAAACACCATTCAGGATCTTTATCATCAGCTACAGGCGGTAGCGC CCTATGCCAGCCAACCCGTGATCCGTCCGGTGGAAGGCAGTAAACCGCT GATTAAACAAGTCCTGGATATTGGCGCGCAAACTCTACTGATCCCGATG GTCGATACTGCCGAACAGGCACGTCAGGTGGTGTCTGCCACGCGCTATC CTCCCTACGGTGAGCGTGGTGTCGGGGCCAGTGTGGCACGGGCTGCGCG CTGGGGACGCATTGAGAATTACATGGCGCAAGTTAACGATTCGCTTTGT CTGTTGGTGCAGGTGGAAAGTAAAACGGCACTGGATAACCTGGACGAAA TCCTCGACGTCGAAGGGATTGATGGCGTGTTTATTGGACCTGCGGATCT TTCTGCGTCGTTGGGCTACCCGGATAACGCCGGGCACCCGGAAGTGCAG CGAATTATTGAAACCAGTATTCGGCGGATCCGTGCTGCGGGTAAAGCGG CTGGTTTTCTGGCTGTGGCTCCTGATATGGCGCAGCAATGCCTGGCGTG GGGAGCGAACTTTGTCGCTGTTGGCGTTGACACGATGCTCTACAGCGAT GCCCTGGATCAACGACTGGCGATGTTTAAATCAGGCAAAAATGGGCCAC GCATAAAAGGTAGTTATTGA
[0020] In the context of the present invention, SEQ ID NO 1 is understood as the protein sequence of YfaU (EC 4.1.2.53, 2-keto-3-deoxy-
TABLE-US-00002 Proteinsequence (SEQIDNO1) MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEH APNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPM VDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLC LLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQ RIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSD ALDQRLAMFKSGKNGPRIKGSY
[0021] As used herein, variants of YfaU refer to amino acid sequences exhibiting 2-keto-3-deoxy-
[0022] As used herein Maltose binding proteins or MBP refer to periplasmic proteins that bind maltose and maltodextrin, take part in the maltose transport system of bacteria and are used to increase the solubility of recombinant proteins expressed in bacteria such as E. coli preventing aggregation of the protein of interest. In particular, Maltose binding protein or MBP refers to protein sequence SEQ ID NO 8:
TABLE-US-00003 MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFP QVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAV RYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSA LMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFL VDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYA VRTAVINAASGRQTVDEALKDAQT
[0023] As used herein, variants of MBP refer to amino acid sequences exhibiting at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with amino acid sequence SEQ ID NO 8 capable of increasing the solubility of recombinant proteins expressed in bacteriae such as E. coli and preventing aggregation of the protein of interest.
[0024] As used herein the term MBP-YfaU refers to the fusion protein comprising YfaU or a variant thereof bound to the maltose binding protein (MBP) or a variant thereof. It is noted that the term variant as used herein only specifically refers to the protein sequences MBP or YfaU and not to any additional sequence of the fusion protein. Preferably, MBP-YfaU comprises the amino acid sequence reproduced herein (SEQ ID NO 9):
TABLE-US-00004 MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFP QVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAV RYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSA LMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFL VDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAV NKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYA VRTAVINAASGRQTVDEALKDAQTSSGLEVLFQGPACGTMNALLSNPFK ERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYH QLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQV VSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTA LDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRI RAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFK SGKNGPRIKGSY
[0025] wherein the peptide sequence SSGLEVLFQGPACGT (outlined above) is understood as a peptide linker or spacer sequence and can be replaced by any suitable linker as establish in the definition below. In addition it is further noted that the above sequence can further comprise any vector suitable for affinity protein purification as for example, but not limited to, a N-terminal (His)6-tag peptide sequence.
[0026] Preferably, MBP-YfaU comprises the amino acid sequence shown in
TABLE-US-00005 MRGSHHHHHHGSGIMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDK AFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEI PALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPW AWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEF LENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGE IMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTSSGLEVLFQGP ACGTMNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLI DGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTL LIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVN DSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGH PEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTM LYSDALDQRLAMFKSGKNGPRIKGSY
[0027] As used herein, the term bound to as referred to the fusion protein of the present invention is understood as protein linked to another protein directly or through a peptide spacer sequence.
[0028] It is noted that linkers or spacer sequences are usually short peptide sequences that occur between protein domains. Linkers are often composed of flexible residues like glycine and serine so that the adjacent protein domains are free to move relative to one another. Longer linkers are used when it is necessary to ensure that two adjacent domains do not sterically interfere with one another. In particular, as used herein, the term peptide linker or spacer sequence refers to amino acid sequences of essentially any length (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids) between the MBP or any variant thereof and the YfaU or any variant thereof having or consisting of preferably from 2 to 100 amino acids, preferably from 3 to 50 amino acids, more preferably from 3 to 40 amino acids, more preferably from 10 to 30 amino acids, more preferably having or consisting of about 15 amino acids. The selection of a linker sequence and length is dependent on the construction of functional chimeric proteins, and therefore, the optimal linker length will vary on a case by case basis. Anyhow, the incorporation of linkers for the construction of stable and bioactive recombinant fusion proteins is well known in the state of the art as shown i.e in Xiaoying Chen et al. Fusion Protein Linkers: Property, Design and Functionality. Adv Drug Deliv Rev. 2013, 65(10): 1357-1369 or in Vishnu Priyanka et al. Linkers in the structural biology of protein-protein interactions. Protein Sci. 2013, 22(2): 153-167.
[0029] As used herein YfaU W23V refers to the protein sequence SEQ ID NO 3:
TABLE-US-00006 MNALLSNPFKERLRKGEVQIGLVLSSTTAYMAEIAATSGYDWLLIDGEH APNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPM VDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLC LLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQ RIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSD ALDQRLAMFKSGKNGPRIKGSY
[0030] As used herein YfaU L216A refers to the protein sequence SEQ ID NO 4:
TABLE-US-00007 MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEH APNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPM VDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLC LLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQ RIIETSIRRIRAAGKAAGFAAVAPDMAQQCLAWGANFVAVGVDTMLYSD ALDQRLAMFKSGKNGPRIKGSY
[0031] As used herein YfaU W23V L216A refers to the protein sequence SEQ ID NO 5:
TABLE-US-00008 MNALLSNPFKERLRKGEVQIGLVLSSTTAYMAEIAATSGYDWLLIDGEH APNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPM VDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLC LLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQ RIIETSIRRIRAAGKAAGFAAVAPDMAQQCLAWGANFVAVGVDTMLYSD ALDQRLAMFKSGKNGPRIKGSY
[0032] As used herein YfaU W23V F174V L216A refers to the protein sequence SEQ ID NO 6:
TABLE-US-00009 MNALLSNPFKERLRKGEVQIGLVLSSTTAYMAEIAATSGYDWLLIDGEH APNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPM VDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLC LLVQVESKTALDNLDEILDVEGIDGVVIGPADLSASLGYPDNAGHPEVQ RIIETSIRRIRAAGKAAGFAAVAPDMAQQCLAWGANFVAVGVDTMLYSD ALDQRLAMFKSGKNGPRIKGSY
[0033] As used herein YfaU W23A L216A refers to the protein sequence SEQ ID NO 7:
TABLE-US-00010 MNALLSNPFKERLRKGEVQIGLALSSTTAYMAEIAATSGYDWLLIDGEH APNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPM VDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLC LLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQ RIIETSIRRIRAAGKAAGFAAVAPDMAQQCLAWGANFVAVGVDTMLYSD ALDQRLAMFKSGKNGPRIKGSY
[0034] As used herein MBP-YfaU being YfaU any of its variants, is preferably understood as YfaU W23V, YfaU L216A, YfaU W23V L216A, YfaU W23V F174V L216A and YfaU W23A L216A bound to, directly or through a peptide spacer sequence, to the MBP as defined above.
[0035] The term comprising it is meant including, but not limited to, whatever follows the word comprising. Thus, use of the term comprising indicates that the listed elements are required or mandatory, but that other elements are optional and may or may not be present.
[0036] By consisting of is meant including, and limited to, whatever follows the phrase consisting of. Thus, the phrase consisting of indicates that the listed elements are required or mandatory, and that no other elements may be present.
[0037] The inventions illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms comprising, including, containing, etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
[0038] Description
[0039] In the present invention, MBP-YfaU enzyme is successfully used to synthesize L-homoserine through two enzymatic consecutive reactions (Scheme 1).
##STR00001##
[0040] The first reaction is the aldol addition of pyruvate (2) to formaldehyde (1) using a pyruvate aldolase (Scheme 1). The second step comprises a transamination reaction using 4-hydroxy-2-oxobutanoic acid (I-1), the aldol adduct obtained in the first step, to obtain L-homoserine (V-1) a compound with high industrial relevance and interest.
[0041] For the first step (carboligation), the metal-dependent Class II pyruvate aldolase 2-keto-3-deoxy-
[0042] In addition, quite remarkably, by using MBP-YfaU the enzyme resulted fully active even at extremely high concentrations of formaldehyde and pyruvate (>1 M). This is surprising, as highly electrophilic aldehydes such as formaldehyde are known to be strong denaturing agents for enzymes. Furthermore, the addition of some divalent metals led surprisingly to even higher stabilities and substrate conversions (up to 2.5 M). A summary of these experiments is depicted in
[0043] The best results were achieved at formaldehyde and pyruvate concentrations of >1.7 M, and using Co.sup.2+ or Ni.sup.2+ as alternative metal cofactors (1 mM the minimum concentration to effectively exchange the naturally occurring cofactor, Mg.sup.2+, in the active site). Under these denaturing conditions, virtually full conversion was achieved, leading to a I-1 productivity of >197 g L.sup.1 d.sup.1.
[0044] Studies on kinetics were further assessed, at 1.7 M concentrations of both substrates and using either Co.sup.2+ or Ni.sup.2+ as metals (1 mM). Results are depicted in
[0045] Consequently, the present invention, has surprisingly found that: [0046] i) The MBP-YfaU enzyme catalyzed the reactions, as confirmed by different blank reaction procedures such as no enzyme addition, use of BSA protein with Ni.sup.2+ or Co.sup.2+ addition or use of EDTA to remove metals, which led to no conversion or insignificant background condensation of less than 0.5% in 24 h. [0047] ii) MBP-YfaU resulted fully active even at extremely high concentrations of formaldehyde and pyruvate (>1 M). Furthermore, the addition of some divalent metals (e.g. Co.sup.2+, Ni.sup.2+, Mn.sup.2+) led surprisingly to even higher stabilities and substrate conversions (up to 2.5 M). [0048] iii) The best results were achieved at formaldehyde and pyruvate concentrations of >1.7 M, and using Co.sup.2+ or Ni.sup.2+ (1 mM). Under these conditions, virtually full conversion was achieved, leading to a productivity of >197 g L.sup.1 d.sup.1, which is remarkably high and attractive for industrial applications. [0049] iv) Under certain conditions (example 5) a subsequent addition of the primary aldol adduct to a second equivalent of formaldehyde, thereinafter double addition, was observed providing advantages in two directions. On one hand, the selectivity towards the desired mono-addition product can be easily modulated by changing reaction conditions. For instance, by using Mg.sup.2+ and slow addition of formaldehyde up to 1 M, product I-1 was isolated in 89% yield. On the other hand, innovative products or intermediates can be easily accessible. For instance preparation of sodium 4-hydroxy-3-(hydroxymethyl)-2-oxobutanoate (1-5, example 5).
[0050] v) YfaU has the ability to control aldol addition stereochemistry. The configuration of the new generated stereogenic centers depends on the enzyme and on the aldol addition reagents.
[0051] Therefore, as illustrated above and in the examples of the present invention, the MBP-YfaU enzyme has a clear potential for its use in industrial bio-transformations, in particular for the synthesis of
[0052] It is particularly noted that variants of the MBP-YfaU enzyme can be used in the above identified processes such as YfaU W23V, YfaU L216A, YfaU W23V L216A, YfaU W23V F174V L216A and YfaU W23A L216A (see definitions above), although E. coli K12 YfaU with SEQ ID NO1 is particularly preferred. The metal-dependent Class II pyruvate-dependent aldolase 2-keto-3-deoxy-
[0053] Therefore, a first aspect of the invention refers to Class I and/or Class II aldolases that utilize pyruvate or other ketoacid derivatives as nucleophilic components in aldol reactions, preferably to a Class II pyruvate-dependent aldolase enzyme, expressed as a fusion protein with the maltose binding protein (MBP) (see the examples for an explanation of a non-limiting manner of manufacturing or producing the aforesaid fusion protein). Preferably, said Class II pyruvate-dependent aldolase is a 2-keto-3-deoxy-L-rhamnonate aldolase or a variant thereof. Most preferably the fusion protein is MBP-YfaU, wherein MBP or YfaU can also include variants of any of these proteins.
[0054] Examples of preferred YfaU variant sequences are SEQ ID NO 3 (YfaU W23V), SEQ ID NO 4 (YfaU L216A), SEQ ID NO 5 (YfaU W23V L216A), SEQ ID NO 6 (YfaU W23V F174V L216A) and SEQ ID NO 7 (YfaU W23A L216A).
[0055] Also preferably, said maltose binding protein corresponds to a protein having SEQ ID NO 8 or a variant thereof.
[0056] The aforesaid fusion proteins thus comprise, consist essentially of or consist preferably of a Class II pyruvate-dependent aldolase enzyme and a maltose binding protein, wherein these two proteins are bound to each other either directly or by a peptide linker as defined in the section entitled definitions above, preferably said linker having from 2 to 100 amino acids, preferably from 3 to 50 amino acids, more preferably from 3 to 40 amino acids, more preferably from 10 to 30 amino acids, more preferably having about 15 amino acids in length.
[0057] A preferred embodiment of the first aspect of the invention refers to a composition comprising the fusion protein as defined in the first aspect of the invention which may optionally further comprise divalent metals, preferably Mg.sup.2+, Co.sup.2+ and/or Ni.sup.2+. .sup.+. It is in addition noted that, the fusion protein, optionally comprising divalent metals, preferably Mg.sup.2+, Co.sup.2+ and/or Ni.sup.2+, can be combined and dialyzed against different buffers, being phosphate and 3-(N-morpholino)propanesulfonate (MOPS) buffers preferred.
[0058] It is noted that the fusion protein of the present invention can be lyophilized or freezed and thus the composition referred to herein can be found, for example, as a lyophilized powder composition.
[0059] It is further noted that the composition referred to in the first aspect of the invention or in any of its preferred embodiments, can further comprise additional enzymes such as reductases, decarboxylases or transaminases such as transaminase Prozomix TA051, TA039 or TA026 for L-derivatives and Prozomix TA07, TA017 or TA043 for D-derivatives (preferably a lyophilized crude cell free extract). Finally, the fusion protein of the present invention may be also used as immobilized enzyme, or within a whole-cell to enable even more robust biocatalytic industrial processes, or in any other form that skilled-in-the-art may envisage.
[0060] A second aspect of the invention refers to a fusion gene or polynucleotide coding for the fusion protein as defined in the first aspect of the invention.
[0061] A third aspect of the invention refers to a plasmid or vector, preferably a viral or non-viral vector, comprising the fusion gene as defined in the second aspect of the invention.
[0062] A fourth aspect of the invention refers to a prokaryotic or eukaryotic microorganism such as a cell, preferably a prokaryotic cell, more preferably a bacterial strain such as E. coli, or also preferably an eukaryotic microorganism such as a yeast (preferably comprising a signal peptide useful for secretion of heterologous proteins), modified, transformed, transduced or transfected with the fusion gene of the second aspect of the invention. Preferably, said prokaryotic or eukaryotic cell is capable of expressing the fusion protein as defined in the first aspect of the invention.
[0063] A fifth aspect of the invention refers to a method for producing the fusion protein as defined in the first aspect of the invention comprising the expression of said protein by using the prokaryotic or eukaryotic cell as defined in the fourth aspect of the invention. A preferred embodiment of the fifth aspect of the invention refers to a process or method of producing 2-keto-3-deoxy-L-rhamnonate aldolase or a variant thereof as defined above, expressed as a fusion protein with a maltose binding protein (MBP) or a variant thereof, which comprises expressing said protein by using a modified microorganism as defined in the fourth aspect above, such as a bacterial strain (i.e. E. coli) or a yeast, with the fusion gene coding for the aforesaid fusion protein as defined in the second aspect of the invention.
[0064] A sixth aspect of the invention refers to a fusion protein obtained or obtainable by the method of the fifth aspect of the invention.
[0065] A seventh aspect of the invention refers to the use of the fusion protein as defined in the first aspect of the invention for carrying out the carbon-carbon bond-forming reaction known as the Aldol Reaction, preferably for carrying out an aldol reaction by using aldehydes as substrates and an -ketoacid, preferably pyruvate or a salt thereof, preferably for producing hydroxyketoacids, and preferably at high denaturing substrate loadings.
[0066] A preferred embodiment of the seventh aspect of the invention refers to the use of the fusion protein as defined in the first aspect of the invention or to the composition as defined in the first aspect of the invention for the preparation of hydroxyketoacids of formula I,
##STR00002##
[0067] or any stereoisomers and mixtures thereof, or any salts or solvates thereof,
[0068] wherein
[0069] R.sub.1 is selected from H, (C.sub.1-C.sub.6)alkyl, (C.sub.0-C.sub.3)alkylaryl, (CH.sub.2).sub.mOCH.sub.2aryl, wherein m is an integer number from 1 to 6, and substituents of formula II, Ill or IV:
##STR00003##
[0070] R.sub.2 is selected from H, OH and (C.sub.1-C.sub.6)alkyl;
[0071] R.sub.3 is selected from H, (C.sub.1-C.sub.8)alkyl, and (C.sub.0-C.sub.3)alkylaryl;
[0072] R.sub.4 is selected from H and PG, wherein PG is a protecting group selected from benzyloxycarbonyl (Cbz), tert-butyloxycarbonyl (Boc), phenylacetyl (PheAc), fluoren-9-ylmethoxycarbonyl (Fmoc), acetyl (Ac), benzyl (Bn), and benzoyl (Bz);
[0073] R.sub.5 and R.sub.6 are selected independently from H, OH and (C.sub.1-C.sub.3)alkyl; and wherein the alkyl and aryl moieties in R.sub.1, R.sub.2 and R.sub.3 are optionally substituted with one or two groups selected independently from halogen, OR, NHR, NRR being R and R selected from H and (C.sub.1-C.sub.3)alkyl.
[0074] As used herein the term (C.sub.1-C.sub.6)alkyl relates to a radical derived from a monovalent alkane (hydrocarbon), of linear or branched chain, containing from one to six carbon atoms and includes groups such as methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl or tert-butyl. Similarly, the term (C.sub.1-C.sub.8)alkyl is used in this specification to refer to alkyl groups of 1 to 8 carbon atoms. Alkyl groups may be optionally substituted by one or two groups such as halogen, hydroxyl, alkoxy and amino.
[0075] As used herein the term aryl, alone or in combination, refers to a system of mono-or polycyclic aromatic ring containing carbon ring atoms. Preferred aryl ring systems are 5-10 monocyclic or bicyclical members, such as phenyl or biphenyl, which optionally carry one or two groups such as halogen, hydroxyl, alkoxy and amino.
[0076] The compounds of the present invention may have acid protons and, therefore they may form salts with bases. Examples of these salts include salts with metal cations, such as for example an alkaline metal ion, an alkaline-earth metal ion or an aluminium ion. Likewise, the compounds of the present invention may contain a basic nitrogen and they may form salts with acid. Examples of salts include among others inorganic acids, such as hydrochloric, hydrobromic, hydroioidic, nitric, sulphuric, phosphoric as well as organic acids as acetic, trifluorometansulfonic, etc. Some of the compounds of the invention may exist as unsolvated as well as solvated forms such as, for example, hydrates or alcohol solvates.
[0077] Many of the organic compounds mentioned herein exist in optically active forms having the ability to rotate the plane of plane-polarized light. In describing an optically active compound, the prefixes D and L or R and S are used to denote the absolute configuration of the molecule about its chiral center(s). The prefixes D and L or (+) and () are employed to designate the sign of rotation of plane-polarized light by the compound, with () or L meaning that the compound is levorotatory. A compound prefixed with (+) or D is dextrorotatory. Compounds of formula I of the present invention may comprise one or more chiral centers. The present invention includes each one of the possible stereoisomers and mixtures thereof, particularly racemic mixtures thereof. Some of the compounds of the present invention may exist as enantiomers or as several diastereoisomers. If desired, a chiral carbon can be designated with an asterisk (*). When bonds to the chiral carbon are depicted as straight lines in the disclosed formulas, it is understood that both the (R) and (S) configurations of the chiral carbon, and hence both enantiomers and mixtures thereof, are embraced within the formula. As is used in the art, when it is desired to specify the absolute configuration about a chiral carbon, one of the bonds to the chiral carbon can be depicted as a wedge (bonds to atoms above the plane) and the other can be depicted as a series or wedge of short parallel lines is (bonds to atoms below the plane). The Cahn-Inglod-Prelog system can be used to assign the (R) or (S) configuration to a chiral carbon.
[0078] Certain materials, compounds, compositions, and components disclosed herein can be obtained commercially or readily synthesized using techniques generally known to those skilled in the art. For example, the starting materials and reagents used in preparing the disclosed compounds and compositions are either available from commercial suppliers such as Aldrich Chemical Co., (Milwaukee, Wis.), Acros Organics (Morris Plains, N.J.), Fisher Scientific (Pittsburgh, Pa.), or Sigma (St. Louis, Mo.) or are prepared by methods known to those skilled in the art following procedures set forth in references such as Fieser and Fieser's Reagents for Organic Synthesis, Volumes 1-17 (John Wiley and Sons, 1991); Rodd's Chemistry of Carbon Compounds, Volumes 1-5 and Supplementals (Elsevier Science Publishers, 1989); Organic Reactions, Volumes 1-40 (John Wiley and Sons, 1991); March's Advanced Organic Chemistry, (John Wiley and Sons, 4th Edition); and Larock's Comprehensive Organic Transformations (VCH Publishers Inc., 1989).
[0079] Another preferred embodiment of the seventh aspect of the invention refers to the use of compounds of formula I obtained by using the method of the invention as intermediates for the preparation of compounds of formula V
##STR00004##
[0080] or any stereoisomers and mixtures thereof, or any salts or solvates thereof,
[0081] wherein
[0082] R.sub.1 is selected from H, (C.sub.1-C.sub.6)alkyl, (C.sub.0-C.sub.3)alkylaryl, (CH.sub.2).sub.mOCH.sub.2aryl, wherein m is an integer number from 1 to 6, and substituents of formula II, III or IV
##STR00005##
[0083] R.sub.2 is selected from H, OH, and (C.sub.1-C.sub.6)alkyl;
[0084] R.sub.3 is selected from H, (C.sub.1-C.sub.8)alkyl, and a (C.sub.0-C.sub.3)alkylaryl;
[0085] R.sub.4 is selected from H and PG, wherein PG is a protecting group selected from benzyloxycarbonyl (Cbz), tert-butyloxycarbonyl (Boc), phenylacetyl (PheAc), fluoren-9-ylmethoxycarbonyl (Fmoc), acetyl (Ac), benzyl (Bn), and benzoyl (Bz);
[0086] R.sub.5 and R.sub.6 are selected independently from H, OH and (C.sub.1-C.sub.3)alkyl;
[0087] R.sub.7 is selected from H, OH, CO, NRR;
[0088] R.sub.8 is selected from H, COOR.sub.9, CONH.sub.2, CH.sub.2OH, CHO;
[0089] R.sub.9 is H, (C.sub.1-C.sub.5)alkyl, aryl;
[0090] wherein the alkyl and aryl moieties in R.sub.1 to R.sub.9 are optionally substituted with one or two groups selected independently from halogen, OR, NHR, NRR;
[0091] R and R are independently H or (C.sub.1-C.sub.3)alkyl.
[0092] Preferably, the compound of formula V of this particular embodiment of the invention is L-homoserine.
[0093] In a preferred embodiment of the seventh aspect of the invention, the use is further characterized by the addition of divalent metals such as Co.sup.2+ or Ni.sup.2+.
[0094] An eighth aspect of the invention refers to a method that comprises an aldol addition reaction of a compound of formula VII to VI catalyzed by the fusion protein or the composition as defined in the first aspect of the invention, preferably by 2-keto-3-deoxy-
##STR00006##
[0095] wherein R.sub.1 and R.sub.2 are as defined in the seventh aspect of the invention in connection to compound I.
[0096] Preferably reactants VI and VII as shown above are present in high concentrations of approx. >0.5 M, preferably >0.7 M, preferably >0.8 M, preferably >0.9 M, more preferably >1.0 M, still more preferably >1.5 M, still more preferably >1.7 M.
[0097] In a preferred embodiment of this aspect of the invention, compound VI is formaldehyde, compound VII is pyruvate or a salt thereof such as, but not limited to, sodium pyruvate and compound I is 4-hydroxy-2-oxobutanoic acid (Ia) or a salt thereof such as, but not limited to, sodium 4-hydroxy-2-oxobutanoate. Preferably these reactants are present in high concentrations of approx. >0.5 M, preferably >0.7 M, preferably >0.8 M, preferably >0.9 M, more preferably >1.0 M, still more preferably >1.5 M, still more preferably >1.7 M.
[0098] In another preferred embodiment of this aspect of the invention, the compound of formula I is any of the compounds stated in table 1 below, or any acid, salt, solvate or stereoisomer thereof.
TABLE-US-00011 TABLE 1 List of compounds of formula I obtained according to the methods of the present invention. Compound Name I1 sodium 4-hydroxy-2-oxobutanoate I2 ()-sodium 4,5-dihydroxy-2-oxopentanoate (and anomer /-Sodium 4-hydroxytetrahydrofuran-2-carboxylate) I3a sodium (4R,6S)-4,6-dihydroxy-2-oxoheptanoate I3b sodium (4S,6R)-4,6-dihydroxy-2-oxoheptanoate I4a sodium (5S)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxohexanoate I4b sodium (5R)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxohexanoate I5 ()-sodium 4-hydroxy-3-(hydroxymethyl)-2-oxobutanoate I6 ()-sodium 5-(benzyloxy)-4-hydroxy-2-oxopentanoate I7a sodium (5S)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-3-methyl-2-oxohexanoate I7b sodium (5R)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-3-methyl-2-oxohexanoate I8a sodium (5S)-5-(((benzyloxy)carbonyl)amino)-3-ethyl-4-hydroxy-2-oxohexanoate I8b sodium (5R)-5-(((benzyloxy)carbonyl)amino)-3-ethyl-4-hydroxy-2-oxohexanoate I9a sodium 3-((2S)-2-(((benzyloxy)carbonyl)amino)-1-hydroxypropyl)-2-oxooctanoate I9b sodium 3-((2R)-2-(((benzyloxy)carbonyl)amino)-1-hydroxypropyl)-2-oxooctanoate I10a sodium (5S)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-3-isopropyl-2-oxohexanoate I10b sodium (5R)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-3-isopropyl-2-oxohexanoate I11 sodium (S) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxopentanoate I12a sodium (4R,5S) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxoheptanoate I12b sodium (4S,5R) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxoheptanoate I13a sodium (4R,5S) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-6-methyl-2-oxoheptanoate I13b sodium (4S,5R) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-6-methyl-2-oxoheptanoate I14a sodium (4R,5S) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-7-methyl-2-oxooctanoate I14b sodium (4S,5R) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-7-methyl-2-oxooctanoate I15a sodium (4R,5S) 5-(((benzyloxy)carbonyl)amino)-4-hydroxy-6-methyl-2-oxooctanoate I16a sodium (S)-4-((S)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)-4-hydroxy-2-oxobutanoate I16b sodium (R)-4-((R)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)-4-hydroxy-2-oxobutanoate I17a sodium 4-((S)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)-4-hydroxy-3-methyl-2-oxobutanoate I17b sodium 4-((R)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)-4-hydroxy-3-methyl-2-oxobutanoate I18a sodium 3-((S)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)(hydroxy)methyl)-2-oxopentanoate I18b sodium 3-((R)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)(hydroxy)methyl)-2-oxopentanoate I19a sodium 3-((S)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)(hydroxy)methyl)-2-oxooctanoate I19b sodium 3-((R)-1-((benzyloxy)carbonyl)pyrrolidin-2-yl)(hydroxy)methyl)-2-oxooctanoate
[0099] It is noted that the formation of a double-addition product (compound 1-5, i.e. sodium 4-hydroxy-3-(hydroxymethyl)-2-oxobutanoate, example 5) according to the scheme depicted above appears to be completely novel for these reactions.
[0100] In a preferred embodiment of the method according to the eighth aspect of the invention, the method further comprises the additional step of: [0101] ii) an enzymatic reaction to obtain compounds of formula V
##STR00007##
[0102] wherein R.sub.1 to R.sub.8 are as defined in the seventh aspect of the invention in connection to compound V.
[0103] Examples of reactions according to ii) above are, without limitation, reduction, decarboxylation or transamination using a reductase, decarboxylase or a transaminase, respectively, as shown in scheme 2.
##STR00008##
[0104] In a preferred embodiment of this aspect of the invention, compound V is homoserine, preferably L-homoserine. More preferably, compound V is further reacted according to example 1 to produce L-homoserine lactone (benzyl (S)-(2-oxotetrahydrofuran-3-yl)carbamate).
[0105] Another embodiment of the present invention refers to the method according to ii) above wherein the reaction is non enzymatic, such as, but not limited to, reduction, reductive amination, lactonization, lactamization, cyclization, as shown in scheme 3 below:
##STR00009##
[0106] Illustrative products, falling within the scope of the present invention, resulting from the reactions according to ii) above are illustrated in table 2 below.
TABLE-US-00012 TABLE 2 List of compounds of formula V obtained according to the methods of the present invention. Com- pound Name V1 L-homoserine V4a sodium (5S)-4-hydroxy-5-methylpyrrolidine-2-carboxylate V4b sodium (5R)-4-hydroxy-5-methylpyrrolidine-2-carboxylate V12a sodium (5S)-5-ethyl-4-hydroxypyrrolidine-2-carboxylate v12b sodium (5R)-5-ethyl-4-hydroxypyrrolidine-2-carboxylate V13a sodium (5S)-4-hydroxy-5-isopropylpyrrolidine-2-carboxylate V13b sodium (5R)-4-hydroxy-5-isopropylpyrrolidine-2-carboxylate V14a sodium (5S)-4-hydroxy-5-isobutylpyrrolidine-2-carboxylate V14b sodium (5R)-4-hydroxy-5-isobutylpyrrolidine-2-carboxylate V15a sodium (5S)-5-((S)-sec-butyl)-4-hydroxypyrrolidine-2- carboxylate V16a sodium (7aS)-1-hydroxyhexahydro-1H-pyrrolizine-3- carboxylate V16b sodium (7aR)-1-hydroxyhexahydro-1H-pyrrolizine-3- carboxylate
[0107] In a preferred embodiment of the eighth aspect of the invention, the process is further characterized by the addition of divalent metals such as Co.sup.2+ or Ni.sup.2+.
[0108] A ninth aspect of the invention refers to a method for the preparation of L-homoserine, comprising the following two-step pathway: [0109] (i) an aldol addition of preferably pyruvate to formaldehyde, catalyzed by a fusion protein enzyme or composition as described in the first aspect of the invention; and [0110] (ii) a biocatalytic transamination reaction for the transformation of the prochiral 4-hydroxy-2-oxobutanoic acid into L-homoserine; and
[0111] optionally this method further comprises (iii) the conversion step of L-homoserine in homoserine lactone.
[0112] In a preferred embodiment of this aspect of the invention the protein fusion as illustrated in (i) above is MBP-YfaU as illustrated in SEQ ID NO 9 or in
[0113] It's worth noting that when L-Alanine is used as amine donor in the transamination step (ii), L-homoserine formation can be carried out in a one pot process of industrial interest.
[0114] A tenth aspect of the invention refers to the use of L-alanine as an amine donor in a one-pot reaction scheme using the fusion protein or composition of the first aspect of the invention.
[0115] Thus, an eleventh aspect of the invention refers to a method for the preparation of L-homoserine, comprising the following one pot pathway: [0116] (i) adding a fusion protein enzyme or composition as described in the first aspect of the invention and a transaminase to a buffer solution; [0117] (ii) adding L-alanine, pyruvate and PLP to the buffer solution of step (i) above; [0118] (iii) adding formaldehyde to the composition of step (ii) above;
[0119] optionally (iv) further converting the resulting L-homoserine in (iii) in L-homoserine lactone. It is noted that step (iv) is not usually performed as part of the one pot pathway above mentioned but as an additional reaction once product (iii) (L-homoserine) is obtained.
[0120] An example of the use or process identified in aspects tenth and eleventh above is illustrated in example 1 in section B).
[0121] Furthermore, as already stated, the formation of a double-addition product (i.e. 4-hydroxy-3-(hydroxymethyl)-2-oxobutanoic acid) appears to be completely novel for these reactions. Thus, a twelfth aspect of the invention refers to a method for the preparation of double addition products, comprising an aldol addition of two compounds of formula VI to VII, preferably the double equivalents of formaldehyde to pyruvate, catalyzed by a fusion protein enzyme or composition as described in the first aspect of the invention.
[0122] The invention has been described broadly and generically herein. Each of the narrower species and sub-generic groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0123] Other embodiments are within the following claims and non-limiting examples. In addition, where features or aspects of the invention are described in terms of groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the group.
[0124] The project leading to this application has received funding from the European Union's Horizon 2020 research and innovation programme under grant agreement No 635595 (CarbaZymes).
EXAMPLES
[0125] Materials and methods. Cloning and expression of 2-keto-3-deoxy-
[0126] The gene rhmA from E coli K-12 (NCBI database accession number NC_000913.3) was amplified by PCR from genomic DNA and cloned into pQE4OMBP (developed as discuss below) using KpnI and HindIII.
[0127] In particular, the construction of pQE40-MBP plasmid was as follows. The MBP-3C cleavage tag (Cordingley, et al. J. Virol. 1989, 63(12), 5037-5045) was cloned from pOPINM* plasmid as template (Berrow, N. S. et al. Nucleic acids Res. 2007, 35(6), e45) using the following primers: MBP-3C forward: 5-GCTAGCGGATCCGGCATCATGAAAATCGAAGAAGG-3; MBP-3C reverse: 5-GCTAGCGCATGCCGGACCCTGAAACAGAACTTCC-3. Underlined sequences indicate the restriction sites for BamHI and SphI, respectively. The fragment was then ligated into pQE40 expression vector. The vector introduces codons for a N-terminal (His).sub.6-tag. The ligated construct was transformed into E. coli Nova Blue, and was confirmed by DNA sequencing.
[0128] The plasmid pQE40 MBP-YfaU was transformed into an E. coli strain M-15 [pREP-4] from QIAGEN and grown in LB (Luca-Bertani) medium with ampicillin (100 g mL.sup.1) plus kanamycin (25 g mL.sup.1) at 37 C. on a rotary shaker at 200 rpm. A final optical density at 600 nm (OD600) of 2-3 was usually achieved. An aliquot of the pre-culture (12 mL) was transferred into a shake-flask (2 L) containing LB (600 mL) with ampicillin (100 g mL.sup.1) plus kanamycin (25 g mL.sup.1) and incubated at 37 C. with shaking at 200 rpm. During the middle exponential phase growth (DO6000.5), the temperature was decreased to 20 C. to minimize potential inclusion bodies formation and isopropyl--D-1-thiogalactopyranoside (IPTG; 1 mM final concentration) was added. Cells from the induced-culture broths (3 L) were centrifuged at 12000 G for 30 min at 4 C. The pellet was re-suspended with starting sodium phosphate buffer (200 mL, 50 mM, pH 8.0), containing NaCl (300 mM) and imidazole (10 mM). Cells were lysed by using a cell disrupter (Constant Systems). Cellular debris was removed by centrifugation at 30 000 g for 30 min. The clear supernatant was collected and purified by immobilized metal ion affinity chromatography (IMAC) in an FPLC system (Amersham biosciences). The crude supernatant was applied to a cooled HR 16/40 column (GE Healthcare) packed with HiTrap chelating support (50 mL bed volume; Amersham Biosciences) and washed with the start buffer (250 mL). The protein was eluted with sodium phosphate buffer (50 mM, pH 8.0) containing NaCl (300 mM) and imidazole (500 mM) at a flow rate of 3 mL min.sup.1. Fractions containing the recombinant protein were combined and dialyzed against sodium phosphate buffer (10 mM, pH 7.0) or alternatively against sodium 3-(N-morpholino)propanesulfonate (MOPS) buffer (2 mM, pH 7.0) at 4 C. The dialyzed solution was frozen at 80 C. and lyophilized. The white solid obtained was stored at 20 C. (yield 390 mg L.sup.1 of culture).
Example 1
-
[0129] A Two-step strategy using benzylamine as amine donor.
Step 1. Aldol Addition. Preparation of Sodium 4-hydroxy-2-oxobutanoate (I1)
[0130] ##STR00010##
[0131] To a solution of MBP-YfaU Mg.sup.2+ (dialyzed against sodium phosphate buffer) (15.4 mg of protein, 2 mg mL-1) containing sodium pyruvate 2 (7.1 mL, 1.0 M at pH 6.5-7.0, adjusted with NaOH, 50 mM) in a Falcon tube, formaldehyde 1 (577 L of commercial 12.3 M solution) was added step-wise (115.4 L each 2 h), stirring in a vortex mixer (1000 rpm) at 25 C. After 16-24 h no pyruvate was detected by HPLC (>98% conversion) and the reaction was filtered through active charcoal (in a filter funnel Pyrex 3, 5 cm , filter bed 1 cm) and the pellet was washed with water (310 mL). Solution was frozen at 80 C. and lyophilized to afford the title compound as a white solid (442 mg as mixture of ketone I1 and its hydrate form, 44% isolated yield).
[0132] When MBP-YfaU Mg2+ was dialyzed against sodium 3-(N-morpholino)propanesulfonate (MOPS) buffer (2 mM, pH 7.0) equimolar concentration (2 M) of pyruvate and formaldehyde could be used.
[0133] Reaction monitoring was carried out as follows: samples withdrawn from the reaction mixture (10 L, diluted to 0.1 mM of carbonyl group with MeOH) were mixed with a solution of O-benzylhydroxylamine hydrochloride (50 L, 0.13 mM in pyridine:methanol:water 33:15:2). After incubation at 60 C. for 60 min, samples were diluted in methanol (500 L) and after centrifugation analyzed by HPLC. Solvent system: solvent A=0.1% v/v trifluoroacetic acid (TFA) in H.sub.2O; solvent B=0.095% v/v TFA in CH.sub.3CN:H.sub.2O 80:20. HPLC conditions: gradient elution from 10 to 100% B over 30 min; flow, 1 mL min-1; detection 215 nm.
[0134] Sodium 4-hydroxy-2-oxobutanoate (I1) .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 3.71 (t, J=5.9 Hz, 2H), 2.88 (t, J=5.9 Hz, 2H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 200.56 (CO), 166.37 (CO.sub.2), 55.94 (CH.sub.2OH), 41.14 (CH.sub.2). Sodium 2,2,4-trihydroxybutanoate (hydrate form). .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 3.54 (t, J=6.7 Hz, 2H), 1.95 (t, J=6.7 Hz, 2H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 174.44 (CO.sup.2, 118.85 (C(OH).sub.2), 56.77 (CH.sub.2OH), 40.14 (CH.sub.2).
Step 2. Transamination Reaction. L-homoserine (V1)
[0135] ##STR00011##
[0136] To a sodium 4-hydroxy-2-oxobutanoate (I-1) solution (8.5 mL of a 0.2 M solution in 50 mM sodium phosphate buffer pH 7.0, containing magnesium sulphate (2.5 mM), ThDP (thiamine pyrophosphate) (0.25 mM) and PLP (pyridoxal phosphate) (0.5 mM), 0.1 mol L.sup.1 final concentration in the reaction) in a Falcon Tube (15 mL). Benzylamine 3 (1.7 mL of a 1.0 M solution in 50 mM sodium phosphate buffer pH 7.0, 0.1 M final concentration in the reaction) was added and stirred in a vortex mixer (1000 rpm) at 25 C. The reaction was started by addition of Transaminase Prozomix TA026 (6.8 mL, 12.5 mg mL.sup.1 dissolved in 50 mM sodium phosphate buffer pH 7.0, containing MgSO.sub.4 (2.5 mM), ThDP (0.25 mM), PLP (0.5 mM) and benzaldehyde lyase from Pseudomonas fluorescens biovar I (BAL) (2000 U, 5 mg L.sup.1 final concentration in the reaction). Reaction monitoring was carried out by HPLC. After 24 h, 71% conversion was reached. Then, the reaction was filtered through active charcoal (in a filter funnel Pyrex 3, 5 cm 0, filter bed 1 cm) and the pellet washed with NaHCO.sub.3 10% (320 mL). L-Homoserine (V-1) was obtained diluted in aqueous media (77 mL, 0.071 M).
Synthesis of Homoserine Lactone. Benzyl (S)-(2-oxotetrahydrofuran-3-yl)carbamate (6)
[0137] Benzyloxycarbonylsuccinimide (CbzOSu) (293 mg dissolved in CH.sub.3CN (60 mL)) was added to the filtrated containing L-homoserine (V-1) (77 mL, 0.071 M) and the reaction was stirred at 25 C. After 12 h, organic solvent was reduced under vacuum and pH of aqueous phase was adjusted to 2.0 with HCl (1 M). The aqueous solution was extracted with AcOEt (320 mL). The combined organic phases were dried over anhydrous MgSO.sub.4 and concentrated under vacuum. The residue was dissolved in methanol (100 mL) cooled down at 80 C., and thionyl chloride (327 L, 4.5 mmol) was added dropwise. After stirring for 12 h at 25 C., the solvent was removed under vacuum to give benzyl (S)-(2-oxotetrahydrofuran-3-yl)carbamate (6) as white solid (245 mg, 93% yield; ee>99%, t.sub.R=13.3 min).
[0138] Chiral HPLC analysis: CHIRALPAK ID 46250 mm column, 5 m, isocratic elution hexane/CH.sub.2Cl.sub.2/EtOH 70/10/20 (v/v/v), flow rate 0.8 mL min.sup.1 at 20 C., UV detection 209 and 254 nm, t.sub.R (R)=11.6 min and t.sub.R (S)=13.8 min. [].sup.20.sub.D=40.1 (c=6 in DMSO, [].sup.20.sub.D (R)=+40.8 and [].sup.20 .sub.D (S)=40.4).
[0139] .sup.1H NMR (400 MHz, DMSO-d.sub.6): (ppm) 7.77 (d, J=8.4 Hz, 1H), 7.38-7.25 (m, 5H), 4.41 (dt, J =11.3, 8.8 Hz, 1H), 4.34-4.25 (m, 1H), 4.16 (ddd, J=10.8, 8.7, 6.3 Hz, 1H), 2.43-2.32 (m, 1H), 2.14 (qd, J=11.3, 9.1 Hz, 1H). .sup.13C NMR (101 MHz, DMSO-d.sub.6): (ppm) 175.79 (CO), 156.17 (NHCO), 137.18 (Car), 128.81 (Car), 128.35 (Car), 128.30 (Car), 66.14 (CH.sub.2), 65.48 (CH.sub.2), 49.91(CH), 28.54 (.sup.CH.sub.2.sup.).
B) L-Homoserine (4). One Pot Strategy Using
[0140] ##STR00012##
[0141] MBP-YfaU (4 mg as lyophilized powder) and transaminase Prozomix TA051 (2.8 U* as lyophilized powder) were dissolved in sodium phosphate buffer (491 L, 50 mM, pH 7.0) in an Eppendorf tube. Then,
Example 2
()-Sodium 4-hydroxytetrahydrofuran-2-carboxylate (/-I-2)
[0142] ##STR00013##
[0143] Reaction was carried out in a Falcon Tube (15 mL). Sodium pyruvate (2) (0.65 g, 5.9 mmol) was dissolved in water (6 mL). Glycolaldehyde (8) (0.35 mg of the commercially available dimer corresponding to 5.9 mmol of monomer) was added to this solution and the pH was adjusted to 7.0 with NaOH (50 mM). The reaction was initiated by the addition of MBP-YfaU as lyophilized powder (30 mg). The mixture was left to react under orbital stirring (1000 rpm) at 25 C. for 16 h. The reaction conversion at this point was greater than 95%, as judged by HPLC analysis. Then, the reaction was centrifuged (5000 g at 4 C. for 30 minutes) and the enzyme in the supernatant, was removed using an Amicon ultrafiltration unit (Millipore, USA, MWCO 10 kDa, 5000 g at 4 C. for 60 minutes) and the residue washed with water (36 mL). The combined aqueous phase was frozen at 80 C. and lyophilized to afford the title compound as a white solid (0.98 g, 98% corresponding to a mixture of the (/)-anomer (-(/)-I-2) and the acyclic compound (()-I-2) in 1:1 proportion).
[0144] NMR (-Anomer). .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 4.58 (m, 1H), 4.16 (dd, J=9.6, 4.1 Hz, 1H), 3.92 (dd, J=9.6, 2.2 Hz, 1H), 2.3 (t, J=4.6 Hz, 1H). 13C NMR (101 MHz, D.sub.2O): (ppm) 176.9, 103.8, 74.9, 71.3, 44.1. (-Anomer). .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 4.58 (m, 1H), 4.13 (m, 1H), 4.03 (dd, J=9.8, 2.5 Hz, 1H), 2.48 (dd, J=14.3, 6.2 Hz, 1H), 2.08 (dd, J=14.2, 2.2 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 176.8, 103.8, 75.5, 70.5, 43.8. (Acyclic I-2) .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 4.22 (ddt, J=8.4, 6.5, 4.4 Hz, 1H), 3.63 (dd, J=11.8, 4.2 Hz, 1H), 3.56 (dd, J=11.8, 6.4 Hz, 1H), 2.99 (dd, J=17.1, 4.5 Hz, 1H), 2.92 (dd, J=17.1, 8.2 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 203.6, 169.5, 67.4, 64.9, 42.8.
Example 3
Sodium (4R,6S)-2,4-dihydroxy-6-methyltetrahydro-2H-pyran-2-carboxylate (13)
[0145] ##STR00014##
Step 1. Synthesis (S)-3-hydroxybutanal (9)
[0146] (S)-3Hydroxybutanal (9) was obtained from (S)-4,4-dimethoxybutan-2-ol by acid hydrolysis as described below. (S)-4,4-Dimethoxybutan-2-ol was obtained from stereoselective reduction of 4,4-dimethoxybutan-2-one.
[0147] (S)-4,4-Dimethoxybutan-2-ol (1.28 g, 9.5 mmol) was dissolved in water (10 mL) and Dowex 50WX8 hydrogen form, 200-400 mesh, (2 g as dry powder) was added. The mixture was left to react under orbital stirring (1000 rpm). After 12 h, when most of the reactant was consumed as judged by TLC, the reaction was filtered and resin was washed with water (5 mL). The aldehyde 12 obtained was used in solution (0.5 M, 17 mL) without any further purification.
Step 2. Preparation of adduct I-3a
[0148] To a solution of (S)-3-hydroxybutanal (9) (11.2 mL, 5.6 mmol) sodium pyruvate (5.6 mL of 1.0 M sodium pyruvate solution in 50 mM sodium phosphate buffer pH 7.0) was added in a falcon tube. The reaction was initiated by addition of NiCl.sub.2 (0.17 mL of 0.1 M NiCl.sub.2 solution in water) and MBP-YfaU as lyophilized powder (96 mg). The mixture (16.8 mL) was left to react under orbital stirring (1000 rpm) at 25 C. for 16 h. The reaction conversion at this point was greater than 95%, as judged by HPLC. Then, the reaction mixture was diluted with methanol (168 mL), filtered through Celite and the pellet washed with methanol (350 mL). The filtrate was then adsorbed onto silica gel (40 g), dried under vacuum and loaded on a silica column chromatography (I=47 cm and (I)=4.5 cm with 200 mL of silica gel). The product was eluted with a step gradient of CHCl.sub.3:MeOH:H.sub.2O, 100:0:0, 200 mL, 75:25:0, 200 mL, 50:50:0, 400 mL, 48:48:4, 400 mL and 45:45:10, 1000 mL. Pure fractions were pooled and the solvent removed under vacuum affording the sodium (4R,6S)-4,6-dihydroxy-2-oxoheptanoate (I-3a) as a yellow oil (0.95 g, 95%).
[0149] [].sup.20.sub.D=18.6 (c=5.0 in DMSO). (-Anomer): .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 4.06-4.08 (m, 2H), 2.10 (ddd, J=12.6, 4.7, 2.0 Hz, 1H), 2.04 (ddt, J=12.4, 4.3, 2.1 Hz, 1H), 1.62 (dd, J =12.6, 11.5 Hz, 1H), 1.27 (m, 1H), 1.24 (d, J=3.8 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 176.2, 96.6, 66.6, 63.9, 40.7, 39.5, 20.4. (-Anomer): .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 3.97 (m, 1H), 3.71 (m, 1H), 2.52 (dd, J=7.1, 1.3 Hz, 1H), 1.98 (dt, J=4.4, 1.9 Hz, 1H), 1.22 (m, 1H), 1.16 (m, 3H), 1.09 (m, 1H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 176.4, 97.1, 68.4, 65.1, 41.0, 40.3, 20.6.
Example 4
Sodium 4-hydroxy-5-methylpyrrolidine-2-carboxylate (V-4)
[0150] ##STR00015##
[0151] Starting aldehyde, benzyl (S)-(1-oxopropan-2-yl)carbamate (10), was obtained from (S)-2-aminopropanal by conventional processes.
Step 1. Preparation of (4R,5S)-(I-4a) and (4S,5S)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxohexanoate (I-4a).
[0152] To a solution of (S)N-Cbz-alaninal (10) (0.5 g, 2.5 mmol) in dimethylformamide (DMF) (5 mL), sodium borate buffer (8.8 mL, 50 mM, pH 7.0) was added. Then, sodium pyruvate (2.5 mL of 1.0 M sodium pyruvate solution in 50 mM sodium borate buffer pH 7.0) and NiCl.sub.2 (0.25 mL of 0.1 M NiCl.sub.2 solution in water) were added. The reaction was initiated by the addition of MBP-YfaU as lyophilized powder (63 mg) dissolved in sodium borate buffer (8.8 mL, 50 mM, pH 7.0). The mixture (25 mL) was left to react under orbital stirring (1000 rpm) for 16 h. The reaction conversion at this point was greater than 95%, as judged by HPLC. Then, the reaction mixture was diluted with methanol (250 mL), filtered through Celite and the pellet washed with methanol (350 mL). The filtrate was adsorbed onto silica gel (40 g) and loaded onto a silica column chromatography (I=47 and =4.5 cm with 200 mL of silica gel). The product was eluted with a step gradient of CHCl.sub.3:MeOH, 100:0, 200 mL, 90:10, 200 mL, 75:25, 400 mL and 50:50, 600 mL. Pure fractions were pooled and the solvent removed under vacuum affording the sodium (4R,5S)-(I-4a) and (4S,5S)-5-(((benzyloxy)carbonyl)amino)-4-hydroxy-2-oxohexanoate (I-4a). 4:1 mixture as white solid (0.68 g, 85%). [].sup.20.sub.D=6.2 (c=5.0 in DMSO).
[0153] To unequivocally acess the structure and stereochemistry of the aldol adduct and produce an amino acid of the pyrrolidine type derivative, the aldol product mixture was submitted to reductive amination.
Step 2. Preparation of Sodium 4-hydroxy-5-methylpyrrolidine-2-carboxylate (V-4a-a)
[0154] ##STR00016##
[0155] The adduct I-4 (0.3 g, 0.9 mmol) was dissolved in MeOH/H.sub.2O 6:1 (700 mL). The solution was kept under H.sub.2 atmosphere at 50 psi in the presence of palladium over charcoal (Pd/C) (1 g).
[0156] After 12 h the reaction was filtered through Celite and the pellet was washed with water (350 mL). The solution was concentrated under vacuum, frozen at 80 C. and lyophilized to afford compounds V-4 a and a (150 mg as mixture of diastereomers, (2R,4R,5S): (2S,4S,5S) V-4a:V-4a 4:1). [].sup.20.sub.D=+7.5 (c=1.0 in water).
[0157] (V-4a Major) .sup.1H NMR (500 MHz, D.sub.2O): (ppm) 4.23 (dd, J=10.0, 6.0 Hz, 1H), 4.19 (q, J=4.7 Hz, 1H), 3.73 (qd, J=7.0, 4.1 Hz, 1H), 2.70 (ddd, J=14.0, 9.8, 5.4 Hz, 1H), 2.11 (dt, J=14.0, 5.2 Hz, 1H), 1.34 (d, J=7.0 Hz, 4H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 166.6, 74.3, 61.3, 57.9, 35.3, 14.3. (V-4a Minor): .sup.1H NMR (500 MHz, D.sub.2O): (ppm) 4.32 (m, 1H), 4.19 (m, Hz, 1H), 3.68 (m, 1H), 2.58 (ddd, J=15.0, 11.0, 4.5 Hz, 1H), 2.26 (m, 1H), 1.41 (d, J=6.8 Hz, 2H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 166.6, 70.5, 60.8, 59.0, 37.0, 11.1.
Example 5
Preparation of Sodium 4-hydroxy-3-(hydroxymethyl)-2-oxobutanoate (I-5)
[0158] ##STR00017##
[0159] Formaldehyde (691 L of 12.3 M commercial solution) was dissolved in 50 mM sodium phosphate buffer pH 7.0 (2.15 mL, containing 2.0 M of sodium pyruvate) in a Falcon tube. The reaction was started by the addition of MBP-YfaU (2.15 mL, 2 mg mL.sup.1 final concentration in reaction, dissolved in 50 mM sodium phosphate buffer pH 7.0, containing 2.0, M of sodium pyruvate) and NiCl.sub.2 (1 mM final concentration in reaction). The reaction was placed in vortex mixer (1000 rpm) at 25 C. Reaction monitoring was carried out by HPLC as described in example 1. After 12 h MeOH (50 mL) was added to the reaction and mixture was filtered through Celite and the pellet was washed with MeOH (350 mL). The product was absorbed onto silica (100 mL) and purified by flash chromatography using silica gel (CH.sub.2Cl.sub.2/MeOH:H.sub.2O, 5:5:1) to afford the title compound 1-5 as a white solid (485 mg, 50% as sodium salt).
[0160] I-5: .sup.1H NMR (400 MHz, D.sub.2O): (ppm) 3.83-3.66 (m, 4H), 3.26 (t, J=5.7 Hz, 1H). .sup.13C NMR (101 MHz, D.sub.2O): (ppm) 205.35, 58.53, 52.69.
Example 6
Preparation of Xompounds I6-I19
[0161] General procedure: To a solution of the appropriate N-Cbz-aminoaldehyde 10 or 12 (Table 3) (2.5 mmol) in DMF (5 mL), sodium borate buffer (8.8 mL, 50 mM, pH 7.0) was added. Then, pyruvate or pyruvate analogs 2 (2.5 mmol in 50 mM sodium borate buffer pH 7.0) and NiCl.sub.2 (0.25 mL of 0.1 M NiCl.sub.2 solution in water) were added. The reaction was initiated by the addition of MBP-YfaU or the corresponding variant as lyophilized powder (63 mg) dissolved in sodium borate buffer (8.8 mL, 50 mM, pH 7.0). The mixture (25 mL) was left to react under orbital stirring (1000 rpm) for 24 h. Then, the reaction mixture was diluted with methanol (250 mL), filtered through Celite and the pellet washed with methanol (350 mL). The filtrate was adsorbed onto silica gel (40 g) and loaded onto a silica column chromatography (I=47 and =4.5 cm with 200 mL of silica gel). The products were eluted with a step gradient of CHCl.sub.3:MeOH, 100:0, 200 mL, 90:10, 200 mL, 75:25, 400 mL and 50:50, 600 mL. Pure fractions were pooled and the solvent removed under vacuum.
##STR00018##
TABLE-US-00013 TABLE 3 Preparation of compounds I6-I19 Compound Acceptor Donor Conv/% Yield** I1 1 2a >95 I2 8 2a >95 99 I3a 9-(S) 2a >95 98 I3b 9-(R) 2a 73 72 I4a 10b-(S) 2a >95 85 I4b 10b-(R) 2a >95 77 I5 1 I1 50 I6 8Bn 2a 81 53 I7a 10b-(S) 2b 70 I7b 10b-(R) 2b 79 I8a 10b-(S) 2c 20-30 I8b 10b-(R) 2c 35 I9a 10b-(S) 2d 31* I9b 10b-(R) 2d 51* I10a 10b-(S) 2e 53* I10b 10b-(R) 2e 63* I11 10a 2a >95 47 I12a 10c-(S) 2a >95 81 I12b 10c-(R) 2a >95 71 I13a 10e-(S) 2a >95 86 I13b 10e-(R) 2a >95 91 I14a 10f-(S) 2a 53 50 I14b 10f-(R) 2a 51 47 I15a 10g-(S) 2a 63 60 I16a 12-(S) 2a 91 69 I16b 12-(R) 2a 88 70 I17a 12-(S) 2b 77 I17b 12-(R) 2b 54 I18a 12-(S) 2c 19 I18b 12-(R) 2c 32 I19b 12-(R) 2d 20* *Not native MPB-YfaU was used **Isolated yield. When yield is not mentioned no isolation was achieved
Example 7
Preparation of Compounds V4 and V12-V16
[0162] Reductive amination of compounds I4 and I -12-I-16 to obtain compounds V4 and V12-V-16 following similar conditions as in example 4 step 2. General procedure: The adducts I (0.9 mmol) were dissolved in MeOH/H.sub.2O 6:1 (700 mL). The solution was kept under H.sub.2 atmosphere at 50 psi in the presence of palladium over charcoal (Pd/C) (1 g). After 12 h the reaction was filtered through Celite and the pellet was washed with water (350 mL). The solution was concentrated under vacuum, frozen at 80 C. and lyophilized to afford compounds V (Table 4).
##STR00019##
TABLE-US-00014 TABLE 4 Compounds V.sub.x obtained from I.sub.x Compound Yield (%) [].sub. V-4a >90 +7.5 V-4b >90 6.3 V-12a >90 +6.8 V-12b >90 3.5 V-13a >90 +10.4 V-13b >90 6.0 V-14a >90 +6.0 V-14b >90 2.6 V-15a >90 V-16a >90 +14.4 V-16b >90 13.2
Example 8
MBP-YfaU Variants
[0163] Following the reaction schemes depicted below, and using the appropriate reactant compounds shown below we prepared compounds of formula I by using the native MBP-YfaU protein and its variants thereof as referred to in the first aspect of the invention:
##STR00020##
[0164] The results are illustrated in table V below.
TABLE-US-00015 TABLE 5 Reactions with 10b carried out using MBP-YfaU being YfaU in its native form or its variants YfaU native YfaU W23V 10b-(R) 10b-(S) 10b-(R) 10b-(S) Comp (2) Conv (%) Conv (%) Conv (%) Conv (%) I-4(b,a) a >95 >95 >95 >95 I-7(b,a) b 79 70 88 80 I-8(b,a) c 35 20-30 >95 >95 I-9(b,a) d 5 I-10(b,a) e 24 5 YfaU L216A YfaU W23V L216A 10b-(R) 10b-(S) 10b-(R) 10b-(S) Comp (2) Conv (%) Conv (%) Conv (%) Conv (%) I-4(b,a) a >95 >95 >95 >95 I-7(b,a) b 11 19 93 76 I-8(b,a) c 27 18 >95 >95 I-9(b,a) d 29 11 I-10(b,a) e 63 56 YfaU W23VF174VL216A YfaU W23AL216A 10b-(R) 10b-(S) 10b-(R) 10b-(S) Comp (2) Conv (%) Conv (%) Conv (%) Conv (%) I-4(b,a) a >95 >95 >95 >95 I-7(b,a) b 32 33 42 34 I-8(b,a) c 27 18 >95 >95 I-9(b,a) d 28 28 51 31 I-10(b,a) e 28 38
##STR00021##
[0165] The results are illustrated in table 6 below.
TABLE-US-00016 TABLE 6 Reactions with 12 carried out using MBP-YfaU being YfaU in its native form or its variants YfaU native YfaU W23V YfaU L216A YfaU W23V L216A 12-(R) 12-(S) 12-(R) 12-(S) 12-(R) 12-(S) 12-(R) 12-(S) Comp (2) Conv (%) Conv (%) Conv (%) Conv (%) Conv (%) Conv (%) Conv (%) Conv (%) I-17(b,a) b 54 77 55 62 34 66 51 80 I-18(b,a) c 32 19 44 22 29 21 39 39 I-19(b,a) d 7 20 6