SOLID PHASE PEPTIDE SYNTHESIS
20190194246 ยท 2019-06-27
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
B01J2204/005
PERFORMING OPERATIONS; TRANSPORTING
C12N2740/16322
CHEMISTRY; METALLURGY
C07K14/4723
CHEMISTRY; METALLURGY
C07K14/635
CHEMISTRY; METALLURGY
B01J2219/1248
PERFORMING OPERATIONS; TRANSPORTING
C07K1/1075
CHEMISTRY; METALLURGY
C07K14/59
CHEMISTRY; METALLURGY
C07K1/045
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C07K1/107
CHEMISTRY; METALLURGY
C07K14/59
CHEMISTRY; METALLURGY
C07K14/635
CHEMISTRY; METALLURGY
Abstract
An improved method of deprotection in solid phase peptide synthesis is disclosed. In particular the deprotecting composition is added in high concentration and small volume to the mixture of the coupling solution, the growing peptide chain, and any excess activated acid from the preceding coupling cycle, and without any draining step between the coupling step of the previous cycle and the addition of the deprotection composition for the successive cycle. Thereafter, the ambient pressure in the vessel is reduced with a vacuum pull to remove the deprotecting composition without any draining step and without otherwise adversely affecting the remaining materials in the vessel or causing problems in subsequent steps in the SPPS cycle.
Claims
1. A system for microwave assisted solid phase peptide synthesis comprising: a microwave source positioned to direct microwave radiation into a microwave cavity; a microwave transparent reaction vessel in said cavity; and a vacuum source connected to said reaction vessel.
2. A method according to claim 1 further comprising a trap between said reaction vessel and said vacuum Source.
3. A method according to claim 1 wherein said cavity can support a single mode of microwave radiation at the microwave frequencies produced by said microwave source.
4. A method according to claim 3 where wherein said reaction vessel comprises: a (glass) frit for draining liquids from said reaction vessel; and a spray head for delivery of reagents to said reaction vessel.
5. A system according to claim 1 further comprising a fiber optic temperature probe positioned to read the temperature of said reaction vessel in said cavity (for controlling the microwave power delivered to said reaction vessel).
6. A system according to claim 4 that incorporates nitrogen pressure to transfer all reagents and to provide an inert environment during peptide synthesis.
7. A system according to claim 6 further comprising a nitrogen source in communication with said reaction vessel to bubble the contents of said reaction vessel for mixing during deprotection, coupling, and cleavage reactions.
8. A system according to claim 1 further comprising a processor for controlling every step in every SPPS cycle carried out in said system.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
DETAILED DESCRIPTION
[0030]
[0031] The deprotection solution is then drained (step 24) following which a washing liquid (e.g., methanol or isopropanol) is added to the vessel for a washing step 25 carried out repetitively with five repetitions being typical. The washing solution is then removed in a second draining step 26 which allows the coupling step 27 to take place. The coupling composition is then removed in a third draining step 30 followed by a second washing step 31, again repeated five times.
[0032] It will be understood that
[0033]
[0034]
[0035] The use of a small volume in high concentration saves physical space (only a small bottle is needed), avoids the need to prepare a solution, and saves solvent. The method additionally offers a thermal advantage (
[0036] In exemplary versions of the claimed invention, an organic base is used as the deprotecting composition with piperidine or pyrrolidone or 4-methylpiperidine being typical (although not necessarily exclusive) for this purpose. It will be understood, of course, that additional organic bases that provide the deprotection function without otherwise interfering with the other steps in the method, the growing peptide chain, or the instrument, will be appropriate as well.
[0037] In the most exemplary embodiment, the piperidine or pyrrolidine or 4-methylpiperidine can be added neat; i.e. as an organic liquid and not in solution. In other circumstances, the piperidine or pyrrolidine or 4-methylpiperidine can be added as a highly concentrated solution of at least about 50% organic base by volume, typically in DMF.
[0038] As a further advantage, the high concentration allows the organic base to be added in a proportionally small volume with a ratio of between about 1:20 and 1:3 being appropriate based upon the volume of the coupling solution. Piperidine or pyrrolidone or 4-methylpiperidine can be added in the volume ratio of about 1:5 based upon the volume of the coupling solution when added neat. In such circumstances, the small volume of the deprotecting solution is typically less than 2 ml, and often less than one milliliter. In exemplary circumstances, between about 0.4 and 1.0 ml of piperidine are added to between about 3.8 and 4.2 ml of the mixture of the coupling solution, the growing peptide chain and any excess activated acid.
[0039] Expressing the proportion as a percentage, the small volume of the deprotecting solution is 20% or less of the volume of the mixture of the coupling solution, the growing peptide chain, and any excess activated acid.
[0040]
[0041] In the invention, however, the addition of a small volume (mass) of concentrated base will greatly moderate the degree to which the temperature drops, thus making it easier and faster to return the compositions to the required coupling temperatures. In
[0042]
[0043] In general, and as can be confirmed by appropriate resources, the boiling point of piperidine is approximately 106 C. and that of DMF is about 153 C. As a result the vapor pressure of piperidine will be higher than the vapor pressure of DMF at any given temperature. Accordingly it has now been discovered that pulling a moderate vacuum from the vessel can selectively remove the piperidine and completely avoid the draining step.
[0044] Expressed alternatively, piperidine's vapor pressure is about 4 mm Hg at 25 C., about 39 mm Hg at 50 C., and about 55 mm Hg at 60 C. For pyrrolidine, the vapor pressure is about 8.4 mm Hg at 25 C. and about 102 mm Hg at 60 C. Thus, raising the temperature to 60 C. greatly encourages the desired evaporation.
[0045] Consistent with well understood principles of liquid and vapor pressure, the method can further comprise accelerating the deprotection step by heating the combined protected amino acid and the liquid organic base in the vessel 22, and then accelerating the removal step further by pulling the vacuum 36 while heating the vessel contents. When using a microwave assisted process as described herein (and elsewhere), the microwave radiation can be used to both accelerate the deprotection step and to accelerate the vacuum removal step.
[0046] In exemplary methods, the pressure can be reduced to below atmospheric pressure, or, expressed in terms of temperatures, the deprotection step can be carried out by heating the compositions to at least about 60 C., and in some cases to between about 81 C. and 99 C., after which the vessel contents can be heated to between about 90 and 110 to accelerate the vacuum removal step. Functionally, the vacuum and the applied microwave power should provide the intended enhanced evaporation without otherwise adversely affecting the remaining materials in the vessel or causing problems in subsequent steps in the SPPS cycle.
[0047] These two improvements in overall SPPS cycles can, be combined, so that in another aspect, the improvement includes the steps of adding the deprotecting composition in high concentration and small volume to the mixture of the coupling solution, the growing peptide chain, and any excess activated acid from the preceding coupling step, and doing so without any intervening draining step between the coupling step of the previous cycle and the addition of deprotection composition for the successive cycle. Thereafter, the ambient pressure in the vessel is reduced with a vacuum pull to remove the deprotecting composition without any draining step.
[0048] Combining both improvements in this manner is illustrated by the differences between
[0049]
[0050]
[0051] As schematically illustrated in
[0052] As further schematic details, the microwave source 40 is driven by a power supply broadly designated at 50 which in preferred embodiments can be the switching power supply (and associated methods) set forth in U.S. Pat. No. 6,288,379, the contents of which are incorporated entirely herein by reference. The basic circuits between the power supply and the diode 40 are likewise illustrated schematically at 51. Basic circuitry of the type required is well understood by those in the relevant arts, need not be described in detail herein, and can be built and operated by the skilled person without undue experimentation.
[0053]
[0054] In particular,
[0055] Nitrogen is helpful under these circumstances because it is relatively inexpensive, widely available, and inert to the reactions being carried out and to the equipment in the instrument or system. It will thus be understood that other inert gases, including the noble gases, can be used for this purpose, but in most cases will simply be more expensive and less widely available. In a functional sense, any gas that will avoid interfering chemically with the ongoing reactions or with the instrument will be appropriate.
[0056] In a manner consistent with the diagram of
[0057] Experimental (Predictive)
[0058] Materials and Methods
[0059] Reagents
[0060] All Fmoc amino acids were obtained from Novabiochem (San Diego, CA) and contained the following side chain protecting groups: Asn(Trt), Asp(OtBu), Arg(Pbf), Cys(Trt), Gln(Trt), Glu(OtBu), His(Trt), Lys(Boc), Ser(tBu), Thr(tBu), Trp(Boc), and Tyr(tBu). N-[(1H-Benzotriazol-1-yl)(dimethylamino)methylenel-N-methylmethanaminium hexafluorophosphate Noxide (HBTU), N-hydroxybenzotriazole (HOBO, and benzotriazol-1-yl-N-oxy-tris(pyrrolidino)phosphonium hexafluorophosphate (PyBOP), were also obtained from Novabiochem. Diisopropylethylamine (DIEM, N-methylmorpholine (NMM), collidine (TMP), piperidine, piperazine, trifluoroacetic acid (TFA), thioanisole, 1,2-ethanedithiol (EDT), and phenol were obtained from Sigma Aldrich (St. Louis, Mo.). Dichloromethane (DCM), N,N-Dimethylformamide (DMF), Nmethylpyrrolidone (NMP), anhydrous ethyl ether, acetic acid, HPLC grade water, and HPLC grade acetonitrile were obtained from VWR (West Chester, Pa.).
[0061] SPHERITIDEresin: Trityl linker was prepared using SPHERITIDE resin (CEM Corporation; Matthews, N.C.; USA). The SPHERITIDE resin consists of poly-e-lysine cross-linked with multifunctional carboxylic acids.
[0062] CEM LIBERTYTM Automated Microwave Peptide Synthesizer
[0063] The LIBERTY system (CEM Corporation, Matthews, N.C.) is a sequential peptide synthesizer capable of complete automated synthesis including cleavage of up to 12 different peptides. The LIBERTY system uses the single-mode microwave reactor, DISCOVER, which has been widely used in the organic synthesis industry. The LIBERTY synthesizer uses a standard 30 milliliter (ml) Teflon glass fritted reaction vessel for 0.025-1.0 millimole (mmol) syntheses. The reaction vessel features a spray head for delivery of all reagents and a fiber-optic temperature probe for controlling the microwave power delivery. The system utilizes up to 25 stock solutions for amino acids and seven reagent ports that can perform the following functions: main wash, secondary wash, deprotection, capping, activator, activator base, and cleavage. The system uses nitrogen pressure for transfer of all reagents and to provide an inert environment during synthesis. Nitrogen bubbling is used for mixing during deprotection, coupling, and cleavage reactions. The system uses metered sample loops for precise delivery of all amino acid, activator, activator base, and cleavage solutions. The LIBERTY synthesizer is controlled by an external computer, which allows for complete control of each step in every cycle.
[0064] Peptide Synthesis: VYWTSPFMKLIHEQCNRADG-NH2
[0065] A model peptide containing all 20 amino acids was synthesized under a variety of conditions using the CEM LIBERTY automated microwave peptide synthesizer on 0.152 g Spheritide resin (0.66 meq/g substitution). Deprotection was performed in two stages using a fresh reagent each time with (i) 80% piperidine in DMF; or (ii) piperidine neat. In each case, 0.8 ml of the piperidine was added to 4.0 ml of the coupling solution remaining from the addition of the previous acid. An initial deprotection of 30 s at 50 W (5 min at 0 W for conventional synthesis) was followed by a 3-min deprotection at 50 W (15 min at 0 W for conventional synthesis) with a maximum temperature of 80 C.
[0066] No draining step was carried out between the coupling step of a previous cycle and the addition of the piperidine for the successive cycle.
[0067] After deprotection, the piperidine was removed by applying a vacuum that reduced the ambient pressure in the reaction vessel to below atmospheric pressure. Removal was enhanced by applying microwave power at 50 W for 3 minutes.
[0068] Coupling reactions were performed in the presence of a 5-fold molar excess of 0.2 M Fmoc-protected amino acids dissolved in DMF with various types of activation: (i) HBTU:DIEA:AA (0.9:2:1); HBTU:HOBt:DIEA:AA (0.9:1:2:1); (iii) PyBOP:DIEA:AA (0.9:2:1); (iv) HBTU:NMM:AA (0.9:2:1); and (v) HBTU:TMP:AA (0.9:2:1), double coupling on valine. Coupling reactions were for 5 min at 40 W (30 min at 0 W for conventional synthesis) with a maximum temperature of 80 C. In later experiments, coupling conditions of cysteine and histidine were altered to 2 min at 0 W followed by 4 min at 40 W with a maximum temperature of 50 C. Cleavage was performed using 10 ml of Reagent K (TFA/phenol/water/thioanisole/EDT; 82.5/5/5/5/2.5) for 180 min. Following cleavage, peptides were precipitated out and washed using ice-cold anhydrous ethyl ether.
[0069] Peptide Analysis
[0070] Prior to LC-MS analysis, all peptides were dissolved in 10% acetic acid solution and lyophilized to dryness. Analytical HPLC of peptide products was performed using a Waters Atlantis dC18 column (3 m, 2.1100 mm) at 214 nm. Separation was achieved by gradient elution of 5-60% solvent B (solvent A=0.05% TFA in water; solvent B=0.025% TFA in acetonitrile) over 60 min at a flow rate of 0.5 ml/min. Mass analysis was performed using an LCQ Advantage ion trap mass spectrometer with electrospray ionization (Thermo Electron, San Jose, Calif.). Racemization analysis of amino acids was performed by C.A.T. GmbH & Co. (Tuebingen, Germany) using a published GC-MS method that involves hydrolysis of the peptide in 6 N DCl/D2O (The Peptides: Analysis, Synthesis, Biology, E
[0071] In another embodiment, the invention presents a novel process whereby the coupling and deprotection steps occur within the same solvent. In this process concentrated base is added directly to the resin coupling solution after a desired period of time for the coupling to occur. The deprotection step is then immediately started when the base is added. Therefore, the onset of the deprotection step is immediately after the coupling step without any time delay. Additionally, only a small volume of base is required since it can use the solvent present from the coupling reaction. This requires a sophisticated reagent delivery system for the base that is accurate at very small volumes (0.5 mL) with rapid delivery. Typically, a 20% solution of base (piperidine) in solvent is used for the deprotection step. Excess base concentration can increase base-catalyzed side reactions and therefore significant solvent is required. This means that significant solvent can be saved from this process by adding concentrated base to the coupling solvent.
[0072] To demonstrate the effectiveness of this new process a batch of 24 peptides were assembled using an automated peptide synthesizer modified to perform the in-situ solvent recycling step during each cycle.
[0073] Materials and Methods
[0074] All peptides were synthesized using a Liberty Blue PRIME system (CEM Corporation; Matthews, N.C.; USA) allowing for automated in-situ solvent recycling and evaporation based washing. The peptides were synthesized at 0.05mmol scale with 10 equivalents of amino acid using CarboMAX coupling with AA/DIC/Oxyma (1:2:1) based activation for 100 sec at 90 C. ProTide resins (CEM Corporation; Matthews, N.C.; USA) based on TentaGel technology were used for synthesis with either a Rink Amide linker or a Cl-TCP(Cl) linker with unactivated loading of the first amino acid with DIEA at 90 C. for 5 min. The deprotection step was performed for 50 sec at 95 C. and initiated by adding 0.5 mL of 50% pyrrolidine directly to the coupling solution. A single 14 mL wash was used in between the deprotection and coupling steps. Peptides were cleaved with TFA/TIS/H2O/DODt (92.5:2.5:2.5:2.5) for 30 min at 38 C. using a RAZOR cleavage system (CEM Corporation; Matthews, N.C.; USA).
##STR00001##
[0075] Results and Discussion:
[0076] All peptides synthesized in Table 1 gave the desired target as the major peak with a standard cycle time of 2 minutes and 58 seconds. The in-situ solvent recycling process allowed for 0.5 mL of a concentrated pyrrolidine (BP 87 C.) solution to be added to the end of the coupling step (without draining) An advantage of this setup was that the deprotection immediately proceeded very close to the desired temperature (95 C.) since the coupling solution was already at 90 C. During the deprotection process a vacuum was applied and the pyrrolidine was evaporated and subsequently condensed in the waste container. This allowed only a single wash step (14 mL) to be required at the end of the deprotection step.
TABLE-US-00001 TABLE1 AutomatedSequentialBatchSynthesisof24Peptides UPLC Synthesis # Peptide DiseaseArea ResinUsed Purity(%) Time 1 GRP RegulatesGastrin RAProTide 81 1:22 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH.sub.2 Release 2 Glucagon Hypoglycemia RAProTide 75 1:28 H- HSQGTFTSDYSKYLDSRRAQDFVQWLMNT- NH2 3 Bivalirudin Bloodthinner C1-2-C1-Trt 71 1:05 H-fPRPGGGGNGDFEEIPEEYL-OH 4 Angiotensin Vasoconstrictor C1-2-C1-Trt 82 0:30 H-NRVYVHPF-OH 5 PTH1-34 Osteoporosis RAProTide 70 1:43 H- SVSEIQLMHNLGKHLNSMERVEWLRKKLQD VHNF-NH.sub.2 6 Gonadorelin Fertility RAProTide 91 0:35 pEHWSYGLRPG-NH.sub.2 7 Triptorelin BreastCancer, RAProTide 73 0:35 pEHWSYwLRPG-NH.sub.2 ProstrateCancer, Fertility 8 Liraglutide Diabetes RAProTide 80 1:31 H-HAEGTFTSDVSSYLEGQAAK(-E- palmitoyl)EFIAWLVRGRG-NH.sub.2 9 Exenatide Diabetes RAProTide 74 1:58 H- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGP SSGAPPPS-NH.sub.2 10 MOG(35-55) MultipleSclerosis RAProTide 71 1:05 H-MEVGWYRSPFSRVVHLYRNGK-NH.sub.2 11 Secretin Osmoregulation RAProTide 70 1:19 H-HDGTFTSELSRLRDSARLQRLLQGLV-NH.sub.2 12 Teriparatide Osteoporosis RAProTide 60 1:43 H- SVSEIQLMHNLGKHLNSMERVEWLRKKLQD VHNF-NH.sub.2 13 GLP-1(7-37) Diabetes RAProTide 74 1:34 H- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR G-NH.sub.2 14 Magainin1 Antibiotic RAProTide 79 1:11 H-GIGKFLHSAGKFGKAFVGEIMKS-NH.sub.2 15 Tetracosactide AdrenalCortex RAProTide 77 1:13 H-SYSMEHFRWGKPVGKKRRPVKVYP-NH.sub.2 stimulant 16 [Arg8]-Vasopressin Hormone(blood RAProTide 94 0:32 H-CYFQNCPRG-NH.sub.2 vessel contraction) 17 Ubiquitin Proteinsignaling RAProTide 60 3:44 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD agent KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE STLHLVLRLRGG-NH.sub.2 18 ParasinI Antibiotic RAProTide 87 0:59 H-KGRGKQGGKVRAKAKTRSS-NH.sub.2 19 DynorphinA OpioidResearch RAProTide 71 0:53 H-YGGFLRRIRPKLKWDNQ-NH.sub.2 20 ACP FattyAcid RAProTide 92 0:32 H-VQAAIDYING-NH.sub.2 Synthesis 21 BAM3200 OpioidResearch RAProTide 70 1:16 H-YGGFMRRVGRPEWWMDYQKRYGGFL- NH.sub.2 22 HIV-TAT(47-57) HIV/AIDS RAProTide 93 0:31 Fmoc-YGRKKRRQRRR-NH.sub.2 Research 23 HIV-TAT(48-60) HIV/AIDS RAProTide 88 0:39 Fmoc-GRKKRRQRRRPPQ-NH.sub.2 Research 24 Pramlintide Diabetes RAProTide 72 1:52 KCNTATCATQRLANFLVHSSNNFGPILPPTN VGSNTY--NH.sub.2
[0077] Total Synthesis Time for Entire Batch: 32.6 Hours
[0078] This new process provided a significant reduction in standard cycle time (2 minutes 57 seconds) from (a)elimination of the coupling drain time, (b)elimination of the deprotection delivery time between steps, and (c)elimination of the temperature ramp time for the deprotection step thereby allowing a shorter deprotection time to be used. Additionally, significant solvent savings were possible with the complete elimination of the deprotection solvent during each cycle.
[0079] In the drawings and specification there has been set forth a preferred embodiment of the invention, and although specific terms have been employed, they are used in a generic and descriptive sense only and not for purposes of limitation, the scope of the invention being defined in the claims.