IDENTIFICATION AND MONITORING OF CLEAVED IMMUNOGLOBULINS BY MOLECULAR MASS

20190195888 · 2019-06-27

Assignee

Inventors

Cpc classification

International classification

Abstract

This document relates to materials and methods for identifying and monitoring immunoglobulin cleavage (e.g., IgG cleavage) in a sample, such as a biological sample, using mass spectrometry techniques.

Claims

1. A method for detecting IgG cleavage in a patient, the method comprising: a. providing a sample comprising IgG from the patient; b. subjecting the sample to a mass spectrometry technique to obtain a mass spectrum of the sample; and c. identifying the presence of an IgG cleavage fragment.

2. A method for identifying plasmin activation in a patient, the method comprising: a. providing a sample comprising IgG from the patient; b. subjecting the sample to a mass spectrometry technique to obtain a mass spectrum of the sample; and c. identifying the presence of an IgG cleavage fragment.

3. A method for detecting complement activation in a patient, the method comprising: a. providing a sample comprising IgG from the patient; b. subjecting the sample to a mass spectrometry technique to obtain a mass spectrum of the sample; and c. identifying the presence of an IgG cleavage fragment.

4. The method of any one of claims 1 to 3, wherein the sample is suspected to comprise plasmin IgG cleavage.

5. The method of any one of claims 1 to 4, wherein the sample is a blood sample.

6. The method of claim 5, wherein the blood sample is a serum sample.

7. The method of any one of claims 1 to 6, wherein the patient is a human.

8. The method of any one of claims 1 to 7, wherein the IgG cleavage fragment is a plasmin generated IgG cleavage fragment.

9. The method of any one of claims 1 to 8, wherein the IgG cleavage fragment comprises the amino acid sequence THTCPPCPAPEL (SEQ ID NO:2).

10. The method of claim 9, wherein the IgG cleavage fragment is glycosylated.

11. The method of any one of claims 1 to 10, wherein the IgG cleavage fragment is from a polyclonal IgG.

12. The method of any one of claims 1 to 10, wherein the IgG cleavage fragment is from a monoclonal IgG.

13. The method of any one of claims 1 to 3, further comprising isolating the IgG from the sample.

14. The method of any one of claims 1 to 3, further comprising enriching the IgG from the sample.

15. The method of any one of claims 1 to 3, further comprising contacting the sample with a reducing agent prior to subjecting the sample to the mass spectrometry technique.

16. The method of claim 15, wherein the reducing agent is dithiothreitol (DTT).

17. The method of any one of claims 1 to 3, wherein the mass spectrometry technique is electrospray ionization mass spectrometry (ESI-MS).

18. The method of claim 17, wherein the ESI-MS technique comprises a quadrupole time-of-flight (TOF) mass spectrometer.

19. The method of claim 18, wherein the mass spectrometry technique is a top-down mass spectrometry technique.

20. A method for identifying an inflammatory condition in a patient, the method comprising: a. providing a sample from the patient; b. subjecting the sample to a mass spectrometry technique to obtain a mass spectrum of the sample; and c. identifying the presence of an IgG cleavage fragment.

21. The method of claim 20, wherein the sample is a blood sample.

22. The method of claim 21, wherein the blood sample is a serum sample.

23. The method of claim 20, wherein the patient is a human.

24. The method of claim 20, wherein the IgG cleavage fragment comprises an Fc fragment.

25. The method of claim 24, wherein the Fc fragment is glycosylated.

26. The method of claim 20, wherein the IgG is a polyclonal IgG.

27. The method of claim 20, wherein the IgG is a monoclonal IgG

28. The method of claim 20, further comprising isolating the IgG from the sample.

29. The method of claim 20, further comprising contacting the sample with a reducing agent prior to subjecting the sample to the mass spectrometry technique.

30. The method of claim 29, wherein the reducing agent is dithiothreitol (DTT).

31. The method of claim 20, wherein the mass spectrometry technique is electrospray ionization mass spectrometry (ESI-MS).

32. The method of claim 31, wherein the ESI-MS technique comprises a quadrupole time-of-flight (TOF) mass spectrometer.

33. The method of claim 20, wherein the mass spectrometry technique is a top-down mass spectrometry technique.

34. The method of claim 20, wherein the method further comprises distinguishing an autoimmune inflammatory condition from an infectious inflammatory condition in the subject.

35. The method of claim 34, wherein a sample from a patient having the autoimmune inflammatory condition comprises a plasmin generated IgG cleavage fragment.

36. The method of claim 35, wherein the plasmin generated IgG cleavage fragment comprises the amino acid sequence THTCPPCPAPEL (SEQ ID NO:2)

37. The method of claim 34, wherein the autoimmune inflammatory condition is selected from the group consisting of Sjgren's syndrome, rheumatoid arthritis, lupus erythematosus, and vasculitis.

38. The method of claim 34, wherein a sample from a patient having the infectious inflammatory condition comprises an IgG-degrading enzyme of Streptococcus pyogenes (IdeS) generated IgG cleavage fragment.

39. The method of claim 34, wherein the infection is a Streptococcus pyogenes infection.

40. A method for monitoring plasmin activation in a subject comprising: a. providing a first sample of the subject; b. providing a second sample of the subject; c. subjecting the first and second samples to a mass spectrometry technique to obtain a mass spectrum of the first and second samples; d. determining the amount of IgG cleavage fragment in the first and second samples; and e. comparing the amount of the IgG cleavage fragment in the first and second samples.

41. A method for monitoring a treatment of an immune disease in a patient comprising: a. providing a first sample of the patient obtained before the treatment; b. providing a second sample of the patient obtained during or after the treatment; c. subjecting the first and second samples to a mass spectrometry technique to obtain a mass spectrum of the first and second samples; d. determining the amount of IgG cleavage fragment in the first and second samples; and e. comparing the amount of the IgG cleavage fragment in the first and second samples.

42. The method of claim 40 or 41, further comprising isolating the IgG from the first sample and isolating the IgG from the second sample.

43. The method of claim 40 or 41, further comprising contacting the first sample and the second sample with a reducing agent prior to subjecting the first sample and the second sample to the mass spectrometry technique.

44. The method of claim 43, wherein the reducing agent is dithiothreitol (DTT).

45. The method of claim 40 or 41, wherein the mass spectrometry technique is electrospray ionization mass spectrometry (ESI-MS).

46. The method of claim 45, wherein the ESI-MS technique comprises a quadrupole time-of-flight (TOF) mass spectrometer.

47. The method of claim 40 or 41, wherein the mass spectrometry technique is a top-down mass spectrometry technique.

48. The method of claim 41, wherein the immune disease is an autoimmune disease.

49. The method of claim 48, wherein the autoimmune disease is selected from the group consisting of Sjgren's syndrome, rheumatoid arthritis, lupus erythematosus, and vasculitis.

50. The method of claim 48, wherein a sample from a patient having the autoimmune inflammatory condition comprises a plasmin generated IgG cleavage fragment.

51. The method of claim 50, wherein the plasmin generated IgG cleavage fragment comprises the amino acid sequence THTCPPCPAPEL (SEQ ID NO:2).

52. The method of claim 40, wherein the determining the amount of IgG cleavage fragment in the first and second samples comprises determining the concentration of IgG cleavage fragment in the first and second samples, and wherein the comparing the amount of the IgG cleavage fragment in the first and second samples comprises comparing the concentration of the IgG cleavage fragment in the first and second samples.

53. The method of claim 41, wherein the determining the amount of IgG cleavage fragment in the first and second samples comprises determining the concentration of IgG cleavage fragment in the first and second samples, and wherein the comparing the amount of the IgG cleavage fragment in the first and second samples comprises comparing the concentration of the IgG cleavage fragment in the first and second samples.

Description

DESCRIPTION OF THE DRAWINGS

[0011] FIG. 1 is a schematic model of an IgG immunoglobulin with a close up of the heavy chain amino acid sequence (SEQ ID NO:1) in the hinge region where plasmin and IdeS cleave the molecule into Fc and F(ab) or F(ab)2 fragments.

[0012] FIG. 2 is a schematic model of an IgG immunoglobulin after cleavage with plasmin and the heavy chain and light chain fragments generated when reduced with DTT.

[0013] FIG. 3 contains MS spectrum of IdeS cleaved serum. A) A total ion chromatogram (TIC) from pooled normal human serum polyclonal immunoglobulins. B) A TIC from pooled normal human serum polyclonal immunoglobulins with cleavage using IdeS enzyme. C) A summed mass spectrum of a deconvoluted mass spectrum (inset) from retention times for the Fc fragment. D) Close up charge states for the polyclonal Fa and Fb fragments.

[0014] FIG. 4 contains MS analyses of plasmin cleaved serum. A) A TIC from a patient with suspected plasmin immunoglobulin cleavage activity. B) A summed mass spectra and a deconvoluted mass spectrum (inset).

[0015] FIG. 5 is a top-down mass spectrum of the +22 charge state from the presumed plasmin cleaved Fc fragment (SEQ ID NO:2).

[0016] FIG. 6 contains a summed mass spectrum from retention times for the polyclonal Fa and Fb fragments showing the molecular mass distributions for the +11 charge states from the patient with plasmin IgG cleavage.

[0017] FIG. 7 shows an overlay of summed spectra from the Fc retention time taken from 6 different patients with evidence for plasmin IgG cleavage.

DETAILED DESCRIPTION

[0018] This document provides materials and methods for identifying and monitoring immunoglobulin cleavage in a sample using mass spectrometry techniques. For example, the materials and methods provided herein can be used to identify and monitor IgG cleavage. The use of mass over charge (m/z), optionally with additional techniques, such as gel electrophoresis and/or peptide sequencing, provides a more direct assessment of the IgG cleavage fragment because it can identify plasmin activation in a sample from a patient and/or detect complement activation in a patient. These methods are useful for screening biological samples for the presence or absence of an IgG cleavage fragment, for identifying an inflammatory condition in a patient, for monitoring plasmin activation in a patient, and/or for monitoring treatment of an immune disease in a patient.

[0019] Described herein are enzyme generated IgG cleavage fragments. IgG cleavage fragments can be generated by any appropriate enzyme. In some cases, the enzyme can be an endogenous enzyme. For example, IgG cleavage fragments can be plasmin-generated IgG cleavage fragments. Plasmin cleaves IgG in the heavy chain hinge to generate Fc and F(ab) or F(ab)2 fragments. A portion of the IgG heavy change hinge sequence (SEQ ID NO:1) including the plasmin cleavage site is shown in FIG. 1. A plasmin-generated IgG cleavage fragment can include the amino acid sequence THTCPPCPAPEL (SEQ ID NO:2) at its N-terminus. For example, a plasmin-generated IgG cleavage fragment can include the amino acid sequence THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGKGK (SEQ ID NO:3) at its N-terminus. In some cases, a plasmin-generated IgG cleavage fragment can be glycosylated. A glycosylated cleavage fragment can include any appropriate carbohydrate (e.g., hexose or sialic acid).

[0020] IgG cleavage fragments described herein (e.g., plasmin-generated IgG fragments) can be detected using mass spectroscopy. The speed, sensitivity, resolution, and robustness of mass spectroscopy make the present methods superior than gel electrophoresis for screening samples for IgG fragments. A method described herein can include the use of a liquid chromatography mass spectrometry (LC-MS). In some cases, electrospray ionization mass spectrometry (ESI-MS) techniques can be used, for example, an electrospray ionization quadrupole time-of-flight mass spectrometry (ESI-Q-TOF MS) technique. In some cases, a mass spectrometry technique can be a top-down mass spectrometry technique.

Samples and Sample Preparation

[0021] The materials and methods for identifying and monitoring immunoglobulin cleavage (e.g., IgG cleavage) described herein can include any appropriate sample. A sample can be any biological sample, such as a tissue (e.g., adipose, liver, kidney, heart, muscle, bone, or skin tissue) or biological fluid (e.g., blood, serum, plasma, urine, lachrymal fluid, or saliva). The sample can be from a patient that has immunoglobulins, which includes but is not limited to a mammal, e.g. a human, dog, cat, primate, rodent, pig, sheep, cow, horse, bird, reptile, or fish. A sample can also be a man-made reagent, such as a mixture of known composition or a control sample. In some cases, the sample is serum from a human patient.

[0022] A sample can be treated to remove components that could interfere with the mass spectrometry technique. A variety of techniques known to those having skill in the art can be used based on the sample type. Solid and/or tissue samples can be ground and extracted to free the analytes of interest from interfering components. In such cases, a sample can be centrifuged, filtered, and/or subjected to chromatographic techniques to remove interfering components (e.g., cells or tissue fragments). In yet other cases, reagents known to precipitate or bind the interfering components can be added. For example, whole blood samples can be treated using conventional clotting techniques to remove red and white blood cells and platelets. A sample can be deproteinized. For example, a plasma sample can have serum proteins precipitated using conventional reagents such as acetonitrile, KOH, NaOH, or others known to those having ordinary skill in the art, optionally followed by centrifugation of the sample.

[0023] Immunoglobulins can be isolated from the samples or enriched (i.e. concentrated) in a sample using standard methods known in the art. Such methods include removing one or more non-immunoglobulin contaminants from a sample. In some cases, the samples can be enriched or purified using immunopurification, centrifugation, filtration, ultrafiltration, dialysis, ion exchange chromatography, size exclusion chromatography, protein A/G affinity chromatography, affinity purification, precipitation, gel electrophoresis, capillary electrophoresis, chemical fractionation (e.g., antibody purification kits, such as Melon Gel Purification), and aptamer techniques. For example, the immunoglobulins can be purified by chemical-based fractionation, e.g., Melon Gel Chromatography (Thermo Scientific), where Melon Gel resins bind to non-immunoglobulin proteins in a sample and allow immunoglobulins to be collected in the flow-through fraction; or by affinity purification, e.g., by Protein A, Protein G, or Protein L purification, where immunoglobulins are bound by those proteins at physiologic pH and then released from the proteins by lowering the pH. When serum, plasma, or whole blood samples are used, a sample, such as a 10-250 l sample (e.g., a 20 l sample), can be directly subjected to Melon Gel, Protein A, Protein or Protein L purification. Size exclusion principles such as a TurboFlow column can also be employed to separate the non-immunoglobulin contaminants from a sample. When urine samples are used, a urine sample can be buffered, e.g., a 50 l urine sample can be diluted first with 50 l of 50 mM ammonium bicarbonate.

[0024] Intact immunoglobulins can be further processed to decouple the light chains in a total immunoglobulin sample from the heavy chain immunoglobulins. Decoupling can be achieved by treating the total immunoglobulins with a reducing agent, such as DTT (2,3 dihydroxybutane-1,4-dithiol), DTE (2,3 dihydroxybutane-1,4-dithiol), thioglycolate, cysteine, sulfites, bisulfites, sulfides, bisulfides, TCEP (tris(2-carboxyethyl)phosphine), 2-mercaptoethanol, and salt forms thereof. In some cases, the reducing step is performed at elevated temperature, e.g., in a range from about 30 C. to about 65 C., such as about 55 C., in order to denature the proteins. In some cases, the sample is further treated, e.g., by modifying the pH of the sample or buffering the sample. In some cases, the sample can be acidified. In some cases, the sample can be neutralized (e.g., by the addition of a base such as bicarbonate).

[0025] In some cases, the antigen binding fragments (Fab) of immunoglobulins can be cleaved from the intact immunoglobulins using proteases such as pepsin. Excess reagents and salts can be removed from the samples using methods known to those having ordinary skill in the art.

Mass Spectrometry Methods

[0026] The materials and methods for identifying and monitoring immunoglobulin cleavage (e.g., IgG cleavage) described herein can include any appropriate mass spectrometry (MS) technique. After sample preparation, a sample can be subjected to a MS technique, either directly or after separation on a high performance liquid chromatography column (HPLC). In some cases, liquid chromatography mass spectrometry (LC-MS) can be used to analyze the mass spectrum of the ions. For example, the method can be used to identify multiply charged ions (e.g., the +1 ions, +2 ions, +3 ions, +4 ions, +5 ions, +6 ions, +7 ions, +8 ions, +9 ions, +10 ions, +11 ions, +12 ions, +13 ions, +14 ions, +15 ions, +16 ions, +17 ions, +18 ions, +19 ions, +20 ions, +21 ions, and +22 ions), resulting from the IgG cleavage fragments in the sample. In some cases, the +22 charged ion is identified and used for further analysis. In some cases, the samples are not fragmented during the mass spectrometry technique. LC-MS is an analytical technique that combines the physical separation capabilities of liquid chromatography with the mass analysis capabilities of mass spectrometry, and is suitable for detection and potential identification of chemicals in a complex mixture. Any LC-MS instrument can be used, e.g., the ABSciex 5600 Mass Spectrometer. In some cases, microflowLC-MS can be utilized. Any suitable microflow instrument can be used, e.g., the Eksigent Ekspert 200 microLC. The ion mass spectrum can be analyzed for one or more peaks corresponding to one or more IgG cleavage fragments in the sample. For example, one or more ion peaks, e.g., a +22 ion peak, can be examined to determine the IgG cleavage fragments in the sample.

[0027] In some cases, electrospray ionization coupled to a quadrupole time-of-flight mass spectrometry (ESI-Q-TOF MS) can be used to analyze the mass spectrum of a sample, e.g., the mass spectrum of the +22 charge state of the IgG cleavage fragments in the sample. Electrospray ionization mass spectrometry (ESI MS) is a useful technique for producing ions from macromolecules because it overcomes the propensity of these molecules to fragment when ionized. In addition, ESI often produces multiply charged ions, effectively extending the mass range of the analyzer to accommodate the orders of magnitude observed in proteins and other biological molecules. A quadrupole mass analyzer (Q) consists of four cylindrical rods, set parallel to each other. In a quadrupole mass spectrometer, the quadrupole is the component of the instrument responsible for filtering sample ions based on their mass-to-charge ratio (m/z). The time-of-flight (TOF) analyzer uses an electric field to accelerate the ions through the same potential, and then measures the time they take to reach the detector. If the particles all have the same charge, the kinetic energies are identical, and their velocities depend only on their masses. Lighter ions reach the detector first. Any ESI-Q-TOF mass spectrometer can be used, e.g., the AB Sciex TripleTOF 5600 quadrupole time-of-flight mass spectrometer. The mass spectrum, e.g., the mass spectrum of multiply charged intact light chain or heavy chain polypeptide ions, can be analyzed to identify one or more peaks at an appropriate mass/charge expected for the chain. For example, for the IgG cleavage fragments, the peaks can occur at about 600-2500 m/z. In some cases, the peaks can occur at about 700-2000 m/z (e.g., about 800-1600 m/z for the +22 ion).

[0028] The multiply charged ion peaks can be converted to a molecular mass using known techniques. For example, multiply charged ion peak centroids can be used to calculate average molecular mass and the peak area value used for quantification is supplied by a software package. Specifically, multiple ion deconvolution can be performed using the Bayesian Protein Reconstruct software package in the BioAnalyst companion software package in ABSCIEX Analyst TF 1.6. Deconvoluted and multiply charged ions can also be manually integrated using the Manual Integration 33 script in Analyst TF. Providing the molecular mass for the IgG cleavage fragments in the sample facilitates sequencing and identification of the IgG cleavage fragments in the sample. For example, the methods provided herein can be used to identify plasmin-generated IgG cleavage fragments in the sample. In addition, the methods provided herein can be used to compare the relative abundance of the IgG cleavage fragments as compared to a control or reference sample. As described herein, the plasmin-generated IgG cleavage can include the N-terminal amino acid sequence THTCPPCPAPEL (SEQ ID NO:2). The presence or absence of this plasmin-generated IgG cleavage fragment can be indicative of activation of complement and therefore is a useful tool for diagnosing and monitoring patients with an inflammatory condition (e.g., an immune disease or an infection).

[0029] In some cases, matrix assisted laser adsorption ionization-time of flight mass spectrometry (MALDI-TOF MS) can be used to analyze the mass spectrum of a sample. MALDI-TOF MS identifies proteins and peptides as mass charge (m/z) spectral peaks. Further, the inherent resolution of MALDI-TOF MS allows assays to be devised using multiple affinity ligands to selectively purify/concentrate and then analyze multiple proteins in a single assay.

Methods for Screening Samples and for Diagnosing and Monitoring Inflammatory Conditions

[0030] The materials and methods provided herein can be used for identifying and monitoring immunoglobulin cleavage (e.g., IgG cleavage).

[0031] In some cases, the mass spectrometry based methods disclosed herein can be used to screen a sample (e.g., a biological sample) for a particular IgG cleavage fragment (e.g., plasmin-generated IgG cleavage fragments). For example, the mass spectrometry based methods disclosed herein can be used for detecting an IgG cleavage in a sample from a patient. For example, the mass spectrometry based methods disclosed herein can be used for identifying plasmin activation in a sample from a patient, for detecting complement activation in a patient. For example, the mass spectrometry based methods disclosed herein can be used for diagnosing an inflammatory condition in a patient. The mass spectrometry based methods disclosed herein can include subjecting a sample having one or more immunoglobulins to a mass spectrometry assay. The sample can be pretreated to isolate or enrich immunoglobulins present in the sample. The immunoglobulin light chains can be decoupled from the immunoglobulin heavy chains prior to the mass spectrometry analysis. The spectrum obtained from the assay can then be used to identify IgG cleavage fragments in the sample. In some cases, the relative abundance of identify IgG cleavage fragments can be determined by converting the peak areas of one or more of the identified peaks into a molecular mass.

[0032] The presence or absence of a particular IgG cleavage fragment (e.g., plasmin-generated IgG cleavage fragments) can be used to diagnose an inflammatory condition. An inflammatory condition can affect any part of the patient. For example, an inflammatory condition disease can affect a major organ (e.g., heart, kidney, liver, lung, and skin), glands (e.g., adrenal, pancreas, thyroid, salivary, and multi-glandular), reproductive organs, digestive system, blood, connective tissue, muscle, nervous system, vascular system, eyes, and/or ears. An inflammatory condition can be an immune disease or an infection (e.g., a pathogenic infection). The presence of plasmin-generated IgG cleavage fragments can indicate that the inflammatory condition may be an autoimmune disease. An immune disease can be an autoimmune disease or an immune deficiency. Examples of autoimmune diseases include, without limitation, Barraquer-Simons Syndrome, asthma, lupus erythematosus, glomerulonephritis, various forms of arthritis (e.g., rheumatoid arthritis), autoimmune heart disease, multiple sclerosis, inflammatory bowel disease, vasculitis, paroxysmal nocturnal hemoglobinuria, and Sjgren's syndrome. In some cases, the presence of a plasmin-generated IgG cleavage fragment can be used to diagnose lupus erythematosus, rheumatoid arthritis, multiple sclerosis, Sjgren's syndrome, inflammatory bowel disease, or vasculitis. Examples of immune deficiencies include, without limitation, humoral immune deficiency, T cell deficiency, granulocyte deficiency, asplenia, complement deficiency, severe combined immunodeficiency, and acquired immune deficiency syndrome. The absence of plasmin-generated IgG cleavage fragments can indicate that the inflammatory condition may be an infection. An infection can be caused by any appropriate pathogen (e.g., bacteria, viruses, or fungi). In some cases, the presence or absence of plasmin-generated IgG cleavage fragments can be used to distinguish between inflammation associated with an autoimmune disease and inflammation associated with an infection. In some cases, the methods provided herein can be used to confirm a diagnosis made by current methods such as gel electrophoresis. For example, if a negative result is obtained from gel electrophoresis, the present methods can be used as a secondary test to confirm or counter such results. In some cases, the diagnosis provided herein can be confirmed using such standard methods.

[0033] In some cases, the mass spectrometry based methods provided herein can also be used for monitoring a patient. For example, the mass spectrometry based methods disclosed herein can be used for monitoring plasmin activation in a patient. For example, the mass spectrometry based methods disclosed herein can be used for monitoring treatment of an immune disease in a patient. The mass spectrometry based methods disclosed herein can include providing a first sample and a second sample of the subject. For example, the mass spectrometry based methods disclosed herein can include providing a first sample of the subject before the treatment and a second sample of the subject during or after the treatment. The first and second samples can be pretreated to isolate or enrich immunoglobulins present in the first and second samples. The immunoglobulin light chains in the first and second samples can be decoupled from the immunoglobulin heavy chains prior to the mass spectrometry analysis. The spectrum obtained from the assay can then be used to identify IgG cleavage fragments in the first and second samples. In some cases, the relative abundance of identify IgG cleavage fragments in the first and second samples can be determined by converting the peak areas of one or more of the identified peaks into a molecular mass. The presence or absence of a particular IgG cleavage fragment (e.g., a plasmin-generated IgG cleavage fragment) can be determined in the first and second samples. A decrease (or loss) of the amount of plasmin-generated IgG cleavage fragments indicates that the plasmin activation in the patient has been reduced (or eliminated); while an increase in the amount of plasmin-generated IgG cleavage fragments indicates that plasmin activation in the patient has increased. In cases where a first sample of the subject is before the treatment and a second sample of the subject is during or after the treatment, the presence or absence of a plasmin-generated IgG cleavage fragment is determined before and after the treatment and compared. A decrease (or loss) of the amount of plasmin-generated IgG cleavage fragments indicates that the treatment may be effective for the subject; while an increase or no change in the amount of plasmin-generated IgG cleavage fragments indicates that the treatment may be ineffective for the subject. For example, the amount of IgG cleavage fragment in a first sample and in a second sample can be determined, and the amount of IgG cleavage fragment in the first sample can be compared to the amount of IgG cleavage fragment and the second sample. For example, the concentration of IgG cleavage fragment in a first sample and in a second sample can be determined, and the concentration of IgG cleavage fragment in the first sample can be compared to the amount of IgG cleavage fragment and the second sample.

[0034] The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.

EXAMPLES

Example 1: Mass Spectrometry to Identify IgG Fc and Fab Fragments Produced by Plasmin in Patient Serum

[0035] Immunoglobulins of the IgG isotype can be cleaved by enzymes such as IdeS and plasmin. A model of an IgG immunoglobulin with a close up of the heavy chain amino acid sequence (SEQ ID NO:1) in the hinge region where plasmin and IdeS cleave the molecule into Fc and F(ab) or F(ab)2 fragments is shown in FIG. 1. Cleavage of an IgG with these enzymes generates fragments referred to as the Fc portion (which contains the constant region of the heavy chain) and the Fab or F(ab)2 portion (which contains the variable region of the heavy chain along with the entire light chain) as shown in FIG. 2. The expected molecular masses for Fa, Fb, and Fc fragments from IgG1 in serum are 25,000 Da-26,000 Da, 22,500 Da-24,800 Da, and 25,304 Da+glycosylation, respectively. These IgG fragments have usually been monitored by low resolution gel electrophoresis.

[0036] Plasmin is usually associated with the breakdown of fibrin clots. However, IgG cleavage in vivo by plasmin is associated with activation of the complement system via Fc fragments. Here, the accurate molecular mass of Fc and Fab fragments coupled with top-down MS was used to identify plasmin activity in patient serum.

Methods

[0037] The Fc and Fab portions of plasmin cleaved IgG were identified by LC retention time, accurate molecular mass, and top-down MS.

[0038] Sample Prep:

[0039] A volume of 20 L of serum was enriched for immunoglobulins using 180 L of Melon Gel following the manufacturer's instructions. After immunoglobulin enrichment 20 L of sample was reduced by adding 20 L of 100 mM DTT and 20 L of 50 mM ammonium bicarbonate then incubated at 55 C. for 30 minutes. Ides enzyme was purchased from Promega and used as directed.

[0040] LC Method:

[0041] An Eksigent Ekspert 200 microLC was used for separation; mobile phase A consisted of water+0.1% FA, and mobile phase B consisted of 90% acetonitrile+10% 2-propanol+0.1% FA. A 2 L injection was made onto a 1.075 mm Poroshell 300SB-C3 column with 5 m particle size flowing at 25 L/minute while the column was heated at 60 C. A 25 minute gradient starting at 80% A 20% B was used.

[0042] ESI-Q-TOF MS:

[0043] Spectra were collected on an ABSciex Triple-TOF 5600 quadrupole time-of-flight mass spectrometer (SCIEX, ON,CA) run in ESI positive mode with a Turbo V dual ion source Source conditions were: IS: 5500, Temp: 500, CUR: 45, GS1: 35, GS2: 30, CE: 505. TOF MS scans were acquired from m/z 600-2500 with an acquisition time of 100 ms. Data Analysis: Analyst TF v1.6 was used for instrument control. Data were viewed using Analyst TF v1.6 and PeakView v1.2.0.3. Deconvolution of multiply charged light chain ions was done using the Bayesian Protein Reconstruct program in BioAnalyst.

Results

[0044] IdeS cleaved serum was analyzed by MS (FIG. 3). Analysis of a large set of serum samples revealed patients with IgG related proteins in their sera having LC retention times, ESI charge state distributions, and molecular masses similar to those observed in IgG cleaved with the enzyme IdeS. Further investigation into the origin of these proteins led to the finding that their accurate molecular mass was the same as that expected from the cleavage of IgG by the endogenous serine protease plasmin (FIG. 4). A summed mass spectra for serum with suspected plasmin cleavage (FIG. 4B) are similar to spectra observed for normal serum treated with IdeS (FIG. 3C). The most abundant peak in the IdeS Fc spectrum and the patient's spectrum differ by the molecular mass of the amino acids between the cleavage sites of plasmin and IdeS.

[0045] The sequence of the presumed Fc fragments in FIG. 4 was confirmed as THTCPPCPAPEL (SEQ ID NO:2) using top-down MS (FIG. 5). The b-ions observed confirm that plasmin generated the IgG Fc fragments in this patient's serum. A summed mass spectra for patient serum with plasmin cleavage (FIG. 6) differs from spectra observed for normal serum treated with IdeS (FIG. 3D). The different distributions represent the patient's individual variable region repertoire for heavy chains and light chains. The Fa portions of the plasmin generated fragments containing the IgG heavy chain variable region had a single molecular mass distribution consistent with the observation that the Fb portion containing the light chain had both kappa and lambda isotype distributions (FIG. 6).

[0046] Multiple patient sera with the same Fc fragments were overlaid (FIG. 7), and were found to have identical top-down MS spectra demonstrating that plasmin enzymatic activity was conserved. The overlay also illustrates the ability of the mass spectrometer to readily identify different Fc glycoforms present in each individual patient.

Other Embodiments

[0047] It is to be understood that while the disclosure has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the disclosure, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.