IMPLANTABLE SCAFFOLDS AND USES THEREOF FOR IMMUNOTHERAPY AND OTHER USES
20220403026 · 2022-12-22
Assignee
Inventors
- Manish J. BUTTE (Los Angeles, CA, US)
- Mohammad Mahdi Hasani-Sadrabadi (Los Angeles, CA)
- Fatemeh S. MAJEDI (Los Angeles, CA, US)
Cpc classification
A61K9/0021
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2039/545
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
C07K16/2809
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
An implantable or injectable scaffold comprising immunostimulatory compounds and a suppressor of regulatory T cell induction is provided for use in immunotherapy treatments, including the treatment of cancers and other tumors, in particular solid tumors including inoperable tumors, as well as for other applications of immune enhancement and/or suppression.
Claims
1. A porous scaffold comprising: (a) at least one compound that regulates T cell immune response; and (b) at least one compound that regulates induction of regulatory T cells (Tregs).
2. The porous scaffold of claim 1, wherein the at least one compound that regulates T cell immune response comprises a T cell immunostimulatory compound or a T cell immunosuppression compound.
3. The porous scaffold of claim 2, wherein the at least one compound that regulates T cell immune response comprises a T cell immunostimulatory compound and the at least one compound that regulates induction of Tregs comprises a compound that suppresses induction of Tregs.
4. The porous scaffold of claim 2, wherein the T cell immunostimulatory compound comprises a T cell activator, a T cell attractant or a T cell adhesion compound.
5. The porous scaffold of claim 2, wherein the T cell immunostimulatory compound comprises a cytokine, a therapeutic or diagnostic protein, a growth factor, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, a thrombolytic, a peptide, an oligonucleotide, a nucleic acid, a chemokine ligand, or an anti-cluster of differentiation (anti-CD) antibody or fragment thereof.
6. The porous scaffold of claim 5, wherein the cytokine comprises an interleukin.
7. The porous scaffold of claim 1, wherein the T cell immunostimulatory compound comprising interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-10 (IL-10), interleukin-12 (IL-12), interleukin-15 (IL-15), IL-2 superkine, chemokine (C-C motif) ligand 21 (CCL21), anti-CD3 or anti-CD28, or any combination thereof.
8. The porous scaffold of claim 7, wherein the IL-2 superkine comprises the sequence as set forth in SEQ ID NO: 3.
9. The porous scaffold of claim 2, wherein the at least one compound that regulates T cell immune response comprises a T cell immunosuppression compound and the at least one compound that regulates induction of Tregs comprises a compound that induces Tregs.
10. The porous scaffold of claim 9, wherein the T cell immunosuppression compound comprises stromal cell-derived factor 1a (SDF-1a).
11. The porous scaffold of claim 5, wherein the growth factor comprises transforming growth factor-beta (TGF-β), vascular endothelial growth factor (VEGF), or bone morphogenetic protein-2 (BMP-2).
12. The porous scaffold of claim 1, further comprising IL-2, IL-4 and TGF-β.
13. The porous scaffold of claim 1, wherein the at least one compound that regulates induction of regulatory T cells is released slowly from the scaffold.
14. The porous scaffold of claim 1, wherein the at least one compound that regulates induction of regulatory T cells is selected from the group consisting of a compound that suppresses induction of regulatory T cells and a compound that induces regulatory T cells.
15. The porous scaffold of claim 12, wherein the compound that suppresses induction or regulatory T cells is an inhibitor of transforming growth factor-beta (TGF-β).
16. The porous scaffold of claim 15, wherein the inhibitor of TGF-β is a TGF-β receptor inhibitor.
17. The porous scaffold of claim 15, wherein the inhibitor of TGF-β is galinusertib (LY2157299) or SB505124.
18. The porous scaffold of claim 13, wherein the compound that induces regulatory T cells is a TGF-β or an activator thereof or an IL-2.
19. The porous scaffold of claim 1, wherein the at least one compound that regulates T cell immune response is bound to heparin.
20. The porous scaffold of claim 19, wherein the heparin is bound to one or more microparticles embedded in the scaffold.
21. The porous scaffold of claim 20, wherein the one or more microparticles comprise one or more silica microparticles.
22. The porous scaffold of claim 21, wherein the heparin is provided at about 2 nanomols per milligram (nmol/mg) of silica.
23. The porous scaffold of claim 21, wherein the one or more silica microparticles are about 3 microns (μm) to about 25 microns (μm).
24. The porous scaffold of claim 21, wherein the silica is mesoporous silica.
25. The porous scaffold of claim 21, wherein the loading of the one or more silica microparticles by the at least one compound that regulates T cell immune response is increased by the bound heparin.
26. The porous scaffold of claim 21, wherein the release of the at least one compound that regulates T cell immune response from the one or more silica microparticles is reduced by the bound heparin.
27. The porous scaffold of claim 21, wherein the one or more silica microparticles persist in vivo for at least 15-20 days.
28. The porous scaffold of claim 1, further comprising one or more nanoparticles.
29. The porous scaffold of claim 28, wherein the one or more nanoparticles comprise poly(lactic-co-glycolic acid) (PLGA).
30. The porous scaffold of claim 28, wherein the one or more nanoparticles are bound to the at least one compound that regulates induction of regulatory T cells.
31. The porous scaffold of claim 1, wherein the scaffold is biocompatible or biodegradable.
32. The porous scaffold of claim 1 wherein the scaffold comprises a polymer comprising alginate, hyaluronic acid and chitosan, or any combination thereof.
33. The porous scaffold of claim 32, wherein the polymer comprises an arginine-glycine-aspartate (RGD) peptide.
34. The porous scaffold of claim 33, wherein the sequence of the RGD peptide is SEQ ID NO: 1.
35. The porous scaffold of claim 1, wherein the porous scaffold comprises pores of from about 1 nm to about 7 nm.
36. The porous scaffold of claim 1, wherein the scaffold is provided to be surgically implantable or injectable or administrable through a catheter.
37. The porous scaffold of claim 1, further comprising one or more immune cells.
38. The porous scaffold of claim 37, wherein the one or more immune cells comprise T cells.
39. The porous scaffold of claim 38, wherein the T cells comprise wild-type or transgenic, murine or human, CD4+/CD8+ T cells.
40. The porous scaffold of claim 38, wherein the T cells are chimeric antigen receptor T cells (CAR-T cells).
41. The porous scaffold of claim 1, wherein anti-CD3 or anti-CD28 antibodies are covalently bound to the polymer.
42. The porous scaffold of claim 1, comprising an alginate-RGD polymer comprising one or more silica-heparin microparticles bound to IL-2, anti-CD3 and anti-CD28; one or more PLGA nanoparticles comprising a TGF-β inhibitor; and anti-CD3 and anti-CD28 antibodies covalently bound to said alginate-RGD polymer.
43. A method of regulating an immune response to a disease or medical condition or symptoms thereof, at a focus of interest in a subject in need, said method comprising providing a porous scaffold at a site at or near a site of said focus of interest, the porous scaffold comprising: (a) at least one compound that regulates T cell immune response; and (b) at least one compound that regulates induction of regulatory T cells (Tregs).
44. The method of claim 43, wherein the compound that regulates T cell immune response comprises a T cell immunostimulatory compound or a T cell immunosuppression compound.
45. The method of claim 3, wherein the T cell immunostimulatory compound comprises a T cell activator, a T cell attractant or a T cell adhesion compound.
46. The method of claim 44, wherein the T cell immunostimulatory compound comprises a cytokine, a therapeutic or diagnostic protein, a growth factor, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, a thrombolytic, a peptide, an oligonucleotide, a nucleic acid, a chemokine ligand, or an anti-cluster of differentiation (anti-CD) antibody or fragment thereof.
47. The method of any one of claim 44, wherein the T cell immunostimulatory compound is interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-10 (IL-10), interleukin-12 (IL-12), interleukin-15 (IL-15), IL-2 superkine, chemokine (C-C motif) ligand 21 (CCL21), anti-CD3 or anti-CD28, or any combination thereof.
48. The method of claim 47, wherein the IL-2 superkine comprises the sequence as set forth in SEQ ID NO: 3.
49. The method of claim 44, wherein the T cell immunosuppression compound comprises a cytokine, a growth factor, or small molecule.
50. The method of claim 43, where the at least one compound that regulates induction of regulatory T cells is released slowly from the scaffold.
51. The method of claim 43, wherein the at least one compound that regulates induction of regulatory T cells comprises a compound that suppresses induction of regulatory T cells or a compound that induces regulatory T cells.
52. The method of claim 51, wherein the compound that suppresses induction of regulatory T cells is an inhibitor of transforming growth factor-beta (TGF-β).
53. The method of claim 52, wherein the inhibitor of TGF-β is a TGF-β receptor inhibitor.
54. The method of claim 52, wherein the inhibitor is galinusertib (LY2157299) or SB505124.
55. The method of claim 51, wherein the compound that induces regulatory T cells is a TGF-β, VEGF, and IL-2 or an activator thereof.
56. The method of claim 43, wherein: (a) the disease or medical condition comprises a tumor, a suspected tumor, or a resected tumor; and (b) the porous scaffold is provided at or adjacent to a focus of interest comprising said tumor, suspected tumor, or resected tumor.
57. The method of claim 54, wherein the tumor is a solid tumor.
58. The method of claim 56, wherein said tumor, suspected tumor, or resected tumor comprises a cancerous, pre-cancerous, or non-cancerous tumor.
59. The method of claim 56, wherein said tumor comprising a sarcoma or a carcinoma, a fibrosarcoma, a myxosarcoma, a liposarcoma, a chondrosarcoma, an osteogenic sarcoma, a chordoma, an angiosarcoma, an endotheliosarcoma, a lymphangiosarcoma, a lymphangioendotheliosarcoma, a synovioma, a mesothelioma, an Ewing's tumor, a leiomyosarcoma, a rhabdomyosarcoma, a colon carcinoma, a pancreatic cancer or tumor, a breast cancer or tumor, an ovarian cancer or tumor, a prostate cancer or tumor, a squamous cell carcinoma, a basal cell carcinoma, an adenocarcinoma, a sweat gland carcinoma, a sebaceous gland carcinoma, a papillary carcinoma, a papillary adenocarcinomas, a cystadenocarcinoma, a medullary carcinoma, a bronchogenic carcinoma, a renal cell carcinoma, a hepatoma, a bile duct carcinoma, a choriocarcinoma, a seminoma, an embryonal carcinoma, a Wilm's tumor, a cervical cancer or tumor, a uterine cancer or tumor, a testicular cancer or tumor, a lung carcinoma, a small cell lung carcinoma, a bladder carcinoma, an epithelial carcinoma, a glioma, an astrocytoma, a medulloblastoma, a craniopharyngioma, an ependymoma, a pinealoma, a hemangioblastoma, an acoustic neuroma, an oligodendroglioma, a schwannoma, a meningioma, a melanoma, a neuroblastoma, or a retinoblastoma, esophageal cancer, pancreatic cancer, metastatic pancreatic cancer, metastatic adenocarcinoma of the pancreas, bladder cancer, stomach cancer, fibrotic cancer, glioma, malignant glioma, diffuse intrinsic pontine glioma, recurrent childhood brain neoplasm renal cell carcinoma, clear-cell metastatic renal cell carcinoma, kidney cancer, prostate cancer, metastatic castration resistant prostate cancer, stage IV prostate cancer, metastatic melanoma, melanoma, malignant melanoma, recurrent melanoma of the skin, melanoma brain metastases, stage IIIA skin melanoma; stage IIIB skin melanoma, stage IIIC skin melanoma; stage IV skin melanoma, malignant melanoma of head and neck, lung cancer, non-small cell lung cancer (NSCLC), squamous cell non-small cell lung cancer, breast cancer, recurrent metastatic breast cancer, hepatocellular carcinoma, Hodgkin's lymphoma, follicular lymphoma, non-Hodgkin's lymphoma, advanced B-cell NHL, HL including diffuse large B-cell lymphoma (DLBCL), multiple myeloma, chronic myeloid leukemia, adult acute myeloid leukemia in remission; adult acute myeloid leukemia with Inv(16)(p13.1q22); CBFB-MYH11; adult acute myeloid leukemia with t(16;16)(p13.1;q22); CBFB-MYH11; adult acute myeloid leukemia with t(8;21)(q22;q22); RUNX1-RUNXJTJ; adult acute myeloid leukemia with t(9;11)(p22;q23); MLLT3-MLL; adult acute promyelocytic leukemia with t(15;17)(q22;q12); PML-RARA; alkylating agent-related acute myeloid leukemia, chronic lymphocytic leukemia, Richter's syndrome; Waldenstrom's macroglobulinemia, adult glioblastoma; adult gliosarcoma, recurrent glioblastoma, recurrent childhood rhabdomyosarcoma, recurrent Ewing sarcoma/peripheral primitive neuroectodermal tumor, recurrent neuroblastoma; recurrent osteosarcoma, colorectal cancer, MSI positive colorectal cancer; MSI negative colorectal cancer, nasopharyngeal nonkeratinizing carcinoma; recurrent nasopharyngeal undifferentiated carcinoma, cervical adenocarcinoma; cervical adenosquamous carcinoma; cervical squamous cell carcinoma; recurrent cervical carcinoma; stage IVA cervical cancer; stage IVB cervical cancer, anal canal squamous cell carcinoma; metastatic anal canal carcinoma; recurrent anal canal carcinoma, recurrent head and neck cancer; carcinoma, squamous cell of head and neck, head and neck squamous cell carcinoma (HNSCC), ovarian carcinoma, colon cancer, gastric cancer, advanced GI cancer, gastric adenocarcinoma; gastroesophageal junction adenocarcinoma, bone neoplasms, soft tissue sarcoma; bone sarcoma, thymic carcinoma, urothelial carcinoma, recurrent Merkel cell carcinoma; stage III Merkel cell carcinoma; stage IV Merkel cell carcinoma, myelodysplastic syndrome and recurrent mycosis fungoides and Sezary syndrome.
60. The method of claim 6, wherein at the site, T cells are stimulated to target the tumor, suspected tumor, or resected tumor, and the induction of Tregs is suppressed.
61. The method of claim 56, wherein: (a) the disease or medical condition comprises a primary tumor, a suspected primary tumor, or a resected primary tumor; (b) the porous scaffold is provided at or adjacent to the focus of interest comprising said primary tumor, suspected primary tumor, or resected primary tumor; (c) the subject has at least one secondary tumor, suspected secondary tumor, or resected secondary tumor; and (d) T cells are stimulated to target the at least one secondary tumor, suspected secondary tumor, or resected secondary tumor.
62. The method of claim 56, wherein said treating reduces the size of the tumor, eliminates said tumor, slows the growth or regrowth of the tumor, slows the growth or regrowth of a secondary tumor, or prolongs survival of said subject, or any combination thereof.
63. The method of claim 43, wherein at the site, T cells are stimulated to target the focus of interest, and the induction of Tregs is suppressed.
64. The method of claim 43, wherein at the site, T cells are suppressed at or near the focus of interest, and Tregs are induced.
65. The method of claim 43, wherein the porous scaffold is surgically implanted or inserted or administered through a catheter at or near the focus of interest.
66. The method of claim 43, wherein: (a) the disease or medical condition comprises an autoimmune disease, and the porous scaffold is provided at or adjacent to a focus of interest comprising an autoimmune-targeted or symptomatic focus of said autoimmune disease; (b) the disease or medical condition comprises an allergic reaction or hypersensitivity reaction, and the porous scaffold is provided at or adjacent to a focus of interest comprising a reactive focus of said allergic reaction or hypersensitivity reaction; (c) the disease or medical condition comprises a localized infection or an infectious disease, and the porous scaffold is provided at or adjacent to a focus of interest comprising a focus of infection or symptoms; (d) the disease or medical condition comprises an injury or a site of chronic damage, and the porous scaffold is provided at or adjacent to a focus of interest comprising the injury or the site of chronic damage; (e) the disease or medical condition comprises a surgical site, and the porous scaffold is provided at or adjacent to a focus of interest comprising the surgical site; (f) the disease or medical condition comprises a transplanted organ, tissue, or cell, and the porous scaffold is provided at or adjacent to a focus of interest comprising a transplant site; or (g) the disease or medical condition comprises a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism, and the porous scaffold is provided at or adjacent to a focus of interest comprising the site of the blood clot.
67. The method of claim 66, wherein said treating: (a) reduces or eliminates inflammation or another symptom of said autoimmune-targeted or symptomatic focus of said autoimmune disease, prolongs survival of said subject, or any combination thereof; (b) reduces or eliminates inflammation or another symptom of allergic reaction or hypersensitivity reaction at said reactive focus of said allergic reaction or hypersensitivity reaction, prolongs survival of said subject, or any combination thereof; (c) reduces or eliminates infection or symptoms at said focus of infection or symptoms of said localized infection or infectious disease, prolongs survival of said subject, or any combination thereof; (d) reduces, eliminates, inhibits or prevents structural, organ, tissue, or cell damage, inflammation, infection, or another symptom at said site of injury or said site of chronic damage, improves structural, organ, tissue, or cell function at said site of injury or said site of chronic damage, improves mobility of said subject, prolongs survival of said subject, or any combination thereof; (e) reduces, eliminates, inhibits, or prevents structural, organ, tissue, or cell damage, inflammation, infection, or another symptom at said surgical site, improves structural, organ, tissue, or cell function at said surgical site, improves mobility of said subject, prolongs survival of said subject, or any combination thereof; (f) reduces, eliminates, inhibits or prevents transplanted organ, tissue, or cell damage or rejection, inflammation, infection or another symptom at said transplant site, improves mobility of said subject, prolongs survival of said transplanted organ, tissue, or cell, prolongs survival of said subject, or any combination thereof; or (g) reduces or eliminates said blood clot causing or at risk for causing said myocardial infarction, said ischemic stroke, or said pulmonary embolism in said subject, improves function or survival of a heart, brain, or lung organ, tissue, or cell in said subject, reduces damage to a heart, brain, or lung organ, tissue, or cell in said subject, prolongs survival of a heart, brain, or lung organ, tissue, or cell in said subject, prolongs survival of said subject, or any combination thereof.
68. The method of claim 67, wherein said disease or medical condition comprises a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism, and said porous scaffold is provided at or adjacent to a focus of interest comprising the site of the blood clot together with angioplasty or another clot removal treatment.
69. A method of making a porous biocompatible or biodegradable scaffold for regulating an immune response at a focus of interest in a subject in need, the method comprising: (a) providing a porous scaffold comprising a polymer: (b) embedding in the scaffold one or more microparticles or one or more nanoparticles: (i) the one or more microparticles bound to heparin, and the heparin bound to at least one compound that regulates T cell immune response; (ii) the one or more nanoparticles bound to at least one compound that regulates induction of regulatory T cells (Tregs); or (iii) the scaffold bound to heparin; or (iv) a combination thereof.
70. The method of claim 69, the porous biocompatible or biodegradable scaffold comprising a polymer comprising alginate, hyaluronic acid, chitosan, or a combination thereof, or an arginine-glycine-aspartate (RGD) peptide, or an alginate-RGD polymer; the one or more microparticles comprising silica-heparin; or the one or more nanoparticles comprising poly(lactic-co-glycolic acid) (PLGA).
71. The method of claim 69, the porous biocompatible or biodegradable scaffold further comprising one or more immune cells.
72. The method of claim 69, the porous biocompatible or biodegradable scaffold further comprising anti-CD3 or anti-CD28 antibodies covalently bound to the polymer.
73. The method of claim 69, the at least one compound that regulates T cell immune response comprising a T cell immunostimulatory compound comprising a cytokine, a therapeutic or diagnostic protein, a growth factor, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, a thrombolytic, a peptide, a chemokine ligand, or an anti-cluster of differentiation (anti-CD) antibody or fragment thereof, interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-10 (IL-10), interleukin-12 (IL-12), interleukin-15 (IL-15), IL-2 superkine, chemokine (C-C motif) ligand 21 (CCL21), anti-CD3 or anti-CD28, or any combination thereof; or the at least one compound that regulates induction of regulatory T cells (Tregs) comprising a compound that suppresses induction of Tregs comprising galinusertib (LY2157299), SB505124, or another transforming growth factor-beta (TGF-β) inhibitor.72.
74. The method of claim 71, wherein the IL-2 superkine comprises the sequence as set forth in SEQ ID NO: 3.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0039] The subject matter regarded as the invention is particularly pointed out and distinctly claimed in the concluding portion of the specification. The invention, however, both as to organization and method of operation, together with objects, features, and advantages thereof, may best be understood by reference to the following detailed description when read with the accompanying drawings in which:
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
DETAILED DESCRIPTION OF THE INVENTION
[0106] The present subject matter may be understood more readily by reference to the following detailed description which forms a part of this disclosure. It is to be understood that this invention is not limited to the specific products, methods, conditions or parameters described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed invention.
[0107] In the following detailed description, numerous specific details are set forth in order to provide a thorough understanding of implantable scaffolds and microparticles, and the uses thereof. However, it will be understood by those skilled in the art that the production of these implantable scaffolds and microparticles and uses thereof may be practiced without these specific details. In other instances, well-known methods, procedures, and components have not been described in detail so as not to obscure their description.
[0108] Provided herein is a multifunctional biomaterial that is placed adjacent to a tumor and which attracts and potentiates cytotoxic T cells and suppresses local regulatory T cells. Together these activities allow for the much sought-after materials and methods for overcoming the immunosuppressive effects of the microenvironment of solid tumors.
[0109] Additionally, provided herein is a multifunctional biomaterial placed in a treatment area to deliver compositions treating localized symptoms of, for example, but not limited to, infectious and non-infectious medical conditions, injuries, damage, surgery, and transplant, where most needed in the treatment of localized conditions or symptoms, while avoiding systemic exposure to immunomodulatory agents.
[0110] Provided herein is a platform that holds the key to solve the above-mentioned challenges by offering a “synthetic lymph node” niche proximally to the tumor for supporting transferred T cells while enhancing their infiltration and cytotoxic capabilities. In some embodiments, this implantable, porous synthetic lymph node serves as a home for the recruitment of endogenous tumor resident T cells and provides them with the activation clues while fortifying them with necessary cytokines/chemokines at controlled rates. The mechanical stiffness of the biomaterial is optimized to mimic that of lymph nodes, including, but not limited to, serving as a home to T cells, e.g., for ACT purposes or for tumor resident T cells to obtain the required training against tumor cells, and facilitates their fight by increasing their number via proliferation signals and blocking the formation of suppressor T cells locally. This flexible platform holds high promises for localized immunomodulation and treatment of, e.g., cancers or other types of tumors.
[0111] Also provided herein is a platform for developed in situ lymphocyte (ISL) therapy, demonstrating potency in enhancing therapeutic efficacy of adoptive T cell therapy (ACT). ACT has been shown to hold high promises for many cancers including melanoma. Though its potency is limited by the inadequate T cell expansion in the tumor's suppressive microenvironment plus poor trafficking of tumor recognizing T cells to the tumor site. Thus, localization of trained T cells adjacent to the tumor while providing a niche that enhances their proliferation can overcome the main problems associated with ACT. Moreover, suppression of Treg in the tumor microenvironment can boost the therapeutic effects.
[0112] In some aspects, a porous scaffold is provided comprising at least one compound that regulates T cell immune response; and at least one compound that regulates induction of regulatory T cells (Tregs).
[0113] In some embodiments, the compound that regulates T cell immune response comprises a T cell immunostimulatory compound or a T cell immunosuppression compound.
[0114] In some embodiments, the at least one compound that regulates T cell immune response comprises a T cell immunostimulatory compound and the at least one compound that regulates induction of Tregs comprises a compound that suppresses induction of Tregs. In some embodiments, the T cell immunostimulatory compound is a T cell activator, a T cell attractant or a T cell adhesion compound. In some embodiments, the T cell immunostimulatory compound comprises a cytokine, a therapeutic or diagnostic protein, a growth factor, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, a thrombolytic, a peptide, an oligonucleotide, a nucleic acid, a chemokine ligand, or an anti-cluster of differentiation (anti-CD) antibody or fragment thereof. In some embodiments, the cytokine comprises an interleukin (IL). In some embodiments, the T cell immunostimulatory compound comprises interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-10 (IL-10), interleukin-12 (IL-12), interleukin-15 (IL-15), IL-2 superkine, chemokine (C-C motif) ligand 21 (CCL21), anti-cluster of differentiation 3 (anti-CD3), or anti-cluster of differentiation 28 (anti-CD28), or any combination thereof.
[0115] In some embodiments, the at least one compound that regulates T cell immune response comprises a T cell immunosuppression compound and the at least one compound that regulates induction of Tregs comprises a compound that induces Tregs. In some embodiments, the T cell immunosuppression compound comprises stromal cell-derived factor 1a (SDF-1a). In some embodiments, the growth factor comprises transforming growth factor-beta (TGF-β), vascular endothelial growth factor (VEGF), or bone morphogenetic protein-2 (BMP-2). In some embodiments, the scaffolds comprises IL-2, IL-4 and TGF-β.
[0116] In some embodiments, the compound that suppresses induction of Tregs comprises a TGF-β inhibitor. In some embodiments, the TGF-β inhibitor is a TGF-β receptor inhibitor. In some embodiments, the TGF-β inhibitor is galinusertib (LY2157299) or SB505124. In other embodiments, the at least one compound that regulates induction of Tregs comprises a compound that induces Tregs. In some embodiments, the compound that induces Tregs is a TGF-β or an activator thereof.
[0117] Compounds that suppression induction of Tregs include, but are not limited to, inhibitors of transforming growth factor-beta (TGF-β), such as an inhibitor of the TGF-β receptor. Non-limiting examples of TGF-β receptor inhibitors include galinusertib (LY2157299), SB505124, small molecule inhibitors, antibodies, chemokines, apoptosis signals (e.g., cytotoxic T-lymphocyte-associated protein 4/programmed cell death protein 1 (CTLA-4/PD-1); Granzyme; tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL); Fas/Fas-L, Galectin-9/transmembrane immunoglobulin and mucin domain 3 (TIM-3)). Compounds that induce Tregs include TGF-β and activators thereof (e.g., SB 431542, A 83-01, RepSox, LY 364947, D 4476, SB 525334, GW 788388, SD 208, R 268712, IN 1130, SM 16, A 77-01, AZ 12799734).
[0118] In some embodiments, the at least one compound that regulates induction of regulatory T cells is released slowly from the scaffold.
[0119] In some embodiments, the at least one compound that regulates induction of regulatory T cells comprises a compound that suppresses induction of regulatory T cells or a compound that induces regulatory T cells.
[0120] In some embodiments, the compound that suppresses induction of regulatory T cells is an inhibitor of transforming growth factor-beta (TGF-β), such as a TGF-β receptor inhibitor. In some embodiments, the inhibitor is galinusertib (LY2157299) or SB505124.
[0121] In another related aspect, one or more of the compounds comprises a therapeutic or diagnostic protein. In another related aspect, one or more of the compounds comprises a cytokine, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, or a thrombolytic. In another related aspect, the cytokine comprises an interleukin. In another related aspect, the interleukin comprises an IL-2, interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-10 (IL-10), an IL-12, or an IL-15. In yet another related aspect, a cytokine may include a human cytokine. In still another related aspect, an IL-2 cytokine comprises an IL-2 superkine. In some embodiments, the IL-2 superkine comprises the sequence as set forth in SEQ ID NO: 3.
[0122] In some embodiments, the at least one compound that regulates T cell immune response is bound to heparin. In some embodiments, the heparin is bound to one or more microparticles embedded in the scaffold. In some embodiments, the one or more microparticles comprise one or more silica microparticles. In some embodiments, the heparin is provided at about 2 nanomols per milligram (nmol/mg) of silica. In some embodiments, the one or more silica microparticles are about 3 microns (μm) to about 25 microns (μm). In some embodiments, the silica is mesoporous silica. In some embodiments, the loading of the one or more silica microparticles by the at least one compound that regulates T cell immune response is increased by the bound heparin. In some embodiments, the release of the at least one compound that regulates T cell immune response from the one or more silica microparticles is reduced by the bound heparin. In some embodiments, the silica microparticles persist in vivo for at least 15-20 days.
[0123] In some embodiments, the porous scaffold further comprises one or more nanoparticles. In some embodiments, the nanoparticles comprise poly(lactic-co-glycolic acid) (PLGA). In some embodiments, the nanoparticles are bound to the at least one compound that regulates induction of regulatory T cells.
[0124] In some embodiments, the scaffold is biocompatible or biodegradable. In some embodiments, the scaffold comprises a polymer selected from alginate, hyaluronic acid and chitosan, or any combination thereof. In some embodiments, the polymer comprises an arginine-glycine-aspartate (RGD) peptide. In some embodiments, the porous scaffold comprises pores of from about 1 to about 7 nm.
[0125] In some embodiments, the scaffold is provided to be surgically implantable or injectable or administrable through a catheter. In some embodiments, the scaffold further comprises one or more immune cells. In some embodiments, the one or more immune cells are T cells. In some embodiments, the T cells comprise wild-type and transgenic, murine and human CD4+ and CD9* T cells. In some embodiments, the T cells are chimeric antigen receptor T cells (CAR-T cells). In some embodiments, anti-CD3 or anti-CD28 antibodies are covalently bound to the polymer.
[0126] In some embodiments, the porous scaffold comprises an alginate-RGD polymer comprising silica-heparin microparticles bound to IL-2, anti-CD3 and anti-CD28, PLGA nanoparticles comprising a TGF-β inhibitor, and anti-CD3 and anti-CD28 antibodies covalently bound to the alginate-RGD polymer.
[0127] In some aspects, a method is provided of regulating an immune response to a disease or medical condition or symptoms thereof, at a focus of interest in a subject in need, the method comprising providing a porous scaffold at a site at or near a site of the focus of interest, the porous scaffold comprising at least one compound that regulates T cell immune response and at least one compound that regulates induction of regulatory T cells (Tregs).
[0128] In some embodiments, the disease or medical condition comprises a tumor, a suspected tumor, or a resected tumor and the porous scaffold is provided at or adjacent to a focus of interest comprising the tumor, suspected tumor, or resected tumor.
[0129] In some embodiments, the tumor is a solid tumor. In some embodiments, the tumor, suspected tumor, or resected tumor comprises a cancerous, pre-cancerous, or non-cancerous tumor. In some embodiments, the tumor comprises a sarcoma or a carcinoma, a fibrosarcoma, a myxosarcoma, a liposarcoma, a chondrosarcoma, an osteogenic sarcoma, a chordoma, an angiosarcoma, an endotheliosarcoma, a lymphangiosarcoma, a lymphangioendotheliosarcoma, a synovioma, a mesothelioma, an Ewing's tumor, a leiomyosarcoma, a rhabdomyosarcoma, a colon carcinoma, a pancreatic cancer or tumor, a breast cancer or tumor, an ovarian cancer or tumor, a prostate cancer or tumor, a squamous cell carcinoma, a basal cell carcinoma, an adenocarcinoma, a sweat gland carcinoma, a sebaceous gland carcinoma, a papillary carcinoma, a papillary adenocarcinomas, a cystadenocarcinoma, a medullary carcinoma, a bronchogenic carcinoma, a renal cell carcinoma, a hepatoma, a bile duct carcinoma, a choriocarcinoma, a seminoma, an embryonal carcinoma, a Wilm's tumor, a cervical cancer or tumor, a uterine cancer or tumor, a testicular cancer or tumor, a lung carcinoma, a small cell lung carcinoma, a bladder carcinoma, an epithelial carcinoma, a glioma, an astrocytoma, a medulloblastoma, a craniopharyngioma, an ependymoma, a pinealoma, a hemangioblastoma, an acoustic neuroma, an oligodendroglioma, a schwannoma, a meningioma, a melanoma, a neuroblastoma, or a retinoblastoma, esophageal cancer, pancreatic cancer, metastatic pancreatic cancer, metastatic adenocarcinoma of the pancreas, bladder cancer, stomach cancer, fibrotic cancer, glioma, malignant glioma, diffuse intrinsic pontine glioma, recurrent childhood brain neoplasm renal cell carcinoma, clear-cell metastatic renal cell carcinoma, kidney cancer, prostate cancer, metastatic castration resistant prostate cancer, stage IV prostate cancer, metastatic melanoma, melanoma, malignant melanoma, recurrent melanoma of the skin, melanoma brain metastases, stage IIIA skin melanoma; stage IIIB skin melanoma, stage IIIC skin melanoma; stage IV skin melanoma, malignant melanoma of head and neck, lung cancer, non-small cell lung cancer (NSCLC), squamous cell non-small cell lung cancer, breast cancer, recurrent metastatic breast cancer, hepatocellular carcinoma, Hodgkin's lymphoma, follicular lymphoma, non-Hodgkin's lymphoma, advanced B-cell NHL, HL including diffuse large B-cell lymphoma (DLBCL), multiple myeloma, chronic myeloid leukemia, adult acute myeloid leukemia in remission; adult acute myeloid leukemia with Inv(16)(p13.1q22); CBFB-MYH11; adult acute myeloid leukemia with t(16;16)(p13.1;q22); CBFB-MYH11; adult acute myeloid leukemia with t(8;21)(q22;q22); RUNX1-RUNX1T1; adult acute myeloid leukemia with t(9;11)(p22;q23); MLLT3-MLL; adult acute promyelocytic leukemia with t(15;17)(q22;q12); PML-RARA; alkylating agent-related acute myeloid leukemia, chronic lymphocytic leukemia, Richter's syndrome; Waldenstrom's macroglobulinemia, adult glioblastoma; adult gliosarcoma, recurrent glioblastoma, recurrent childhood rhabdomyosarcoma, recurrent Ewing sarcoma/peripheral primitive neuroectodermal tumor, recurrent neuroblastoma; recurrent osteosarcoma, colorectal cancer, MSI positive colorectal cancer; MSI negative colorectal cancer, nasopharyngeal nonkeratinizing carcinoma; recurrent nasopharyngeal undifferentiated carcinoma, cervical adenocarcinoma; cervical adenosquamous carcinoma; cervical squamous cell carcinoma; recurrent cervical carcinoma; stage IVA cervical cancer; stage IVB cervical cancer, anal canal squamous cell carcinoma; metastatic anal canal carcinoma; recurrent anal canal carcinoma, recurrent head and neck cancer; carcinoma, squamous cell of head and neck, head and neck squamous cell carcinoma (HNSCC), ovarian carcinoma, colon cancer, gastric cancer, advanced GI cancer, gastric adenocarcinoma; gastroesophageal junction adenocarcinoma, bone neoplasms, soft tissue sarcoma; bone sarcoma, thymic carcinoma, urothelial carcinoma, recurrent Merkel cell carcinoma; stage III Merkel cell carcinoma; stage IV Merkel cell carcinoma, myelodysplastic syndrome and recurrent mycosis fungoides and Sezary syndrome. In some embodiments, at the site, T cells are stimulated to target the tumor, suspected tumor, or resected tumor, and the induction of Tregs is suppressed.
[0130] In some embodiments, said treating reduces the size of the tumor, eliminates the tumor, slows the growth or regrowth of the tumor, slows the growth or regrowth of a secondary tumor, or prolongs survival of said subject or any combination thereof.
[0131] In some embodiments, at the site, T cells are stimulated to target the focus of interest, and the induction of Tregs is suppressed. In other embodiments, at the site, T cells are suppressed at or near the focus of interest, and Tregs are induced.
[0132] In some embodiments, the disease or medical condition comprises an autoimmune disease, and the porous scaffold is provided at or adjacent to a focus of interest comprising an autoimmune-targeted or symptomatic focus of said autoimmune disease; the disease or medical condition comprises an allergic reaction or hypersensitivity reaction, and the porous scaffold is provided at or adjacent to a focus of interest comprising a reactive focus of said allergic reaction or hypersensitivity reaction; the disease or medical condition comprises a localized infection or an infectious disease, and the porous scaffold is provided at or adjacent to a focus of interest comprising a focus of infection or symptoms; the disease or medical condition comprises an injury or a site of chronic damage, and the porous scaffold is provided at or adjacent to a focus of interest comprising the injury or the site of chronic damage; the disease or medical condition comprises a surgical site, and the porous scaffold is provided at or adjacent to a focus of interest comprising the surgical site; the disease or medical condition comprises a transplanted organ, tissue, or cell, and the porous scaffold is provided at or adjacent to a focus of interest comprising a transplant site; or the disease or medical condition comprises a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism, and the porous scaffold is provided at or adjacent to a focus of interest comprising the site of the blood clot. In some embodiments, said treating reduces or eliminates inflammation or another symptom of said autoimmune-targeted or symptomatic focus of said autoimmune disease, prolongs survival of said subject, or any combination thereof; reduces or eliminates inflammation or another symptom of allergic reaction or hypersensitivity reaction at said reactive focus of said allergic reaction or hypersensitivity reaction, prolongs survival of said subject, or any combination thereof; reduces or eliminates infection or symptoms at said focus of infection or symptoms of said localized infection or infectious disease, prolongs survival of said subject, or any combination thereof; reduces, eliminates, inhibits or prevents structural, organ, tissue, or cell damage, inflammation, infection, or another symptom at said site of injury or said site of chronic damage, improves structural, organ, tissue, or cell function at said site of injury or said site of chronic damage, improves mobility of said subject, prolongs survival of said subject, or any combination thereof; reduces, eliminates, inhibits, or prevents structural, organ, tissue, or cell damage, inflammation, infection, or another symptom at said surgical site, improves structural, organ, tissue, or cell function at said surgical site, improves mobility of said subject, prolongs survival of said subject, or any combination thereof; reduces, eliminates, inhibits or prevents transplanted organ, tissue, or cell damage or rejection, inflammation, infection or another symptom at said transplant site, improves mobility of said subject, prolongs survival of said transplanted organ, tissue, or cell, prolongs survival of said subject, or any combination thereof; or reduces or eliminates said blood clot causing or at risk for causing said myocardial infarction, said ischemic stroke, or said pulmonary embolism in said subject, improves function or survival of a heart, brain, or lung organ, tissue, or cell in said subject, reduces damage to a heart, brain, or lung organ, tissue, or cell in said subject, prolongs survival of a heart, brain, or lung organ, tissue, or cell in said subject, prolongs survival of said subject, or any combination thereof. In some embodiments, the disease or medical condition comprises a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism, and the porous scaffold is provided at or adjacent to a focus of interest comprising the site of the blood clot together with angioplasty or another clot removal treatment.
[0133] In some aspects, a method is provided for stimulating T cells to target a solid tumor and for suppressing the induction of Tregs in a patient comprising providing the porous scaffold described herein at a site at or near a solid tumor, a suspected solid tumor or a resected solid tumor, the porous scaffold comprising at least one response cell immunostimulatory compound and at least one compound that suppresses induction of regulatory T cells (Tregs). In one embodiment, the tumor is an inoperable tumor.
[0134] In some aspects, a method is provided for regulating an immune response at a focus of interest in a subject in need, said method comprising providing a porous scaffold to the subject, at or near a site of the focus of interest, the porous scaffold comprising at least one compound that regulates T cell immune response; and at least one compound that regulates induction of regulatory T cells (Tregs), wherein regulating the immune response comprises increasing or decreasing proliferation of cytotoxic T cells; increasing or decreasing proliferation of helper T cells; maintaining, increasing, or decreasing the population of helper T cells at the site of said focus of interest; activating or suppressing cytotoxic T cells at the site of said focus of interest; or any combination thereof. In some aspects, a method is provided for treating a disease or medical condition, or alleviating symptoms thereof, at a focus of interest in a subject in need, said method comprising providing a porous scaffold at a site at or near a focus of interest, the porous scaffold comprising: at least one compound that regulates T cell immune response; and at least one compound that regulates induction of regulatory T cells (Tregs). In some embodiments, the compound that suppresses induction of Tregs comprises a TGF-β inhibitor. In some embodiments, the TGF-β inhibitor is a TGF-β receptor inhibitor. In some embodiments, the TGF-β inhibitor is galinusertib (LY2157299) or SB505124. In other embodiments, the at least one compound that regulates induction of Tregs comprises a compound that induces Tregs. In some embodiments, the compound that induces Tregs is a TGF-β or an activator thereof.
[0135] Compounds that suppression induction of Tregs include, but are not limited to, inhibitors of transforming growth factor-beta (TGF-β), such as an inhibitor of the TGF-β receptor. Non-limiting examples of TGF-β receptor inhibitors include galinusertib (LY2157299), SB505124, small molecule inhibitors, antibodies, chemokines, apoptosis signals (e.g., cytotoxic T-lymphocyte-associated protein 4/programmed cell death protein 1 (CTLA-4/PD-1); Granzyme; tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL); Fas/Fas-L, Galectin-9/transmembrane immunoglobulin and mucin domain 3 (TIM-3)). Compounds that induce Tregs include TGF-β and activators thereof (e.g., SB 431542, A 83-01, RepSox, LY 364947, D 4476, SB 525334, GW 788388, SD 208, R 268712, IN 1130, SM 16, A 77-01, AZ 12799734).
[0136] In another aspect, a method is provided herein for making a porous biocompatible or biodegradable scaffold for regulating an immune response at a focus of interest in a subject in need, the method comprising: providing a porous scaffold comprising a polymer: embedding in the scaffold one or more microparticles or one or more nanoparticles, the one or more microparticles bound to heparin, and the heparin bound to at least one compound that regulates T cell immune response; or the one or more nanoparticles bound to at least one compound that regulates induction of regulatory T cells (Tregs). In some embodiments, the porous biocompatible or biodegradable scaffold comprising a polymer comprising alginate, hyaluronic acid, chitosan, or a combination thereof, or an arginine-glycine-aspartate (RGD) peptide, or an alginate-RGD polymer; the one or more microparticles comprising silica-heparin; or the nanoparticles comprising poly(lactic-co-glycolic acid) (PLGA). In some embodiments, the porous biocompatible or biodegradable scaffold further comprising one or more immune cells. In some embodiments, the porous biocompatible or biodegradable scaffold further comprising anti-CD3 or anti-CD28 antibodies covalently bound to the polymer. In some embodiments, the at least one compound that regulates T cell immune response comprising a T cell immunostimulatory compound comprising a cytokine, a therapeutic or diagnostic protein, a growth factor, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, a thrombolytic, a peptide, an oligonucleotide, a nucleic acid, a chemokine ligand, or an anti-cluster of differentiation (anti-CD) antibody or fragment thereof, interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-10 (IL-10), interleukin-12 (IL-12), interleukin-15 (IL-15), IL-2 superkine, chemokine (C-C motif) ligand 21 (CCL21), anti-CD3 or anti-CD28, or any combination thereof; or the at least one compound that regulates induction of regulatory T cells (Tregs) comprising a compound that suppresses induction of Tregs comprising galinusertib (LY2157299), SB505124, or another transforming growth factor-beta (TGF-β) inhibitor.
[0137] Unless otherwise defined herein, scientific and technical terms used in connection with the present application shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
[0138] As employed above and throughout the disclosure, the following terms and abbreviations, unless otherwise indicated, shall be understood to have the following meanings.
[0139] In the present disclosure, the singular forms “a,” “an,” and “the” include the plural reference, and reference to a particular numerical value includes at least that particular value, unless the context clearly indicates otherwise. Thus, for example, a reference to “a compound” is a reference to one or more of such compounds and equivalents thereof known to those skilled in the art, and so forth. The term “plurality”, as used herein, means more than one. When a range of values is expressed, another embodiment includes from the one particular and/or to the other particular value.
[0140] Similarly, when values are expressed as approximations, by use of the antecedent “about,” it is understood that the particular value forms another embodiment. All ranges are inclusive and combinable. In the context of the present disclosure, by “about” a certain amount it is meant that the amount is within ±20% of the stated amount, or preferably within ±10% of the stated amount, or more preferably within ±5% of the stated amount.
[0141] Throughout this application, various embodiments of this invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0142] Whenever a numerical range is indicated herein, it is meant to include any cited numeral (fractional or integral) within the indicated range. The phrases “ranging/ranges between” a first indicate number and a second indicate number and “ranging/ranges from” a first indicate number “to” a second indicate number are used herein interchangeably and are meant to include the first and second indicated numbers and all the fractional and integral numerals there between.
[0143] In some embodiments, described throughout herein, are “porous scaffolds.” These scaffolds are able to provide T cell immunoregulatory compounds to a microenvironment within which they are implanted and located. The release of immunoregulatory compounds may be regulatable, providing targeted therapeutic biological molecule(s) or biological molecule(s) that in turn regulates a downstream therapeutic target. This regulatable production may in certain embodiments, reduce or eliminate systemic toxicity.
[0144] In some embodiments, described throughout herein, are “microparticles.” These microparticles are embedded in a scaffold. These microparticles may serve as a “platform” comprising at least one compound that regulates T cell immune response, providing an increased amount of a biomolecule or other compound that regulates T cell immune response, while retaining the regulatable aspects of the localized distribution. These “microparticles” may be targeted to a site of need by incorporating targeting molecules into an encapsulation coating. Additionally, at least one compound that regulates induction of T regulatory cells (Tregs) may in certain embodiments be incorporated into the microparticles. Additionally, the microparticles may further comprise an encapsulation coating (e.g., heparin), which may enhance the biophysical properties of the microparticles.
[0145] In some embodiments, “nanoparticles” can be used in place of microparticles, as described herein.
[0146] In some embodiments, described herein are uses of these “porous scaffolds” for treating cancer or other tumors. Use of these “scaffolds” in a therapeutic cancer or tumor treatment may in certain embodiments, prove advantageous as they may provide a regulatable expression system of a needed or advantageous biomolecule, such as a compound that regulates T cell immune response and/or a compound that regulates induction of regulatory T cells, within a localized treatment area that may further be targeted to T cells, which in turn could promote clearance of the cancer or tumor. These implantable scaffolds may further be biodegradable following implantation in a subject.
[0147] In some embodiments, described herein are uses of these “porous scaffolds” or “scaffolds” for treating a focus of interest of an autoimmune disease or an allergic reaction or hypersensitivity reaction, a localized site of an infection or infectious disease, a localized site of an injury or other damage, a transplant or other surgical site, a blood clot, or a symptom thereof, or a combination thereof. Use of these “factories” in the treatment of a focus of interest of an autoimmune disease or an allergic reaction or hypersensitivity reaction, a localized site of an infection or infectious disease, a localized site of an injury or other damage, a transplant or other surgical site, a blood clot, or a symptom thereof, or a combination thereof, may in certain embodiments, prove advantageous as they may provide a regulatable expression system of a needed or advantageous biomolecule, within a localized treatment area that may further be targeted to T cells, which could promote clearance of or alleviate localized symptoms of the autoimmune disease, allergic reaction or hypersensitivity reaction, infection or infectious disease, or blood clot, or could facilitate healing and/or prevent infection or rejection of a localized site of an injury or other damage, a transplant or other surgical site, or could alleviate localized symptoms thereof.
[0148] As used herein, the terms “treat”, “treatment”, or “therapy” (as well as different forms thereof) refer to therapeutic treatment, including prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change associated with a disease or condition. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of the extent of a disease or condition, stabilization of a disease or condition (i.e., where the disease or condition does not worsen), delay or slowing of the progression of a disease or condition, amelioration or palliation of the disease or condition, and remission (whether partial or total) of the disease or condition, whether detectable or undetectable. Those in need of treatment include those already with the disease or condition as well as those prone to having the disease or condition or those in which the disease or condition is to be prevented.
[0149] As used herein, the terms “component,” “composition,” “formulation”, “composition of compounds,” “compound,” “drug,” “pharmacologically active agent,” “active agent,” “therapeutic,” “therapy,” “treatment,” or “medicament,” are used interchangeably herein, as context dictates, to refer to a compound or compounds or composition of matter which, when administered to a subject (human or animal) induces a desired pharmacological and/or physiologic effect by local and/or systemic action. A personalized composition or method refers to a product or use of the product in a regimen tailored or individualized to meet specific needs identified or contemplated in the subject.
[0150] The terms “subject,” “individual,” and “patient” are used interchangeably herein, and refer to an animal, for example a human, to whom treatment with a composition or formulation in accordance with the present invention, is provided. The term “subject” as used herein refers to human and non-human animals. The terms “non-human animals” and “non-human mammals” are used interchangeably herein and include all vertebrates, e.g., mammals, such as non-human primates, (particularly higher primates), sheep, dog, rodent, (e.g. mouse or rat), guinea pig, goat, pig, cat, rabbits, cows, horses and non-mammals such as reptiles, amphibians, chickens, and turkeys. The term “higher vertebrates” is used herein and includes avians (birds) and mammals. The compositions described herein can be used to treat any suitable mammal, including primates, such as monkeys and humans, horses, cows, cats, dogs, rabbits, sheep, goats, pigs, and rodents such as rats and mice. In one embodiment, the mammal to be treated is human. The human can be any human of any age. In an embodiment, the human is an adult. In another embodiment, the human is a child. The human can be male, female, pregnant, middle-aged, adolescent, or elderly. According to any of the methods of the present invention and in one embodiment, the subject is human. In another embodiment, the subject is a non-human primate. In another embodiment, the subject is murine, which in one embodiment is a mouse, and, in another embodiment is a rat. In another embodiment, the subject is canine, feline, bovine, equine, laprine, or porcine. In another embodiment, the subject is mammalian.
[0151] Conditions and disorders in a subject for which a particular drug, compound, composition, formulation (or combination thereof) is said herein to be “indicated” are not restricted to conditions and disorders for which that drug or compound or composition or formulation has been expressly approved by a regulatory authority, but also include other conditions and disorders known or reasonably believed by a physician or other health or nutritional practitioner to be amenable to treatment with that drug or compound or composition or formulation or combination thereof.
[0152] As noted above, obstacles persist in developing and applying effective methods for activating cytotoxic T cells for cancer immunotherapy. As described herein, significant improvements have been made in the response of T cells to solid tumors despite their immunosuppressive tumor environment. TGF-β is known to be a potent component of the tumor microenvironment, which promotes cancer growth and metastasis and promotes the induction of Tregs from the helper T cells drawn to the tumor. Suppression of TGF-β could allow for a reduction in regulatory T cells and more effective CD8+ T cell killing, resulting in rapid clearance of solid tumors. Here we describe an approach to enable the local delivery of TGF-β inhibitor (TGF-βi) into the tumor environment for the enhancement of the immune responses during immunotherapy. An implantable scaffold is provided comprising means for local delivery of TGF-βi (e.g., in PLGA nanoparticles embedded in the scaffold) and also one or more immunostimulatory compounds to attract and activate cytotoxic T cells to target the tumor (e.g., IL-2 on silica-heparin microparticles embedded in the scaffold). Systemic effects are avoided by employing local effects of the scaffold, which can induce a potent T cell response to a tumor or remaining tumor after resection, or even treat inoperable tumors, and then the scaffold can biodegrade over time.
[0153] As described herein, the studies described emphasize the local delivery of inhibitors and activators based in a biodegradable scaffold. Once administered, the scaffold can attract lymphocytes to the site of the tumor and allow simultaneous T cell stimulation and controlled release of the TGF-βi. The combined response of the immune system in the tumor microenvironment is then enhanced: Treg development is reduced in favor of effector T cell activation and tumor rejection is achieved by the activated T cells. This method provides an immunotherapy treatment that is more effective by directly altering the effects of the tumor microenvironment.
[0154] Details of each component of the scaffold are provided below. The implantable scaffold can be made of various biocompatible and biodegradable polymers. To further encourage cell trafficking within these structures, cell adhesion peptides such as but not limited to the chemokine CCL21, and immunostimulatory compounds such as IL-2, IL-4, IL-6, IL7, IL-10, IL-12, IL-15, or IL-2 superkine, or antibodies such as anti-CD3 and anti-CD28 are provided. To improve the resemblance of these 3D matrices to natural tissues techniques are used that create microscale pores within these structures that both allows for maximizing the loading capacity for delivering T cells and facilitates their expansion as well. The scaffolds are modified with anti-CD3/anti-CD28 antibodies and further comprise a TGF-βi, as well as IL-2 cytokine to provide activation signal for T cells and prevent formation of regulatory T cells.
Scaffold
[0155] The scaffold may comprise a polymer such as but not limited to alginate, hyaluronic acid, or chitosan, or any combination thereof. It comprises one of more the components described below. The scaffold can be fabricated into a shape and size for facile insertion or implantation during a surgical or transdermal procedure. In one embodiment, the scaffold is about the shape and size of a pencil eraser. However, the shape and size can be configured for a particular application, for ease of insertion, and/or for retention at a particular site near a tumor or resected tumor site.
Pores
[0156] Pores are created in the scaffold by freeze drying process such as that described in Biopolymer-Based Hydrogels As Scaffolds for Tissue Engineering Applications: A Review Biomacromolecules 2011, 12, 5, 1387-1408; https://pubs.acs.org/doi/abs/10.1021/bm200083n. In one embodiment, the pores are between about 1 and about 7 nm in size.
Microparticles
[0157] In certain embodiments, disclosed herein are microparticles. In some embodiments, the microparticles comprise a polymer. In some embodiments, the polymer comprises a biocompatible polymer. In some embodiments, the biocompatible polymer comprises alginate, chitosan, or mesoporous silica. In some embodiments, the microparticles comprise silica microparticles. Silica microparticles such as mesoporous silica may be embedded in the scaffold. In some embodiments, the silica is bound to heparin. In some embodiments, about 2 nmol of heparin is bound per mg of silica. In some embodiments, the microparticle has a size comprising 1-1000 micrometers. In some embodiments, the particles are from about 3 to about 24 μm in diameter. In some embodiments, the microparticles comprise hyaluronic acid. In some embodiments, the microparticles comprise heparin.
[0158] In some embodiments, microparticles may be encapsulated by a coating. In some embodiments, coatings provide microparticles with enhanced biological characteristics, including interactions with cells, with compounds that regulate T cell immune response, with compounds that regulate induction of regulatory T cells, and with other biomolecules. In some embodiments, microparticles are encapsulated with a coating comprising heparin. In some embodiments, microparticles are encapsulated with alginate or alginate-heparin. In some embodiments, an alginate-heparin coating may be sulfated.
[0159] In some embodiments, microparticles may comprise a “coating” material. In some embodiments, these materials provide microparticles with enhanced biological characteristics, including interactions with cells and biomolecules. In some embodiments, microparticles are formed in the presence of a mix of alginate-heparin. In some embodiments, microparticles are formed in the presence of a mix of alginate. In some embodiments, an alginate may be sulfated.
[0160] A skilled artisan would appreciate that a description of a microparticle comprising an alginate or alginate-heparin coating may in certain embodiments, encompass a microparticle prepared in the presence of alginate or alginate and heparin, wherein these molecules and integral components of the microparticle synthesized.
[0161] In some embodiments, microparticles may be targeted to T cells. In some embodiments, a microparticle coat comprises biomolecules that recognize and bind cell surface markers on T cells. In some embodiments, cell surface markers on T cells include CD3 and CD28. In some embodiments, a biomolecule that recognized a T cell surface marker comprises an antibody or a fragment thereof.
[0162] Paramagnetic nanoparticles may be included in the microparticles, e.g., for purification or for ease of separation, and are commercially available (e.g., CHEMICELL™ GmbH). In some embodiments, the paramagnetic nanoparticles comprise superparamagnetic iron oxide nanoparticles (SPIONs). In some embodiments, a SPION comprises a particle having a size about 50-200 mm. This addition may in certain embodiments enhance purification of microparticles using methods well known in the art.
Nanoparticles
[0163] In some embodiments, the scaffold comprises one or more nanoparticles. In some exemplary, but non-limiting, embodiments, the nanoparticle comprises a poly(lactic-co-glycolic acid) (PLGA, PLG), a copolymer, produced using methods known in the art. In some embodiments, the nanoparticle is sized between 1-100 nm. In some embodiments, the nanoparticle is biocompatible and/or biodegradable. This addition may in certain embodiments enhance purification of microparticles or nanoparticles using methods well known in the art.
[0164] In some embodiments, the nanoparticle is bound to at least one compound that regulates induction of regulatory T cells, as described herein.
T Cells and Regulatory Compounds
[0165] In some embodiments, immune cells, for example T cell, are generated and expanded by the presence of cytokines in vivo. In some embodiments, cytokines that affect generation and maintenance to T-helper cells in vivo comprise IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, or IL-2 superkine. In some embodiments, T regulatory (Treg) cells are generated from naïve T cells by cytokine induction in vivo. In some embodiments, TGF-β and/or IL-2 play a role in differentiating naïve T cell to become Treg cells.
[0166] “Cytokines” are a category of small proteins (˜5-20 kDa) critical to cell signaling. Cytokines are peptides and usually are unable to cross the lipid bilayer of cells to enter the cytoplasm. Among other functions, cytokines may be involved in autocrine, paracrine and endocrine signaling as immunomodulating agents. Cytokines may be pro-inflammatory or anti-inflammatory. Cytokines include, but are not limited to, chemokines (cytokines with chemotactic activities), interferons, interleukins (ILs; cytokines made by one leukocyte and acting on one or more other leukocytes), lymphokines (produced by lymphocytes), monokines (produced by monocytes), and tumor necrosis factors. Cells producing cytokines include, but are not limited to, immune cells (e.g., macrophages, B lymphocytes, T lymphocytes and mast cells), as well as endothelial cells, fibroblasts, and various stromal cells. A particular cytokine may be produced by more than one cell type.
[0167] A skilled artisan would appreciate that the term “cytokine” may encompass cytokines beneficial to enhancing an immune response targeted against a cancer or a pre-cancerous or non-cancerous tumor or lesion. A skilled artisan would also appreciate that the term “cytokine” may encompass cytokines beneficial to enhancing an immune response against a disease or inflammation (e.g., resulting from surgery, an injury, or damage from an autoimmune response) or that the term “cytokine” may encompass cytokines beneficial to reducing an abnormal autoimmune response.
[0168] In some embodiments, a cytokine encoded by the nucleic acid expands and maintains T-helper cells (helper T cells). In some embodiments, a cytokine encoded by the nucleic acid expands T-helper cells. In some embodiments, a cytokine encoded by the nucleic acid maintains T-helper cells. In some embodiments, a cytokine encoded by the nucleic acid expands cytotoxic T cells (CTLs). In some embodiments, a cytokine encoded by the nucleic acid activates cytotoxic T cells. In some embodiments, a cytokine encoded by the nucleic acid expands and activates cytotoxic T cells. In some embodiments, a cytokine encoded by the nucleic acid increases proliferation of a T-helper cell population. In some embodiments, a cytokine encoded by the nucleic acid increases proliferation of a cytotoxic T cell population.
[0169] In some embodiments, the encoded cytokine comprises an interleukin (IL). A skilled artisan would appreciate that interleukins comprise a large family of molecules, including, but not limited to, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, and IL-36.
[0170] In some embodiments, the encoded interleukin comprises an IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, or an IL-15, or any combination thereof. In some embodiments, the encoded cytokine comprises an IL-2. In some embodiments, the encoded cytokine comprises an IL-12. In some embodiments, the encoded cytokine comprises an IL-15.
[0171] In some embodiments, the plasmid encodes any additional cytokine or polypeptide or peptide.
[0172] In some embodiments, the IL-2 cytokine comprises an IL-2 superkine (super IL-2 cytokine). IL-2 is a 133 amino acid glycoprotein with one intramolecular disulfide bond and variable glycosylation.
[0173] “IL-2 superkine” or “Super 2” (Fc) is an artificial variant of IL-2 containing mutations at positions L80F/R81D/L85V/I86V/I92F. These mutations are located in the molecule's core that acts to stabilize the structure and to give it a receptor-binding conformation mimicking native IL-2 bound to CD25. These mutations effectively eliminate the functional requirement of IL-2 for CD25 expression and elicit proliferation of T cells. Compared to IL-2, the IL-2 superkine induces superior expansion of cytotoxic T cells, leading to improved antitumor responses in vivo, and elicits proportionally less toxicity by lowering the expansion of T regulatory cells and reducing pulmonary edema. Examples of IL-2 superkine (Super2) deoxyribonucleic acid (DNA) and protein sequences can be found, e.g., in Table 1.
TABLE-US-00001 TABLE 1 IL-2 superkine (Super2) Sequence. Type of Sequence Sequence (SEQ ID NO) Super2 GGAGCCATGGGAGAATTCGCACCTACTTCAAGTT nucleotide CTACAAAGAAAACACAGCTACAACTGGAGCATT sequence TACTTCTGGATTTACAGATGATTTTGAATGGAAT TAATAATTACAAGAATCCCAAACTCACCAGGAT GCTCACATTTAAGTTTTACATGCCCAAGAAGGCC ACAGAACTGAAACATCTTCAGTGTCTAGAAGAA GAACTCAAACCTCTGGAGGAAGTGCTAAATTTA GCTCAGAGCAAAAACTTTCACTTCGATCCCAGGG ACGTCGTCAGCAATATCAACGTATTCGTCCTGGA ACTAAAGGGATCTGAAACAACATTCATGTGTGA ATATGCTGATGAGACAGCAACCATTGTAGAATTT CTGAACAGATGGATTACCTTTTGTCAAAGCATCA TCTCAACACTAACTCAT (SEQ ID NO: 2) Super2 MGEFAPTSSSTKKTQLQLEHLLLDLQMILNGINNY protein KNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPL sequence EEVLNLAQSKNFHFDPRDVVSNINVFVLELKGSETT FMCEYADETATIVEFLNRWITFCQSIISTLTH (SEQ ID NO: 3)
[0174] A “T cell” is characterized and distinguished by the T cell receptor (TCR) on the surface. A T cell is a type of lymphocyte that arises from a precursor cell in the bone marrow before migrating to the thymus, where it differentiates into one of several kinds of T cells. Differentiation continues after a T cell has left the thymus. A “cytotoxic T cell” (CTL) is a CD8+ T cell able to kill, e.g., virus-infected cells or cancer cells. A “T helper cell” is a CD4+ T cell that interacts directly with other immune cells (e.g., regulatory B cells) and indirectly with other cells to recognize foreign cells to be killed. “Regulatory T cells” (T regulatory cells; Treg), also known as “suppressor T cells,” enable tolerance and prevent immune cells from inappropriately mounting an immune response against “self,” but may be co-opted by cancer or other cells. In autoimmune disease, “self-reactive T cells” mount an immune response against “self” that damages healthy, normal cells.
[0175] In some embodiments, the porous scaffold comprises a T cell immunostimulatory compound and/or a compound that suppresses induction of Tregs. In some embodiments, the porous scaffold comprises a T cell immunosuppression compound and/or a compound that induces Tregs.
[0176] One skilled in the art appreciates the many mechanisms of T cell immunostimulation and/or immunosuppression. Likewise, one skilled in the art appreciates the many mechanisms of Treg induction and/or suppression of Treg induction.
[0177] T cell immunostimulatory compounds include, but are not limited to, T cell activators, T cell attractants, or T cell adhesion compounds. T cell immunostimulatory compounds include, but are not limited to, cytokines, a therapeutic or diagnostic protein, a growth factor, a chemokine, a therapeutic or diagnostic antibody or fragment thereof, an antigen-binding protein, a Fc fusion protein, an anticoagulant, an enzyme, a hormone, a thrombolytic, a peptide, an oligonucleotide, a nucleic acid, chemokine ligands, and anti-CD antibodies or fragments thereof. Non-limiting examples include interleukins (e.g., IL-2, IL4, I-L6, IL-7, IL-10, IL-12, or IL-15, or an IL-2 superkine), chemokine ligands (e.g., CCL ligands, including CCL21), and anti-CD antibodies (e.g., anti-CD3 or anti-CD28) or fragments thereof, or any combination(s) thereof.
[0178] T cell immunosuppression compounds include, but are not limited to cytokines, chemokines, growth factors, or small molecule inhibitors.
[0179] Compounds that suppression induction of Tregs include, but are not limited to, inhibitors of transforming growth factor-beta (TGF-β), such as an inhibitor of the TGF-β receptor. Non-limiting examples of TGF-β receptor inhibitors include galinusertib (LY2157299) or SB505124. Compounds that induce Tregs include TGF-β and activators thereof (e.g., IL-2, IL-4).
[0180] As used herein, a “targeting agent,” or “affinity reagent,” is a molecule that binds to an antigen or receptor or other molecules. In some embodiments, a “targeting agent” is a molecule that specifically binds to an antigen or receptor or other molecule. In certain embodiments, some or all of a targeting agent is composed of amino acids (including natural, non-natural, and modified amino acids), nucleic acids, or saccharides. In certain embodiments, a “targeting agent” is a small molecule.
[0181] As used herein, the term “antibody” encompasses the structure that constitutes the natural biological form of an antibody. In most mammals, including humans, and mice, this form is a tetramer and consists of two identical pairs of two immunoglobulin chains, each pair having one light and one heavy chain, each light chain comprising immunoglobulin domains VL and CL, and each heavy chain comprising immunoglobulin domains VH, C-gamma-1 (Cγ1), C-gamma-2 (Cγ2), and C-gamma-3 (Cγ3). In each pair, the light and heavy chain variable regions (VL and VH) are together responsible for binding to an antigen, and the constant regions (CL, Cγ1, Cγ2, and Cγ3, particularly Cγ2, and Cγ3) are responsible for antibody effector functions. In some mammals, for example in camels and llamas, full-length antibodies may consist of only two heavy chains, each heavy chain comprising immunoglobulin domains VH, Cγ2, and Cγ3. By “immunoglobulin (Ig)” herein is meant a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes. Immunoglobulins include but are not limited to antibodies. Immunoglobulins may have a number of structural forms, including but not limited to full-length antibodies, antibody fragments, and individual immunoglobulin domains including but not limited to VH, Cγ1, Cγ2, Cγ3, VL, and CL.
[0182] Depending on the amino acid sequence of the constant domain of their heavy chains, intact antibodies can be assigned to different “classes”. There are five-major classes (isotypes) of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into “subclasses”, e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known to one skilled in the art.
[0183] As used herein, the term “immunoglobulin G” or “IgG” refers to a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, IgG3. As used herein, the term “modified immunoglobulin G” refers to a molecule that is derived from an antibody of the “G” class. As used herein, the term “antibody” refers to a protein consisting of one or more polypeptides substantially encoded by all or part of the recognized immunoglobulin genes. The recognized immunoglobulin genes, for example in humans, include the kappa (κ), lambda (λ), and heavy chain genetic loci, which together comprise the myriad variable region genes, and the constant region genes mu (μ), delta (δ), gamma (γ), sigma (σ), and alpha (α) which encode the IgM, IgD, IgG, IgE, and IgA isotypes or classes, respectively.
[0184] The term “antibody” is meant to include full-length antibodies, and may refer to a natural antibody from any organism, an engineered antibody, or an antibody generated recombinantly for experimental, therapeutic, or other purposes as further defined below. Furthermore, full-length antibodies comprise conjugates as described and exemplified herein. As used herein, the term “antibody” comprises monoclonal and polyclonal antibodies. Antibodies can be antagonists, agonists, neutralizing, inhibitory, or stimulatory. Specifically included within the definition of “antibody” are full-length antibodies described and exemplified herein. By “full length antibody” herein is meant the structure that constitutes the natural biological form of an antibody, including variable and constant regions.
[0185] The “variable region” of an antibody contains the antigen binding determinants of the molecule, and thus determines the specificity of an antibody for its target antigen. The variable region is so named because it is the most distinct in sequence from other antibodies within the same isotype. The majority of sequence variability occurs in the complementarity determining regions (CDRs). There are 6 CDRs total, three each per heavy and light chain, designated VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3. The variable region outside of the CDRs is referred to as the framework (FR) region. Although not as diverse as the CDRs, sequence variability does occur in the FR region between different antibodies. Overall, this characteristic architecture of antibodies provides a stable scaffold (the FR region) upon which substantial antigen binding diversity (the CDRs) can be explored by the immune system to obtain specificity for a broad array of antigens.
[0186] Furthermore, antibodies may exist in a variety of other forms including, for example, Fv, Fab, and (Fab′)2, as well as bi-functional (i.e. bi-specific) hybrid antibodies (e.g., Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)) and in single chains (e.g., Huston et al., Proc. Natl. Acad. Sci. U.S.A., 85, 5879-5883 (1988) and Bird et al., Science, 242, 423-426 (1988), which are incorporated herein by reference). (See, generally, Hood et al., “Immunology”, Benjamin, N.Y., 2nd ed. (1984), and Hunkapiller and Hood, Nature, 323, 15-16 (1986)).
[0187] The term “epitope” as used herein refers to a region of the antigen that binds to the antibody or antigen-binding fragment. It is the region of an antigen recognized by a first antibody wherein the binding of the first antibody to the region prevents binding of a second antibody or other bivalent molecule to the region. The region encompasses a particular core sequence or sequences selectively recognized by a class of antibodies. In general, epitopes are comprised by local surface structures that can be formed by contiguous or noncontiguous amino acid sequences.
[0188] As used herein, the terms “selectively recognizes”, “selectively bind” or “selectively recognized” mean that binding of the antibody, antigen-binding fragment or other bivalent molecule to an epitope is at least 2-fold greater, preferably 2-5 fold greater, and most preferably more than 5-fold greater than the binding of the molecule to an unrelated epitope or than the binding of an antibody, antigen-binding fragment or other bivalent molecule to the epitope, as determined by techniques known in the art and described herein, such as, for example, ELISA or cold displacement assays.
[0189] As used herein, the term “Fc domain” encompasses the constant region of an immunoglobulin molecule. The Fc region of an antibody interacts with a number of Fc receptors and ligands, imparting an array of important functional capabilities referred to as effector functions, as described herein. For IgG the Fc region comprises Ig domains CH2 and CH3. An important family of Fc receptors for the IgG isotype are the Fc gamma receptors (FcγRs). These receptors mediate communication between antibodies and the cellular arm of the immune system.
[0190] As used herein, the term “Fab domain” encompasses the region of an antibody that binds to antigens. The Fab region is composed of one constant and one variable domain of each of the heavy and the light chains.
[0191] In one embodiment, the term “antibody” or “antigen-binding fragment” respectively refer to intact molecules as well as functional fragments thereof, such as Fab, a scFv-Fc bivalent molecule, F(ab′)2, and Fv that are capable of specifically interacting with a desired target. In some embodiments, the antigen-binding fragments comprise:
[0192] (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, which can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain;
[0193] (2) Fab′, the fragment of an antibody molecule that can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab′ fragments are obtained per antibody molecule;
[0194] (3) (Fab′)2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; F(ab′)2 is a dimer of two Fab′ fragments held together by two disulfide bonds;
[0195] (4) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and
[0196] (5) Single chain antibody (“SCA”), a genetically engineered molecule containing the variable region of the light chain and the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule.
[0197] (6) scFv-Fc, is produced in one embodiment, by fusing single-chain Fv (scFv) with a hinge region from an immunoglobulin (Ig) such as an IgG, and Fc regions.
[0198] In some embodiments, an antibody provided herein is a monoclonal antibody. In some embodiments, the antigen-binding fragment provided herein is a single chain Fv (scFv), a diabody, a tri(a)body, a di- or tri-tandem scFv, a scFv-Fc bivalent molecule, an Fab, Fab′, Fv, F(ab′)2 or an antigen binding scaffold (e.g., affibody, monobody, anticalin, DARPin, Knottin, etc.). “Affibodies” are small proteins engineered to bind to a large number of target proteins or peptides with high affinity, often imitating monoclonal antibodies, and are antibody mimetics.
[0199] As used herein, the terms “bivalent molecule” or “BV” refer to a molecule capable of binding to two separate targets at the same time. The bivalent molecule is not limited to having two and only two binding domains and can be a polyvalent molecule or a molecule comprised of linked monovalent molecules. The binding domains of the bivalent molecule can selectively recognize the same epitope or different epitopes located on the same target or located on a target that originates from different species. The binding domains can be linked in any of a number of ways including, but not limited to, disulfide bonds, peptide bridging, amide bonds, and other natural or synthetic linkages known in the art (Spatola et al., “Chemistry and Biochemistry of Amino Acids, Peptides and Proteins,” B. Weinstein, eds., Marcel Dekker, New York, p. 267 (1983); Morley, J. S., “Trends Pharm Sci.” (1980) pp. 463-468; Hudson et al., Int. J. Pept. Prot. Res. (1979) 14, 177-185; Spatola et al., Life Sci. (1986) 38, 1243-1249; Hann, M. M., J. Chem. Soc. Perkin Trans. I (1982) 307-314; Almquist et al., J. Med. Chem. (1980) 23, 1392-1398; Jennings-White et al., Tetrahedron Lett. (1982) 23, 2533; Szelke et al., European Application EP 45665; Chemical Abstracts 97, 39405 (1982); Holladay, et al., Tetrahedron Lett. (1983) 24, 4401-4404; and Hruby, V. J., Life Sci. (1982) 31, 189-199).
[0200] As used herein, the terms “binds” or “binding” or grammatical equivalents, refer to compositions having affinity for each other. “Specific binding” is where the binding is selective between two molecules. A particular example of specific binding is that which occurs between an antibody and an antigen. Typically, specific binding can be distinguished from non-specific when the dissociation constant (KD) is less than about 1×10-5 M or less than about 1×10-6 M or 1×10-7 M. Specific binding can be detected, for example, by ELISA, immunoprecipitation, coprecipitation, with or without chemical crosslinking, two-hybrid assays and the like. Appropriate controls can be used to distinguish between “specific” and “non-specific” binding.
[0201] In addition to antibody sequences, an antibody according to the present invention may comprise other amino acids, e.g., forming a peptide or polypeptide, such as a folded domain, or to impart to the molecule another functional characteristic in addition to ability to bind antigen. For example, antibodies of the invention may carry a detectable label, such as fluorescent or radioactive label, or may be conjugated to a toxin (such as a holotoxin or a hemitoxin) or an enzyme, such as beta-galactosidase or alkaline phosphatase (e.g., via a peptidyl bond or linker).
[0202] In one embodiment, an antibody of the invention comprises a stabilized hinge region. The term “stabilized hinge region” will be understood to mean a hinge region that has been modified to reduce Fab arm exchange or the propensity to undergo Fab arm exchange or formation of a half-antibody or a propensity to form a half-antibody. “Fab arm exchange” refers to a type of protein modification for human immunoglobulin, in which a human immunoglobulin heavy chain and attached light chain (half-molecule) is swapped for a heavy-light chain pair from another human immunoglobulin molecule. Thus, human immunoglobulin molecules may acquire two distinct Fab arms recognizing two distinct antigens (resulting in bispecific molecules). Fab arm exchange occurs naturally in vivo and can be induced in vitro by purified blood cells or reducing agents such as reduced glutathione. A “half-antibody” forms when a human immunoglobulin antibody dissociates to form two molecules, each containing a single heavy chain and a single light chain. In one embodiment, the stabilized hinge region of human immunoglobulin comprises a substitution in the hinge region.
[0203] In one embodiment, the term “hinge region” as used herein refers to a proline-rich portion of an immunoglobulin heavy chain between the Fc and Fab regions that confers mobility on the two Fab arms of the antibody molecule. It is located between the first and second constant domains of the heavy chain. The hinge region includes cysteine residues which are involved in inter-heavy chain disulfide bonds. In one embodiment, the hinge region includes cysteine residues which are involved in inter-heavy chain disulfide bonds.
[0204] In one embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.1 nM-10 mM. In one embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.1 nM-1 mM. In one embodiment, the antibody or antigen-binding fragment binds its target with a KD within the 0.1 nM range. In one embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.1-2 nM. In another embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.1-1 nM. In another embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.05-1 nM. In another embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.1-0.5 nM. In another embodiment, the antibody or antigen-binding fragment binds its target with a KD of 0.1-0.2 nM.
[0205] In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises a modification. In another embodiment, the modification minimizes conformational changes during the shift from displayed to secreted forms of the antibody or antigen-binding fragment. It is to be understood by a skilled artisan that the modification can be a modification known in the art to impart a functional property that would not otherwise be present if it were not for the presence of the modification. Encompassed are antibodies which are differentially modified during or after translation, e.g., by glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. Any of numerous chemical modifications may be carried out by known techniques, including but not limited, to specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH4, acetylation, formylation, oxidation, reduction, metabolic synthesis in the presence of tunicamycin, etc.
[0206] In some embodiments, the modification is one as further defined herein below. In some embodiments, the modification is a N-terminus modification. In some embodiments, the modification is a C-terminal modification. In some embodiments, the modification is an N-terminus biotinylation. In some embodiments, the modification is a C-terminus biotinylation. In some embodiments, the secretable form of the antibody or antigen-binding fragment comprises an N-terminal modification that allows binding to an Immunoglobulin (Ig) hinge region. In some embodiments, the Ig hinge region is from but is not limited to, an IgA hinge region. In some embodiments, the secretable form of the antibody or antigen-binding fragment comprises an N-terminal modification that allows binding to an enzymatically biotinylatable site. In some embodiments, the secretable form of the antibody or antigen-binding fragment comprises a C-terminal modification that allows binding to an enzymatically biotinylatable site. In some embodiments, biotinylation of said site functionalizes the site to bind to any surface coated with streptavidin, avidin, avidin-derived moieties, or a secondary reagent.
[0207] It will be appreciated that the term “modification” can encompass an amino acid modification such as an amino acid substitution, insertion, and/or deletion in a polypeptide sequence.
[0208] In one embodiment, a variety of radioactive isotopes are available for the production of radioconjugate antibodies and other proteins and can be of use in the methods and compositions provided herein. Examples include, but are not limited to, At211, Cu64, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Zr89 and radioactive isotopes of Lu. In a further embodiment, the amino acid sequences of the invention may be homologues, variants, isoforms, or fragments of the sequences presented. The term “homolog” as used herein refers to a polypeptide having a sequence homology of a certain amount, namely of at least 70%, e.g. at least 80%, 90%, 95%, 96%, 97%, 98%, 99% of the amino acid sequence it is referred to. Homology refers to the magnitude of identity between two sequences. Homolog sequences have the same or similar characteristics, in particular, have the same or similar property of the sequence as identified. The term ‘variant’ as used herein refers to a polypeptide wherein the amino acid sequence exhibits substantially 70, 80, 95, or 99% homology with the amino acid sequence as set forth in the sequence listing. It should be appreciated that the variant may result from a modification of the native amino acid sequences, or by modifications including insertion, substitution or deletion of one or more amino acids. The term “isoform” as used herein refers to variants of a polypeptide that are encoded by the same gene, but that differ in their isoelectric point (pI) or molecular weight (MW), or both. Such isoforms can differ in their amino acid composition (e.g. as a result of alternative splicing or limited proteolysis) and in addition, or in the alternative, may arise from differential post-translational modification (e.g., glycosylation, acylation, phosphorylation deamidation, or sulphation). As used herein, the term “isoform” also refers to a protein that exists in only a single form, i.e., it is not expressed as several variants. The term “fragment” as used herein refers to any portion of the full-length amino acid sequence of protein of a polypeptide of the invention which has less amino acids than the full-length amino acid sequence of a polypeptide of the invention. The fragment may or may not possess a functional activity of such polypeptides.
[0209] In an alternate embodiment, enzymatically active toxin or fragments thereof that can be used in the compositions and methods provided herein include, but are not limited, to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
[0210] A chemotherapeutic or other cytotoxic agent may be conjugated to the protein, according to the methods provided herein, as an active drug or as a prodrug. The term “prodrug” refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. (See, for example Wilman, 1986, Biochemical Society Transactions, 615th Meeting Belfast, 14:375-382; and Stella et al., “Prodrugs: A Chemical Approach to Targeted Drug Delivery,” Directed Drug Delivery, Borchardt et al., (ed.): 247-267, Humana Press, 1985.) The prodrugs that may find use with the compositions and methods as provided herein include but are not limited to phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, beta-lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs which can be converted into the more active cytotoxic free drug. Examples of cytotoxic drugs that can be derivatized into a prodrug form for use with the antibodies and Fc fusions of the compositions and methods as provided herein include but are not limited to any of the aforementioned chemotherapeutic.
[0211] Non-limiting examples of antibodies, antibody fragments and antigen-binding proteins include single-chain antibodies such as scFvs. A non-limiting example, a scFv that blocks PD-1 for the treatment of cancer or tumor, including in association with CAR-T therapy, wherein activation of scFv production can be directed at a particular site in the body, in one embodiment, at or near a tumor. Another non-limiting example includes brolucizumab, which targets VEGF-A and is used to treat wet age-related macular degeneration.
[0212] In another example, the therapeutic protein is an immune checkpoint inhibitor, such as an antibody fragment, or antigen-binding protein, that inhibits a checkpoint molecule such as but not limited to PD-1, PD-L1, CTLA-4, CTLA-4 receptor, PD1-L2, 4-1BB, OX40, LAG-3 and TIM-3. In one embodiment, a scFv that inhibits a checkpoint protein. In one embodiment, the porous scaffold is used in association with a cancer or tumor therapy, such as CAR-T therapy. Thus, the porous scaffold provides a similar therapeutic activity as antibodies to PD-1 and other checkpoint molecules.
Cell Adhesion/Attraction Components
[0213] Any one or more cell adhesion and/or cell attraction and/or immunostimulatory and/or immunosuppression compounds or components may be included in or on the scaffold. In one embodiment, such components attract or activate T cells. Non-limiting examples include CCL21, anti-CD3 antibodies, anti-CD28 antibodies, or any combination thereof. In one embodiment, a combination of anti-CD3 and an anti-CD28 antibodies are used. Any one or more immunostimulatory components may be included in or on the scaffold. In some embodiments, components such as but not limited to IL-2, IL-4, IL-6, IL-7, IL-10, IL-12 IL-15, or IL-2 superkine are used, singly or in any combination. In one embodiment as described below, such components may be bound to mesoporous silica microparticles or to heparin-modified mesoporous silica microparticles comprising the scaffold. In another embodiment, post-modification of the scaffold is performed to conjugate anti-CD3 and anti-CD28 antibodies through EDC/NHS cross-linking reagents, to provide stronger T cell activation signals. In other embodiments, such compounds or components suppress T cell attraction or T cell activation. Additional embodiments are described elsewhere herein.
Treg Regulators
[0214] Any one of various methods of regulating Treg induction and/or suppression of Treg induction may be used.
[0215] A TGF-β inhibitor (TGF-βi) such as a TGF-β receptor inhibitor may be used. Non-limiting examples include galinusertib (LY2157299) or SB505124. The compound is incorporated into the scaffold. In one embodiment, the TGF-βi suppresses the formation of induced Tregs and thus enhances the tumoricidal activity of T cells attracted to, activated, or delivered by the scaffolds described herein. In one embodiment the TGF-β inhibitor or inducer is slowly released from the scaffold. Alternatively, compounds that induce Tregs may be used. Non-limiting examples include TGF-β and activators thereof (e.g., IL-2, IL-4, etc.). Additional embodiments are described elsewhere herein.
Methods of Making Scaffolds
[0216] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with at least one compound that regulates T cell immune response (e.g., with cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine] to improve T cells' proliferation and effector functions).
[0217] The implantable scaffold can be made of various biocompatible and biodegradable polymers. To further encourage cell trafficking within these structures, cell adhesion peptides such as but not limited to the chemokine CCL21, and immunostimulatory compounds such as IL-2, IL-4, IL-6, IL-7, IL-10, IL-12 IL-15, or IL-2 superkine, or antibodies such as anti-CD3 and anti-CD28 are provided. To improve the resemblance of these 3D matrices to natural tissues techniques are used that create microscale pores within these structures that both allows for maximizing the loading capacity for delivering T cells and facilitates their expansion as well. The scaffolds are modified with anti-CD3/anti-CD28 antibodies and further comprise a TGF-βi, as well as IL-2 cytokine to provide activation signal for T cells and prevent formation of regulatory T cells.
Methods of Using Scaffolds
[0218] The scaffolds described herein can be fabricated for various applications. In one aspect, the porous scaffold is provided at a site at or near a focus of interest in a subject in need. In one embodiment, one or more scaffolds are inserted surgically at or near the site of a tumor during resection or biopsy. In one embodiment the scaffold is implanted at or near the site of a tumor. In one embodiment the scaffold biodegrades. In some embodiment the mechanical properties of the scaffold as well as the degradation time can be modified for a particular use by changing the formulation.
[0219] In some embodiments, “treating” comprises therapeutic treatment including prophylactic or preventive measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder, for example to treat or prevent cancer. Thus, in some embodiments, treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with cancer or a combination thereof. Thus, in other embodiments, treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with a non-cancerous tumor or a combination thereof. Thus, in some embodiments, “treating,” “ameliorating,” and “alleviating” refer inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof. In some embodiments, “preventing” refers, inter alia, to delaying the onset of symptoms, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, or a combination thereof. In some embodiments, “suppressing” or “inhibiting”, refers inter alia to reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, prolonging patient survival, or a combination thereof.
[0220] A “cancer” is one of a group of diseases characterized by uncontrollable growth and having the ability to invade normal tissues and to metastasize to other parts of the body. Cancers have many causes, including, but not limited to, diet, alcohol consumption, tobacco use, environmental toxins, heredity, and viral infections. In most instances, multiple genetic changes are required for the development of a cancer cell. Progression from normal to cancerous cells involves a number of steps to produce typical characteristics of cancer including, e.g., cell growth and division in the absence of normal signals and/or continuous growth and division due to failure to respond to inhibitors thereof; loss of programmed cell death (apoptosis); unlimited numbers of cell divisions (in contrast to a finite number of divisions in normal cells); aberrant promotion of angiogenesis; and invasion of tissue and metastasis.
[0221] A “pre-cancerous” condition, lesion, or tumor is a condition, lesion, or tumor comprising abnormal cells associated with a risk of developing cancer. Non-limiting examples of pre-cancerous lesions include colon polyps (which can progress into colon cancer), cervical dysplasia (which can progress into cervical cancer), and monoclonal monopathy (which can progress into multiple myeloma). Premalignant lesions comprise morphologically atypical tissue which appears abnormal when viewed under the microscope, and which are more likely to progress to cancer than normal tissue.
[0222] A “non-cancerous tumor” or “benign tumor” is one in which the cells demonstrate normal growth, but are produced, e.g., more rapidly, giving rise to an “aberrant lump” or “compact mass,” which is typically self-contained and does not invade tissues or metastasize to other parts of the body. Nevertheless, a non-cancerous tumor can have devastating effects based upon its location (e.g., a non-cancerous abdominal tumor that prevents pregnancy or causes a ureter, urethral, or bowel blockage, or a benign brain tumor that is inaccessible to normal surgery and yet damages the brain due to unrelieved pressure as it grows).
[0223] In some embodiments, “treating” comprises therapeutic treatment including prophylactic or preventive measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder, for example to treat or prevent an autoimmune disease, an allergic reaction or hypersensitivity reaction, a localized infection or an infectious disease, an injury or other damage, a transplant or other surgical site, or a symptom thereof, or a combination thereof. Thus, in some embodiments, treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with an autoimmune disease, an allergic reaction or hypersensitivity reaction, a localized infection or an infectious disease, an injury or other damage, a transplant or other surgical site, or a symptom thereof, or a combination thereof. Thus, in some embodiments, “treating,” “ameliorating,” and “alleviating” refer inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof. In some embodiments, “preventing” refers, inter alia, to delaying the onset of symptoms, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, or a combination thereof. In some embodiments, “suppressing” or “inhibiting”, refers inter alia to reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, prolonging patient survival, or a combination thereof.
[0224] A “focus of interest” a “localized environment,” or a “localized site” comprises a site in which the disease, reaction, infection, injury, or other medical condition is specific to one part or area of the body; in which a symptom or condition of the medical condition is specific to one part or area of the body; or in which treatment is desired for one part or area of the body (even if the disease, reaction, infection, injury, or other medical condition affects other parts or areas of the body or the body as a whole).
[0225] In some embodiments, the scaffold comprises a microparticle not comprising alginate, heparin, or a lipid coating. In some embodiments, the scaffold comprises a microparticle comprising alginate. In some embodiments, the scaffold comprises a microparticle comprising alginate-heparin. In certain embodiments, this scaffold can be administered via a catheter. In certain embodiments, this scaffold can be implanted or injected locally at the site of a tumor. Scaffolding comprising microparticles provides in some embodiments, further control over the release of the compound regulating T cell immune response and/or the compound regulating induction of Tregs, and also localizes the effects. In some embodiments, implantation, injection, or other administration of the scaffold provides a stronger cytokine gradient to boost up the therapeutic effects.
[0226] In some embodiments, application of the scaffold, or compositions thereof is for local use. This may, in certain embodiments, provide an advantage, wherein the controlled localized release of the compound regulating T cell immune response and/or the compound regulating induction of Tregs may provide a local immune effect thereby avoiding a toxic systemic effect of the cytokine. In one example, controlled release of IL-2 or an IL-2 superkine, may increase proliferation of cytotoxic T cells and or helper T cells in the area adjacent to the cancer or tumor, thereby promoting clearance of the cancer or tumor. In some embodiments, controlled release of IL-2 or an IL-2 superkine, may maintain a helper T cell population in the area adjacent to the tumor. In some embodiments, controlled release of IL-2 or an IL-2 superkine, may activate a cytotoxic T cell population in the area adjacent to the tumor. In some embodiments, controlled release of IL-2 or an IL-2 superkine, may lead to enhanced killing of tumor cells in the localized area at and adjacent to the tumor. In some embodiments, controlled release of IL-2 or an IL-2 superkine, provides enhanced clearance of a tumor. This technique may also be used for the treatment of other diseases, reactions, injuries, transplants, blood clots, and the like, recited herein.
[0227] As used herein, the terms “composition” and “pharmaceutical composition” may in some embodiments, be used interchangeably having all the same qualities and meanings. In some embodiments, disclosed herein is a pharmaceutical composition for the treatment of a cancer or tumor as described herein. In some embodiments, disclosed herein is a pharmaceutical composition for the treatment of cancer or tumor. In some embodiments, disclosed herein is a pharmaceutical composition for the use in methods locally regulating an immune response. In some embodiments, disclosed herein are pharmaceutical compositions for the treatment of an autoimmune disease, an allergic reaction or hypersensitivity reaction, a localized site of an infection or infectious disease, a localized site of an injury or other damage, a transplant or other surgical site, a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism or a symptom thereof, or a combination thereof.
[0228] In some embodiments, a pharmaceutical composition comprises a porous scaffold, as described in detail above. In still another embodiment, a pharmaceutical composition for the treatment of a disease or medical condition, as described herein, comprises an effective amount of the compound regulating T cell immune response and/or the compound regulating induction of Tregs and a pharmaceutically acceptable excipient. In some embodiments, a composition comprising the porous scaffold comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs and a pharmaceutically acceptable excipient is used in methods for regulating an immune response.
Tumors
[0229] In one embodiment, the subject for implantation of a scaffold as described herein has a solid tumor or cancer. In another embodiment, the tumor is a lymphatic tumor or cancer. In another embodiment, the tumor or cancer is any tumor or cancer. In another embodiment, the disease or medical condition comprises a tumor, a suspected tumor, or a resected tumor. In one embodiment, the tumor, suspected tumor, or resected tumor comprises a cancerous, pre-cancerous, or non-cancerous tumor. Non-limiting examples include a sarcoma or a carcinoma, a fibrosarcoma, a myxosarcoma, a liposarcoma, a chondrosarcoma, an osteogenic sarcoma, a chordoma, an angiosarcoma, an endotheliosarcoma, a lymphangiosarcoma, a lymphangioendotheliosarcoma, a synovioma, a mesothelioma, an Ewing's tumor, a leiomyosarcoma, a rhabdomyosarcoma, a colon carcinoma, a pancreatic cancer or tumor, a breast cancer or tumor, an ovarian cancer or tumor, a prostate cancer or tumor, a squamous cell carcinoma, a basal cell carcinoma, an adenocarcinoma, a sweat gland carcinoma, a sebaceous gland carcinoma, a papillary carcinoma, a papillary adenocarcinomas, a cystadenocarcinoma, a medullary carcinoma, a bronchogenic carcinoma, a renal cell carcinoma, a hepatoma, a bile duct carcinoma, a choriocarcinoma, a seminoma, an embryonal carcinoma, a Wilm's tumor, a cervical cancer or tumor, a uterine cancer or tumor, a testicular cancer or tumor, a lung carcinoma, a small cell lung carcinoma, a bladder carcinoma, an epithelial carcinoma, a glioma, an astrocytoma, a medulloblastoma, a craniopharyngioma, an ependymoma, a pinealoma, a hemangioblastoma, an acoustic neuroma, an oligodendroglioma, a schwannoma, a meningioma, a melanoma, a neuroblastoma, or a retinoblastoma, esophageal cancer, pancreatic cancer, metastatic pancreatic cancer, metastatic adenocarcinoma of the pancreas, bladder cancer, stomach cancer, fibrotic cancer, glioma, malignant glioma, diffuse intrinsic pontine glioma, recurrent childhood brain neoplasm renal cell carcinoma, clear-cell metastatic renal cell carcinoma, kidney cancer, prostate cancer, metastatic castration resistant prostate cancer, stage IV prostate cancer, metastatic melanoma, melanoma, malignant melanoma, recurrent melanoma of the skin, melanoma brain metastases, stage IIIA skin melanoma; stage IIIB skin melanoma, stage IIIC skin melanoma; stage IV skin melanoma, malignant melanoma of head and neck, lung cancer, non-small cell lung cancer (NSCLC), squamous cell non-small cell lung cancer, breast cancer, recurrent metastatic breast cancer, hepatocellular carcinoma, Hodgkin's lymphoma, follicular lymphoma, non-Hodgkin's lymphoma, advanced B-cell NHL, HL including diffuse large B-cell lymphoma (DLBCL), multiple myeloma, chronic myeloid leukemia, adult acute myeloid leukemia in remission; adult acute myeloid leukemia with Inv(16)(p13.1q22); CBFB-MYH11; adult acute myeloid leukemia with t(16;16)(p13.1;q22); CBFB-MYH11; adult acute myeloid leukemia with t(8;21)(q22;q22); RUNX1-RUNX1T1; adult acute myeloid leukemia with t(9;11)(p22;q23); MLLT3-MLL; adult acute promyelocytic leukemia with t(15;17)(q22;q12); PML-RARA; alkylating agent-related acute myeloid leukemia, chronic lymphocytic leukemia, Richter's syndrome; Waldenstrom's macroglobulinemia, adult glioblastoma; adult gliosarcoma, recurrent glioblastoma, recurrent childhood rhabdomyosarcoma, recurrent Ewing sarcoma/peripheral primitive neuroectodermal tumor, recurrent neuroblastoma; recurrent osteosarcoma, colorectal cancer, MSI positive colorectal cancer; MSI negative colorectal cancer, nasopharyngeal nonkeratinizing carcinoma; recurrent nasopharyngeal undifferentiated carcinoma, cervical adenocarcinoma; cervical adenosquamous carcinoma; cervical squamous cell carcinoma; recurrent cervical carcinoma; stage IVA cervical cancer; stage IVB cervical cancer, anal canal squamous cell carcinoma; metastatic anal canal carcinoma; recurrent anal canal carcinoma, recurrent head and neck cancer; carcinoma, squamous cell of head and neck, head and neck squamous cell carcinoma (HNSCC), ovarian carcinoma, colon cancer, gastric cancer, advanced GI cancer, gastric adenocarcinoma; gastroesophageal junction adenocarcinoma, bone neoplasms, soft tissue sarcoma; bone sarcoma, thymic carcinoma, urothelial carcinoma, recurrent Merkel cell carcinoma; stage III Merkel cell carcinoma; stage IV Merkel cell carcinoma, myelodysplastic syndrome and recurrent mycosis fungoides and Sezary syndrome. In another related aspect, the tumor or cancer comprises a metastasis of a tumor or cancer. In some embodiments, a solid tumor treated using a method described herein, originated as a blood tumor or diffuse tumor.
[0230] In some embodiments, a pharmaceutical composition comprises the porous scaffold, as described in detail above. In still another embodiment, a pharmaceutical composition for the treatment of cancer or tumor, as described herein, comprises an effective amount of the compound regulating T cell immune response and/or the compound regulating induction of Tregs and a pharmaceutically acceptable excipient. In some embodiments, a composition comprising the porous scaffold comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs and a pharmaceutically acceptable excipient is used in methods for regulating an immune response. In some embodiments, treating reduces the size of the tumor, eliminates the tumor, slows the growth or regrowth of the tumor, or prolongs the survival of the subject, or any combination thereof. In some embodiments, a composition comprising the porous scaffold is used in methods to reduce the size of a tumor. In some embodiments, a composition comprising the porous scaffold is used in methods to eliminate the tumor. In some embodiments, a composition comprising the porous scaffold is used in methods to slow the growth of a tumor. In some embodiments, a composition comprising the porous scaffold is used in methods to prolong the survival of the subject. In some embodiments, methods of treating described herein reduce the size of the tumor, eliminate said tumor, slow the growth or regrowth of the tumor, or prolong survival of said subject, or any combination thereof.
Immune Response Stimulation or Suppression
[0231] In one embodiment, the scaffolds can be used to stimulate the immune response. In another embodiment, the scaffolds can be used to deliver signals to suppress the immune response. In a non-limiting example, by using TGF-β instead of a TGFβi in the formulation, the scaffolds will provide signals to promote formation of regulatory T cells (Tregs). These cells can contribute in modulating the immune response after organ transplantation.
[0232] In some embodiments, the disease or medical condition comprises an autoimmune disease, and the porous scaffold is provided at or adjacent to a focus of interest comprising an autoimmune-targeted or symptomatic focus of said autoimmune disease; the disease or medical condition comprises an allergic reaction or hypersensitivity reaction, and the porous scaffold is provided at or adjacent to a focus of interest comprising a reactive focus of said allergic reaction or hypersensitivity reaction; the disease or medical condition comprises a localized infection or an infectious disease, and the porous scaffold is provided at or adjacent to a focus of interest comprising a focus of infection or symptoms; the disease or medical condition comprises an injury or a site of chronic damage, and the porous scaffold is provided at or adjacent to a focus of interest comprising the injury or the site of chronic damage; the disease or medical condition comprises a surgical site, and the porous scaffold is provided at or adjacent to a focus of interest comprising the surgical site; the disease or medical condition comprises a transplanted organ, tissue, or cell, and the porous scaffold is provided at or adjacent to a focus of interest comprising a transplant site; or the disease or medical condition comprises a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism, and the porous scaffold is provided at or adjacent to a focus of interest comprising the site of the blood clot.
[0233] In some embodiments, the autoimmune disease includes, for example, but is not limited to, rheumatoid arthritis, juvenile dermatomyositis, psoriasis, psoriatic arthritis, sarcoidosis, lupus, Crohn's disease, eczema, vasculitis, ulcerative colitis, multiple sclerosis, or type 1 diabetes, achalasia, Addison's disease, adult Still's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome, autoimmune angioedema, autoimmune dysautonomia, autoimmune encephalomyelitis, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune orchitis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune urticaria, axonal & neuronal neuropathy (AMAN), Bald disease, Behcet's disease, benign mucosal pemphigoid, bullous pemphigoid, Castleman disease (CD), celiac disease, Chagas disease, chronic inflammatory demyelinating polyneuropathy (CIDP), chronic recurrent multifocal osteomyelitis (CRMO), Churg-Strauss syndrome (CSS) or eosinophilic granulomatosis (EGPA), cicatricial pemphigoid, Cogan's syndrome, cold agglutinin disease, congenital hear block, Coxsackie myocarditis, CREST syndrome, Crohn's disease, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), discoid lupus, Dressler's syndrome, endometriosis, eosinophilic esophagitis (EoE), eosinophilic fasciitis, erythema nodosum, essential mixed cryoglobulinemia, Evans syndrome, fibromyalgia, fibrosing alveolitis, giant cell arteritis (temporal arteritis) giant cell myocarditis, glomerulonephritis, Goodpasture's syndrome, granulomatosis with polyangiitis, Grave's disease, Guillain-Barre syndrome, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schonlein purpura (HSP), Herpes gestationis or pemphigoid gestationis (PG), Hidradenitis suppurativa (HS; acne inversa), hypogammalglobulinemia, IgA nephropathy, IgG4-related sclerosing disease, immune thrombocytopenic purpura (ITP), inclusion body myositis (IBM), interstitial cystitis (IC), juvenile arthritis, juvenile diabetes (type 1 diabetes), juvenile myositis (JM), Kawasaki disease, Lambert-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, ligneous conjunctivitis, linear IgA disease, lupus, Lyme disease chronic, Menier's disease, microscopic polyangiitis (MPA), mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, multifocoal motor neuropathy (MMN, MMNCB), multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neonatallupus, neuromyelitis optica, neutropenia, ocular cicatricial pemphigoid, optic neuritis, palindromic rheumatism (PR), PANDAS, paraneoplasticcerebellar degeneration (PCD), paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Pars planitis (peripheral uveitis), Parsonage-Turner syndrome, pemphigus, peripheral neuropathy, perivenous encephalomyelitis, pernicious anemia (PA), POEMS syndrome, polyarteritis nodosa, polyglandular syndromes types I-III, polymyalgia rheumatica, polymyositis, postmyocadial infarction syndrome, primary biliary cirrhosis, primary sclerosing cholangitis, progesterone dermatitis, psoriasis, psoriatic arthritis, pure red cell aplasia (PRCA), pyoderma gangrenosum, Raynaud's phenomenon, reactive arthritis, reflex sympathetic dystrophy (RSD; complex regional pain syndrome [CRPS]), relapsing polychondritis, restless leg syndrome (RLS), retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis (RA), sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjörgren's syndrome, sperm & testicular autoimmunity, stiff person syndrome (SPS), subacute bacterial endocarditis (SBE), Susac's syndrome, sympathetic ophthalmia (SO), Takayasu arteritis, temporal arteritis/giant cell arteritis, thrombocytopenic purpura (TTP), thyroid eye disease (TED), Tolosa-Hunt syndrome (THS), transverse myelitis, type 1 diabetes, ulcerative colitis (UC), undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vitiligo, or Vogt-Koyanagi-Harada disease.
[0234] Alternatively, protein production locally for autoimmune diseases targets the pathogenic antibodies in the disease, for example, a protein that breaks down antibodies in the vicinity (an IgG endopeptidase) or a protein that binds antibodies (a decoy of the antibody's autoimmune target).
[0235] In some embodiments, the allergic reaction includes, for example, but is not limited to, a localized allergic reaction or hypersensitivity reaction including a skin rash, hives, localized swelling (e.g., from an insect bite), or esophageal inflammation from food allergies or eosinophilic esophagitis, other enteric inflammation from food allergies or eosinophilic gastrointestinal disease, localized drug allergies when the drug treatment was local to a part of the body, or allergic conjunctivitis.
[0236] In some embodiments, the localized site of an infection or the localized site of an infectious disease includes, for example, but is not limited to, a fungal infection (e.g., aspergillus, coccidioidomycosis, tinea pedis (foot), tinea corporis (body), tinea cruris (groin), tinea capitis (scalp), and tinea unguium (nail)), a bacterial infection (e.g., methicillin-resistant Staphylococcus aureus [MRSA], localized skin infections, abscesses, necrotizing facsciitis, pulmonary bacterial infections [e.g., pneumonia], bacterial meningitis, bacterial sinus infections, bacterial cellulitis, such as due to Staphylococcus aureus (MRSA), bacterial vaginosis, gonorrhea, chlamydia, syphilis, Clostridium difficile (C. diff), tuberculosis, cholera, botulism, tetanus, anthrax, pneumococcal pneumonia, bacterial meningitis, Lyme disease), a viral infection (e.g., varicella-zoster/herpes zoster [shingles], Herpes simplex I [e.g., cold sores/fever blisters], Herpes simplex II [genital herpes], or human papilloma virus [e.g., cervical cancer, throat cancer, esophageal cancer, mouse cancer], Epstein-Barr virus [e.g., nasopharyngeal cancer], encephalitis viruses [e.g., brain inflammation], or hepatitis viruses [e.g., liver disease; hepatitis A, hepatitis B, hepatitis C, hepatitis D, hepatitis E, hepatitis F, hepatitis G] or COVID-19), a parasitic infection (e.g., an area infected by scabies, Chagas, Hypoderma tarandi, amoebae, roundworm, Toxoplasma gondii). In some embodiments, the injury or other damage includes, for example, but is not limited to traumatic injury (e.g., resulting from an accident or violence) or chronic injury (e.g., osteoarthritis). In some embodiments, the localized site of injury comprises a muscular-skeletal injury, a neurological injury, an eye or ear injury, an internal or external wound, or a localized abscess, an area of mucosa that is affected (e.g., conjunctiva, sinuses, esophagus), or an area of skin that is affected (e.g., infection, autoimmunity). In some embodiments, the transplant or other surgical site includes, for example, but is not limited to, the site and/or its local environment or surroundings of an organ, corneal, skin, limb, face, or other transplant, or a surgical site and/or its local environment or surroundings, for, e.g., but not limited to, treatment of surgical trauma, treatment of a condition related to the transplant or surgery, or prevention of infection. In some embodiments, the site is at or adjacent to a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism. In some embodiments, the methods disclosed herein treat one or more symptoms of a disease, reaction, infection, injury, transplant, surgery, or blood clot. In some embodiments, the methods disclosed herein treat a combination thereof.
[0237] In some embodiments, a pharmaceutical composition comprises the compound regulating T cell immune response and/or the compound regulating induction of Tregs, as described in detail above. In still another embodiment, a pharmaceutical composition for the treatment of an autoimmune disease, an allergic reaction or hypersensitivity reaction, a localized site of an infection or infectious disease, a localized site of an injury or other damage, a transplant or other surgical site, a blood clot, or a symptom thereof of any one of these, or a combination thereof, as described herein, comprises an effective amount of the compound regulating T cell immune response and/or the compound regulating induction of Tregs and a pharmaceutically acceptable excipient. In some embodiments, a composition comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs and a pharmaceutically acceptable excipient is used in methods for regulating an immune response. In some embodiments, a composition comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs is used in methods for promoting clearance of or alleviating localized symptoms of the autoimmune disease, allergic reaction or hypersensitivity reaction, infection or infectious disease. In some embodiments, a composition comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs is used in methods for facilitating healing and/or preventing or inhibiting infection or rejection of a localized site of an injury or other damage, a transplant or other surgical site. In some embodiments, a composition comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs is used in methods for alleviating localized symptoms relating to an autoimmune disease, an allergic reaction or hypersensitivity reaction, a localized site of an infection or infectious disease, a localized site of an injury or other damage, a transplant or other surgical site, or a symptom thereof, or a combination thereof. In some embodiments, a composition comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs is used in methods to prolong the survival of the subject. In some embodiments, methods of treating described herein for promoting clearance of or alleviating localized symptoms of the autoimmune disease, allergic reaction or hypersensitivity reaction, infection or infectious disease; for facilitating healing and/or preventing or inhibiting infection or rejection of a localized site of an injury or other damage, a transplant or other surgical site; for reducing or eliminating a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism; or for alleviating localized symptoms thereof; or for a combination thereof.
[0238] In some embodiments, a method of use of the porous scaffold comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs further comprises a step of administering activated T cells to said subject. Methods of preparing T cells are known in the art. In some embodiments, these cells may be administered prior to or after administering the porous scaffold comprising the compound regulating T cell immune response and/or the compound regulating induction of Tregs. In some embodiments, T cells are administered by intravenous (i.v.) injection. In some embodiments, administration of T cells enhances the therapeutic effect provided by the regulated, local administration of the compound regulating T cell immune response and/or the compound regulating induction of Tregs, as administered from the porous scaffold.
[0239] Treatment of the subject with the porous scaffolds may also be used in conjunction with other known treatments. In a non-limiting example, when the disease or medical condition comprises a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism, and the porous scaffold may be provided at or adjacent to a focus of interest comprising the site of the blood clot together with angioplasty or another clot removal treatment.
[0240] In some embodiments, treating reduces or eliminates inflammation or another symptom of the autoimmune-targeted or symptomatic focus of an autoimmune disease, prolongs survival of the subject, or any combination thereof; reduces or eliminates inflammation or another symptom of allergic reaction or hypersensitivity reaction at the reactive focus of an allergic reaction or hypersensitivity reaction, prolongs survival of the subject, or any combination thereof; reduces or eliminates infection or symptoms at the focus of infection or symptoms of a localized infection or infectious disease, prolongs survival of the subject, or any combination thereof; reduces, eliminates, inhibits or prevents structural, organ, tissue, or cell damage, inflammation, infection, or another symptom at a site of injury or a site of chronic damage, improves structural, organ, tissue, or cell function at a site of injury or a site of chronic damage, improves mobility of the subject, prolongs survival of the subject, or any combination thereof; reduces, eliminates, inhibits, or prevents structural, organ, tissue, or cell damage, inflammation, infection, or another symptom at a surgical site, improves structural, organ, tissue, or cell function at a surgical site, improves mobility of the subject, prolongs survival of the subject, or any combination thereof; reduces, eliminates, inhibits or prevents transplanted organ, tissue, or cell damage or rejection, inflammation, infection or another symptom at a transplant site, improves mobility of the subject, prolongs survival of a transplanted organ, tissue, or cell, prolongs survival of the subject, or any combination thereof; or reduces or eliminates a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism in the subject, improves function or survival of a heart, brain, or lung organ, tissue, or cell in the subject, reduces damage to a heart, brain, or lung organ, tissue, or cell in the subject, prolongs survival of a heart, brain, or lung organ, tissue, or cell in the subject, prolongs survival of the subject, or any combination thereof.
[0241] In some embodiments, at the site, T cells are stimulated to target the focus of interest, and the induction of Tregs is suppressed. In other embodiments, at the site, T cells are suppressed at or near the focus of interest, and Tregs are induced.
[0242] In some aspects, a method is provided for regulating an immune response at a focus of interest in a subject in need, said method comprising providing a porous scaffold to the subject, at or near a site of the focus of interest, the porous scaffold comprising at least one compound that regulates T cell immune response; and at least one compound that regulates induction of regulatory T cells (Tregs), wherein regulating the immune response comprises increasing or decreasing proliferation of cytotoxic T cells; increasing or decreasing proliferation of helper T cells; maintaining, increasing, or decreasing the population of helper T cells at the site of said focus of interest; activating or suppressing cytotoxic T cells at the site of said focus of interest; or any combination thereof.
[0243] Unless otherwise indicated, all numbers expressing quantities, ratios, and numerical properties of ingredients, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about”. All parts, percentages, ratios, etc. herein are by weight unless indicated otherwise.
[0244] As used herein, the singular forms “a” or “an” or “the” are used interchangeably and intended to include the plural forms as well and fall within each meaning, unless expressly stated otherwise or unless the context clearly dictates otherwise. For example, the term “a compound” or “at least one compound” may include a plurality of compounds, including mixtures thereof.
[0245] Also as used herein, “at least one” is intended to mean “one or more” of the listed elements. Singular word forms are intended to include plural word forms and are likewise used herein interchangeably where appropriate and fall within each meaning, unless expressly stated otherwise. Except where noted otherwise, capitalized and non-capitalized forms of all terms fall within each meaning.
[0246] “Consisting of” shall thus mean excluding more than traces of other elements. The skilled artisan would appreciate that while, in some embodiments the term “comprising” is used, such a term may be replaced by the term “consisting of”, wherein such a replacement would narrow the scope of inclusion of elements not specifically recited. The terms “comprises”, “comprising”, “includes”, “including”, “having” and their conjugates encompass “including but not limited to”.
[0247] The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined. In some embodiments, the term “about” refers to a deviance of between 0.0001-5% from the indicated number or range of numbers. In some embodiments, the term “about” refers to a deviance of between 1-10% from the indicated number or range of numbers. In some embodiments, the term “about” refers to a deviance of up to 25% from the indicated number or range of numbers. In some embodiments, the term “about” refers to ±10%.
[0248] Throughout this application, various embodiments may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of certain embodiments. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0249] Whenever a numerical range is indicated herein, it is meant to include any cited numeral (fractional or integral) within the indicated range. The phrases “ranging/ranges between” a first indicate number and a second indicate number and “ranging/ranges from” a first indicate number “to” a second indicate number are used herein interchangeably and are meant to include the first and second indicated numbers and all the fractional and integral numerals therebetween.
[0250] Any patent, patent application publication, or scientific publication, cited herein, is incorporated by reference herein in its entirety.
[0251] The following examples are presented in order to more fully illustrate some embodiments of the invention. They should, in no way be construed, however, as limiting the broad scope of the invention. One skilled in the art can readily devise many variations and modifications of the principles disclosed herein without departing from the scope of the invention.
EXAMPLES
Example 1: Production of Scaffolds with Immunostimulatory Capability and Methods of Use
[0252] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that stimulate T cells (e.g., cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine], chemokine ligands [e.g., CCL21], anti-CD antibodies [e.g., anti-CD3, anti-CD28]) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that suppress induction of Tregs (e.g., TGF-beta inhibitors) may also be included.
[0253] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs are selected for the treatment of a disease or medical condition of interest, or for the alleviation of localized symptoms, or combinations thereof, in a subject. Alternatively, the T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs are diagnostic compound(s) selected for detecting the presence of a disease or medical condition of interest, or a component or indicator thereof, in a subject.
[0254] The scaffold is administered at, adjacent to, or near the site of the focus of interest in the subject in need thereof. The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment within the subject in need thereof. Alternatively, the T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs detect(s) the presence of a disease or medical condition of interest or a component or indicator thereof, within the subject in need thereof.
Example 2: Production of Scaffolds with Immunosuppression Capability and Methods of Use
[0255] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with immunosuppression capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with cytokines (e.g.,_IL-2, IL-4, TGF-beta) and other suppressors to inhibit T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that induce Tregs (e.g., TGF-beta and activators thereof) may also be included.
[0256] The T cell immunosuppression compound and/or the compound that induces Tregs are selected for the treatment of a disease or medical condition of interest, or for the alleviation of localized symptoms, or combinations thereof, in a subject. Alternatively, the T cell immunosuppression compound and/or the compound that induces Tregs are diagnostic compound(s) selected for detecting the presence of a disease or medical condition of interest, or a component or indicator thereof, in a subject.
[0257] The scaffold is administered at, adjacent to, or near the site of the focus of interest in the subject in need thereof. The T cell immunosuppression compound and/or the compound that induces Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment within the subject in need thereof. Alternatively, the T cell immunosuppression compound and/or the compound that induces Tregs detect(s) the presence of a disease or medical condition of interest or a component or indicator thereof, within the subject in need thereof.
Example 3: Treatment of Cancerous, Pre-Cancerous, and Non-Cancerous Tumors with Porous Scaffolds
[0258] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that stimulate T cells (e.g., cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine], chemokine ligands [e.g., CCL21], anti-CD antibodies [e.g., anti-CD3, anti-CD28]) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that suppress induction of Tregs (e.g., TGF-beta inhibitors) may also be included.
[0259] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs are selected for the treatment of a cancerous, pre-cancerous, or non-cancerous tumor, or for the alleviation of localized symptoms, or combinations thereof, in a subject. The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment or reduction in size of the cancerous, pre-cancerous, or non-cancerous tumor. The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs is selected, e.g., to inhibit cell division and/or growth (e.g., a growth factor inhibitor), to inhibit angiogenesis (e.g., an angiogenic factor inhibitor), to promote cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., increasing proliferation of cytotoxic T cells, increasing proliferation of helper T cells, maintaining the population of helper T cells, activating cytotoxic T cells, or a combination thereof), in the vicinity of the tumor. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0260] Where the tumor is cancerous or pre-cancerous (e.g., a growth comprising cells with at least one pre-cancerous mutation), the T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs may be selected based on the type(s) of cells comprising the tumor and, e.g., any cell surface proteins specific to the cancerous or pre-cancerous cells as compared with neighboring healthy tissue.
[0261] The scaffold is administered adjacent to the tumor within the subject in need thereof. Where the tumor is inoperable, it may be possible to use a guided catheter to administer the porous scaffold adjacent to the tumor.
[0262] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the tumor within the subject.
Example 4: Treatment of an Autoimmune-Targeted Focus or of a Symptomatic Focus of an Autoimmune Disease with Porous Scaffolds
[0263] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that suppress T cells (e.g., cytokines, IL-2, or TGF-beta) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that induce Tregs (e.g., TGF-beta and activators thereof) may also be included. If, as a non-limiting example, the subject has rheumatoid arthritis, the porous scaffold treatment is administered at or adjacent to joints (e.g., in the hands or feet) particularly inflamed or damaged by the effects of rheumatoid arthritis. If, as a non-limiting example, the subject has psoriasis, the porous scaffold treatment is administered at or adjacent to an area of psoriatic rash (e.g., especially if the area is one in which psoriasis is potentially dangerous, such as in close proximity to an eye). If, as a non-limiting example, the subject has eczema, the porous scaffold treatment is administered at or adjacent to an area of eczema on the skin. If, as a non-limiting example, the subject has multiple sclerosis, the porous scaffold treatment is administered at or adjacent to a damaged myelin sheath.
[0264] The T cell immunosuppression compound and/or the compound that induces Tregs are selected for the treatment of a an autoimmune-targeted focus or symptomatic focus of an autoimmune disease, or for the alleviation of localized symptoms, or combinations thereof, in a subject. The T cell immunosuppression compound and/or the compound that induces Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment or reduction in size of the autoimmune-targeted focus or symptomatic focus of an autoimmune disease. The cytokine or other protein of interest is selected, e.g., to inhibit or promote (as needed) cell division and/or growth (e.g., a growth factor inhibitor), to inhibit inflammation (e.g., anti-inflammatory), to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., decreasing proliferation of cytotoxic T cells, decreasing proliferation of helper T cells, reducing cytotoxic T cells, or a combination thereof, as well as increasing recognition of self), in the vicinity of the autoimmune-targeted or symptomatic focus of the autoimmune disease. Optionally, the method further comprises a step of administering activated T cells to the subject. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0265] The scaffold is administered adjacent to the autoimmune-targeted focus or symptomatic focus of the autoimmune disease within the subject in need thereof. Where the site of the focus of interest is inoperable, it may be possible to use a guided catheter to administer the porous scaffold adjacent to autoimmune-targeted focus or symptomatic focus of the autoimmune disease within the subject.
[0266] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the autoimmune-targeted focus or symptomatic focus of the autoimmune disease within the subject.
Example 5: Treatment of a Reactive Focus of an Allergic Reaction or Hypersensitivity Reaction with Porous Scaffolds
[0267] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that suppress T cells (e.g., cytokines, IL-2, or TGF-beta) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that induce Tregs (e.g., TGF-beta and activators thereof) may also be included.
[0268] The T cell immunosuppression compound and/or the compound that induces Tregs are selected for the treatment of a reactive focus of an allergic reaction or hypersensitivity reaction, or for the alleviation of localized symptoms, or combinations thereof, in a subject. Non-limiting examples of a reactive focus of an allergic reaction or hypersensitivity reaction in a subject include a skin rash, a hive or hives, or a localized swelling (e.g., from an insect or other bite).
[0269] The T cell immunosuppression compound and/or the compound that induces Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment or reduction in size of the reactive focus of an allergic reaction or hypersensitivity reaction, or for the alleviation of localized symptoms. The cytokine or other protein of interest is selected, e.g., to inhibit or promote (as needed) cell division and/or growth (e.g., a growth factor inhibitor), to inhibit inflammation (e.g., anti-inflammatory), to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., decreasing production or accumulation of histamine, increasing proliferation of cytotoxic T cells, increasing proliferation of helper T cells, maintaining the population of helper T cells, activating cytotoxic T cells, or a combination thereof), in the vicinity of the reactive focus of the allergic reaction or hypersensitivity reaction. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0270] The scaffold is administered adjacent to the reactive focus of an allergic reaction or hypersensitivity reaction within the subject in need thereof.
[0271] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the reactive focus of an allergic reaction or hypersensitivity reaction within the subject.
Example 6: Treatment of a Focus of Infection or Symptoms of a Localized Infection or an Infectious Disease with Porous Scaffolds
[0272] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that stimulate T cells (e.g., cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine], chemokine ligands [e.g., CCL-19, CCL21, SDF-1a], anti-CD antibodies [e.g., anti-CD3, anti-CD28]) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that suppress induction of Tregs (e.g., TGF-beta inhibitors) may also be included.
[0273] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs are selected for the treatment of a focus of infection or symptoms of a localized infection or an infectious disease, or for the alleviation of localized symptoms, or combinations thereof, in a subject. The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment or reduction in the size/amount/severity of the focus of infection or symptoms of a localized infection or an infectious disease. If, as a non-limiting example, the subject has fungal infection (e.g., as described herein), a bacterial infection (e.g., methicillin-resistant Staphylococcus aureus [MRSA], etc.), a viral infection (e.g., a shingles rash from varicella-zoster/herpes zoster; a cold sore/fever blister from, e.g., Herpes simplex I; a genital wart or blister from, e.g., Herpes simplex II, etc.), a parasitic infection (e.g., an area infected by scabies, Chagas, Hypoderma tarandi, an amoeba, a roundworm, Toxoplasma gondii, etc.), the T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs treatment is administered at or adjacent to the infection site, rash, lesion, cold sore, wart, etc., either to treat the infection (e.g., an wound or surgical site infected with MRSA), to contain it or reduce its spread within the subject, to reduce its transmissibility to other individuals (Herpes simplex I or Herpes simplex II), or to reduce a symptom of the infection at the focus of symptoms (e.g., pain associated with an outbreak of shingles). Optionally, the method further comprises a step of administering activated T cells to the subject.
[0274] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment of a localized focus of an infection or infectious disease or of one or more localized symptoms of the infection or infectious disease. The cytokine or other protein of interest is selected, e.g., to inhibit or promote (as needed) cell division and/or growth (e.g., a growth factor inhibitor), to inhibit inflammation (e.g., anti-inflammatory), to promote analgesic activity, to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., increasing proliferation of cytotoxic T cells, increasing proliferation of helper T cells, maintaining the population of helper T cells, increasing cytotoxic T cells, or a combination thereof), in the vicinity of the focus of infection or symptoms of a localized infection or an infectious disease. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0275] The scaffold is administered at or adjacent to the focus of infection or symptoms of the localized infection or infectious disease within the subject in need thereof.
[0276] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the focus of infection or symptoms of the localized infection or infectious disease within the subject.
Example 7: Treatment of an Injury or a Site of Chronic Damage with Porous Scaffolds
[0277] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that stimulate T cells (e.g., cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine], chemokine ligands [e.g., CCL19, CCL21, and SDF-1a], anti-CD antibodies [e.g., anti-CD3, anti-CD28]) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that suppress induction of Tregs (e.g., TGF-beta inhibitors) may also be included.
[0278] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs are selected for the treatment of selected for the treatment of an injury (e.g., trauma, chemical or of a site of chronic damage (e.g., osteoarthritis, type 1 diabetes, rheumatoid arthritis, lupus) in the subject, or for the alleviation of localized symptoms, or combinations thereof, in a subject. The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment or reduction in the size/amount/severity of the focus of infection or symptoms of an injury or a site of chronic damage. The porous scaffold treatment is administered at or adjacent to the injury or to the site of chronic damage, either to treat, reduce, or alleviate the injury (e.g., to promote repair, to promote vascularization, etc.), to prevent infection or further damage (e.g., fungal, bacterial, viral, or parasitic infection; neuropathy; muscle wasting; etc.), or to reduce a symptom of the injury or of the chronic damage (e.g., pain, inflammation, etc.).
[0279] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs is selected, e.g., to inhibit or promote (as needed) cell division and/or growth (e.g., a growth factor inhibitor), to inhibit inflammation (e.g., anti-inflammatory), to promote analgesic activity, to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., increasing proliferation of cytotoxic T cells, increasing proliferation of helper T cells, maintaining the population of helper T cells, increasing cytotoxic T cells, or a combination thereof), in the vicinity of the injury or the site of chronic damage. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0280] The scaffold is administered at or adjacent to the focus of infection or symptoms of the localized infection or infectious disease within the subject in need thereof.
[0281] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the injury or site of chronic damage within the subject.
Example 8: Treatment of a Surgical Site with Porous Scaffolds
[0282] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that stimulate T cells (e.g., cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine], chemokine ligands [e.g., CCL19, CCL21, and SDF-1a], anti-CD antibodies [e.g., anti-CD3, anti-CD28]) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that suppress induction of Tregs (e.g., TGF-beta inhibitors) may also be included. Alternatively, these microparticles are loaded with compounds that suppress T cells (e.g., cytokines, growth factors, or chemokines) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that induce Tregs (e.g., TGF-beta, IL-2, and activators thereof) may also be included.
[0283] The compound that regulates T cell immune response and/or the compound that regulates induction of Tregs are selected for the treatment of selected for the treatment of a surgical site in the subject, or for the alleviation of localized symptoms, or combinations thereof, in a subject. The porous scaffold treatment is administered at or adjacent to the surgical site, either to treat, reduce, or alleviate the effects of surgery (e.g., to promote repair, to promote vascularization, etc.), to prevent infection or further damage (e.g., fungal, bacterial, viral, or parasitic infection; neuropathy; muscle wasting; etc.), or to reduce a symptom of the effects of surgery (e.g., pain, inflammation, etc.).
[0284] The compound that regulates T cell immune response and/or the compound that regulates induction of Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment or reduction in the size/amount/severity of the surgical site and type of surgery, as well as of one or more localized symptoms of the associated effects of surgery. The compound that regulates T cell immune response and/or the compound that regulates induction of Tregs is selected, e.g., to inhibit or promote (as needed) cell division and/or growth (e.g., a growth factor inhibitor), to inhibit inflammation (e.g., anti-inflammatory), to promote analgesic activity, to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., increasing proliferation of cytotoxic T cells, increasing proliferation of helper T cells, maintaining the population of helper T cells, increasing cytotoxic T cells, or a combination thereof), in the vicinity of the surgical site. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0285] The scaffold is administered at or adjacent to the surgical site within the subject in need thereof.
[0286] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the surgical site within the subject.
Example 9: Treatment of a Transplant Site Associated with a Transplanted Organ, Tissue, or Cells with Porous Scaffolds
[0287] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that suppress T cells (e.g., cytokines, chemokines, or growth factors) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that induce Tregs (e.g., TGF-beta and activators thereof) may also be included.
[0288] The T cell immunosuppression compound and/or the compound that induces Tregs are selected for the treatment of a transplant site associated with a transplanted organ, tissue, or cells, or for the alleviation of localized symptoms, or combinations thereof, in a subject. The T cell immunosuppression compound and/or the compound that induces Tregs porous scaffold treatment is administered at or adjacent to the transplant site associated with a transplanted organ, tissue, or cells, either to treat, reduce, or alleviate the surgery related to the transplant (e.g., to promote repair, to promote vascularization, etc.), to prevent infection or damage (e.g., fungal, bacterial, viral, or parasitic infection; neuropathy; muscle wasting; to reduce the likelihood of rejection, or to reduce a symptom of the transplant or surgery related thereto (e.g., pain, inflammation, etc.).
[0289] The T cell immunosuppression compound and/or the compound that induces Tregs acts in concert with other proteins or cells to enhance a desired immune response for the treatment of the transplant site associated with a transplanted organ, tissue, or cells. The T cell immunosuppression compound and/or the compound that induces Tregs is selected, e.g., to inhibit or promote (as needed) cell division and/or growth (e.g., a growth factor inhibitor), to inhibit inflammation (e.g., anti-inflammatory), to promote analgesic activity, to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response, such as suppression of rejection (e.g., decreasing proliferation of cytotoxic T cells, decreasing proliferation of helper T cells, decreasing cytotoxic T cells, or a combination thereof), in the vicinity of the injury or the site of chronic damage.
[0290] The scaffold is administered at or adjacent to the transplant site associated with a transplanted organ, tissue, or cells in the subject, thereby reducing the likelihood of rejection and/or one or more of its symptoms or effects, as well as the symptoms or effects of the transplant surgery.
[0291] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the transplant site associated with a transplanted organ, tissue, or cells within the subject.
Example 10: Treatment of a Blood Clot Causing or at Risk for Causing a Myocardial Infarction, an Ischemic Stroke, or a Pulmonary Embolism with Porous Scaffolds
[0292] Implantable scaffolds are made of various biocompatible and biodegradable polymers, such as alginate, hyaluronic acid, and chitosan. Microscale pores are created within the structures. To create scaffolds with stimulatory capability by this artificial niche, mesoporous silica microparticles are embedded in the scaffolds. These microparticles are loaded with compounds that stimulate T cells (e.g., cytokines [e.g., IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-15, IL-2 superkine], chemokine ligands [e.g., CCL21], anti-CD antibodies [e.g., anti-CD3, anti-CD28]) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that suppress induction of Tregs (e.g., TGF-beta inhibitors) may also be included. Alternatively, these microparticles are loaded with compounds that suppress T cells (e.g., cytokines) to improve T cells' proliferation and/or effector functions. Nanoparticles comprising compounds that induce Tregs (e.g., TGF-beta and activators thereof) may also be included.
[0293] The compound that regulates T cell immune response and/or the compound that regulates induction of Tregs (e.g., a cytokine, a thrombolytic, or another protein of interest) are selected for the treatment of selected for the treatment of a blood clot causing or at risk for causing a myocardial infarction, an ischemic stroke, or a pulmonary embolism in the subject, or for the alleviation of localized symptoms, or combinations thereof, in a subject. In a non-limiting example, thrombolytic (“clot buster”) treatment is administered at or adjacent to the blood clot to break up, reduce, or eliminate the blood clot in order to treat or prevent infarction of a blood vessel and thereby to treat or prevent, e.g., a myocardial infarction (heart attack), an ischemic stroke, or a pulmonary embolism. Non-limiting examples of thrombolytics include tissue plasminogen activator (tPA), tenecteplase, alteplase, urokinase, reteplase, and streptokinase.
[0294] The porous scaffold treatment is administered at or adjacent to the blood clot, either to treat, reduce, or alleviate the effects of surgery (e.g., to promote repair, to promote vascularization, etc.), to prevent infection or further damage (e.g., fungal, bacterial, viral, or parasitic infection; neuropathy; muscle wasting; etc.), or to reduce a symptom of the effects of surgery (e.g., pain, inflammation, etc.). It is noted that the location of the blood clot may not be in the heart, the brain, or a lung at the time of treatment, but rather in some other part of the subject's body (e.g., the lower limbs and extremities; the carotid artery; the site of an injury, surgery, or a transplant; or elsewhere).
[0295] The compound that regulates T cell immune response and/or the compound that regulates induction of Tregs acts in concert with other proteins or cells to enhance a desired response for the treatment of a blood clot. The compound that regulates T cell immune response and/or the compound that regulates induction of Tregs (e.g., cytokine, thrombolytic or other protein of interest) is selected, e.g., to inhibit angiogenesis, to promote reduction or elimination of clotting, to inhibit inflammation (e.g., anti-inflammatory), to promote analgesic activity, to inhibit or promote (as needed) cell death (e.g., an apoptosis-promoting cytokine or other protein of interest), or to regulate an immune response (e.g., increasing proliferation of cytotoxic T cells, increasing proliferation of helper T cells, maintaining the population of helper T cells, increasing cytotoxic T cells, or a combination thereof), in the vicinity of the blood clot. Optionally, the method further comprises a step of administering activated T cells to the subject.
[0296] The porous scaffold is administered at or adjacent to or near the blood clot. The porous scaffold may be administered via a guided catheter, which may facilitate access to, and treatment of, the blood clot. The porous scaffold may be administered, in a non-limiting example, together with angioplasty (e.g., a balloon catheter) or other clot removal treatment.
[0297] The T cell immunostimulatory compound and/or the compound that suppresses induction of Tregs at, adjacent to, or near the site of the focus of interest treat(s) a localized environment comprising the blood clot within the subject.
Materials and Methods for Examples 11-25
Chemicals and Biologicals
[0298] Unless noted otherwise, all chemicals were purchased from SIGMA-ALDRICH™, INC. (St. Louis, Mo.). All glassware was cleaned overnight using concentrated sulfuric acid and then thoroughly rinsed with MILLI-Q® water. All the other cell culture reagents, solutions, and dishes were obtained from THERMO FISHER SCIENTIFIC™ (Waltham, Mass.), except as indicated otherwise.
Preparation and Characterization of Artificial APC Microparticles
[0299] Monodisperse mesoporous silica microparticles (5 to 20 μm [micrometers/microns]) were formed using a microfluidic jet spray-drying route, using cetyltrimethylammonium bromide (CTAB) and/or Pluronic F127 as templating agents, and tetraethylorthosilicate (TEOS) for silica as reported before (see, e.g., Waldron, K. et al. Formation of monodisperse mesoporous silica microparticles via spray-drying. J. Colloid Interface Sci. (2014). doi:10.1016/j.jcis.2013.12.027; Liu, W., Chen, X. D. & Selomulya, C. On the spray drying of uniform functional microparticles. Particuology (2015). doi:10.1016/j.partic.2015.04.001). Carbodiimide chemistry (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride [EDC]/N-hydroxysuccinimide [NHS]; EDC/NHS) was utilized to modify silica conjugates with heparin after treating the silica with (3-Aminopropyl)triethoxysilane (APTES) to provide primary amine groups (see
[0300] For the preparation of antibody-conjugated microparticles, anti-CD3 (clone 2C11; BIO-X-CELL™) and anti-CD28 (clone 37.51; BIO-X-CELL™) were covalently conjugated to the surface of particles using carbodiimide chemistry. After activation of antibodies' carboxylic groups for 10 min with EDC/NHS, microparticles were added and incubated under gentle stirring at 4° C. (degrees Celsius) overnight. The protein-functionalized microparticles (artificial antigen presenting cells, aAPCs) were then separated from the solution and washed several times. Unreacted functional groups were quenched by washing samples in Tris buffer (100 mM, pH 8) for 30 min. A 10-fold dilution of the conjugation density that is used in a conventional plate-bound stimulation method for T cell activation was selected as the final conjugation density for beads. Micro-bicinconinic acid (MICRO-BCA™) assay was used to quantify total amount of surface conjugated antibodies according to the manufacturer's protocol.
Preparation and Characterization of Scaffolds
[0301] In some exemplary, but non-limiting, embodiments, to form the scaffolds, alginate (MW ˜250 kDa, high G blocks; Novamatrix UP MVG, FMC Biopolymer, Rockland, Me.) was oxidized with sodium periodate (1.5%), overnight at room temperature, then quenched the reaction by dropwise addition of ethylene glycol for 45 min. The solution (MWCO 3.5 kDa) was then dialyzed against deionized water for 3 days (d) followed by lyophilization. Afterward, the alginate was dissolved in 2-morpholin-4-ylethanesulfonic acid (MES) (MES 150 mM, NaCl 250 mM, pH 6.5) and covalently conjugated to RGD-containing peptide (GGGGRGDY [SEQ ID NO: 1]; GENSCRIPT™ USA Inc., Piscataway, N.J.) using carbodiimide chemistry (EDC/NHS). The reaction was continued for 24 h followed by dialysis (MWCO 20 kDa) and lyophilization. This alginate-RGD complex in phosphate buffered saline (PBS) was then cross-linked via calcium sulfate solution. The gels were casted in desired 24- or 96-well plates followed by two overnight washes to get rid of the extra calcium ions and then used as two-dimensional (2D) matrices. For three-dimensional (3D) structures these same scaffolds were frozen at −80° C., lyophilized for 3 days, and stored at 4° C. before cellular studies. To prepare aAPC loaded scaffolds, 20×10.sup.6 (20×106) aAPCs were mixed with 1 ml of alginate prior to crosslinking with CaSO4 (CaSO4).
[0302] An array of different alginate formulations was then prepared by varying either the polymer content or the amount of crosslinker (here CaSO4). To measure the mechanical stiffness of the gels, an INSTRON™ Model 5542 mechanical tester was used, and all the samples were tested at a rate of 1 mm/min. The Young's modulus (YM; Young modulus) was then calculated from the slope of the linear region that corresponds with 0-10% strain. Here, the stiff gel comprised of alginate 2.5% with 40 mM CaSO4 was used.
[0303] X-ray irradiation (GULMAY MEDICAL™ RS320 X-ray unit) was used to irradiate the fabricated scaffolds before in vitro or in vivo functional assays, following ISO 11137-2:2013 recommended protocols. 16 A 25 kGy (2.5 Mrads) sterilization dose was used. Physical properties, including changes in morphology and mechanical stiffness of the scaffolds, or T cell activation property change after sterilization, were tested.
[0304] Scanning electron microscopy (SEM) images of the gels were taken to see the cross-sectional microstructure and porosity of the alginate-based scaffolds. The lyophilized scaffolds were freeze-fractured (using liquid nitrogen) for cross-sectional images. The scaffolds were sputtered with iridium (SOUTH BAY TECHNOLOGY™ Ion Beam Sputtering) prior to imaging with a ZEISS SUPRA™ 40VP scanning electron microscope (CARL ZEISS MICROSCOPY™ GmbH). The sizes of pores from different parts of the SEM images were then measured and analyzed using ImageJ software (NIH). For SEM imaging of cell-loaded scaffolds, the cell-laden hydrogels were fixed with 2.5% glutaraldehyde, followed by post-fixation in osmium tetroxide prior to serial dehydration in increasing concentrations of ethanol (25, 50, 75, 90, and 100%) for 15 min each, and iridium sputtering.
[0305] To immobilize anti-cluster of differentiation 3 (anti-CD3) and anti-cluster of differentiation 28 (anti-CD28) to the scaffolds, the freeze-dried scaffolds were activated with EDC/NHS or EDC/sulfo-NHS for 15 min. Then the scaffolds were washed twice with PBS (supplemented with 0.42 mM CaCl.sub.2)) before addition of anti-CD3 and anti-CD28. Then they were incubated at 4° C. overnight. Unreacted functional groups were quenched by washing the scaffolds with Tris buffer (100 mM, pH 8) for 30 min. For T cell activation studies, 5×10.sup.6 (5×106) primary naïve T cells were added to the scaffolds and cultured for 3-5 days to study their effector functions.
[0306] To prepare IL-2 loaded aAPCs, microparticles were incubated with cytokine in PBS buffer containing bovine serum albumin (BSA; 0.1% w/v) and were gently shaken overnight at 4° C. The microparticles were then centrifuged and washed several times to remove unabsorbed cytokines. The concentration of IL-2 in the removed supernatant was measured using enzyme-linked immunosorbant assay (ELISA) to estimate the binding capacity of microparticles.
[0307] In vitro release of IL-2 from aAPCs or from aAPCs-loaded scaffolds as well as chemokine (C-C motif) ligand 21 (CCL21) release from the scaffolds were studied by incubating 20×10.sup.6 (20×106) microparticles or one scaffolds in 2 ml PBS (pH 7.4; supplemented with 1 mM CaCl.sub.2)) at 37° C. At different time intervals, 500 μL (microliters) of the supernatant was collected and replaced with an equivalent volume of PBS. The concentration of released IL-2 was determined using a human IL-2 and murine CCL21 ELISA kits as a function of time.
[0308] TGF-β inhibitor, galunisertib (LY2157299) (CAYMAN CHEMICAL™), loaded poly(lactic-co-glycolic) acid (PLGA) nanoparticles (NPs) were prepared using a nanoprecipitation method as previously reported. RESOMER™ RG 503 PLGA (50:50; molecular weight: 28 kg/mol) was used in this study. LY2157299 (Cayman chemical https://www.caymanchem.com/product/15312/ly2157299) and PLGA were dissolved in 5 mL dichloromethane and sonicated into 1% poly vinyl alcohol (PVA) solution (50 ml) by probe sonicator (12 W) for 2 min. The resulting emulsification was then added to 100 ml of 0.5% PVA solution. The solution was agitated, and the dichloromethane was allowed to evaporate for 4 h. The solution was then centrifuged at 3000×g for 5 min to pellet out any non-nano dimensional materials. The supernatant was removed and ultracentrifuged and washed three times at 21,000 g for 20 min to wash away the PVA. The resulting nanoparticle solution was flash frozen in liquid nitrogen and lyophilized for 2 days prior to characterization and use. Hydrodynamic diameter and surface charge of formed PLGA NPs was studied using dynamic light scattering (DLS) and zeta potential measurements (ZETASIZER NANO™, Malvern, UK). To load these NPs into alginate-based scaffolds, LY2157299-loaded PLGA NPs were mixed with alginate prior to crosslinking via calcium. The concentration of released and LY2157299 from nanoparticles before and after loading into alginate scaffolds was determined by measuring the ultraviolet (UV) absorption of LY2157299.
T Cell Isolation and Activation
[0309] All in vitro experiments were conducted in accordance with University of California at Los Angeles' (UCLA's; Los Angeles, Calif., USA) institutional policy on humane and ethical treatment of animals following protocols approved by the Animal Research Committee. Five- to eight-week-old wild-type or OT-I/OTII TCR transgenic mice (Jackson Labs) were used for all experiments.
[0310] Cell-culture media was RPMI supplemented with 10% heat-inactivated FBS, 1% penicillin/streptomycin, 1% sodium pyruvate, 1% HEPES buffer, 0.1% μM 2-mercaptoethanol. CD4+/CD8+ T cells were purified using EASYSEP™ immunomagnetic negative selection enrichment kits (STEM CELL TECHNOLOGIES™). (Per liter, RPMI 1640 medium is commercially available [see e.g., https://www.fishersci.com/shop/products/gibco-rpmi-1640-medium-41/p-4919923] and contains: glucose (2 g), pH indicator (phenol red, 5 mg), salts (6 g sodium chloride, 2 g sodium bicarbonate, 1.512 g disodium phosphate, 400 mg potassium chloride, 100 mg magnesium sulfate, and 100 mg calcium nitrate), amino acids (300 mg glutamine; 200 mg arginine; 50 mg each asparagine, cystine, leucine, and isoleucine; 40 mg lysine hydrochloride; 30 mg serine; 20 mg each aspartic acid, glutamic acid, hydroxyproline, proline, threonine, tyrosine, and valine; 15 mg each histidine, methionine, and phenylalanine; 10 mg glycine; 5 mg tryptophan; and 1 mg reduced glutathione), vitamins (35 mg i-inositol; 3 mg choline chloride; 1 mg each para-aminobenzoic acid, folic acid, nicotinamide, pyridoxine hydrochloride, and thiamine hydrochloride; 0.25 mg calcium pantothenate; 0.2 mg each biotin and riboflavin; and 0.005 mg cyanocobalamin)).
[0311] Control in vitro activation of CD4+/CD8+ T cells was performed by culturing 1×10.sup.6 (1×106) cells/mL in tissue culture-treated 24-well plates that were pre-coated with anti-CD3 (clone 2C11; BIO X CELL™) at a concentration of 10 μg/mL (micrograms/mL) plus addition of 2 μg/mL (micrograms/mL) soluble anti-CD28 (clone 37.51; BIO X CELL™). T cells were then collected from wells and allowed to proliferate in interleukin-2 (IL-2, BRB™ Preclinical Repository, NCI, NIH)-containing medium (50 U/mL), prior to being used for experiments.
[0312] For Treg formation experiments CD4+ T cells were purified from mouse spleen as mentioned above. Cells were then either activated on scaffolds or on anti-CD3e antibody (8 mg/ml) coated plates with the anti-CD28 antibody (2 mg/ml) supplemented medium. At the same time transforming growth factor-beta (TGF-beta; TGF-β) (15 ng/ml) was added to the media. After four days regulatory T cells were removed and stained with antibodies for flow cytometry analysis.
Flow Cytometry
[0313] For flow cytometry analysis, antibodies to mouse antibodies, were purchased from EBIOSCIENCE™, BIOLEGEND™, or BD BIOSCIENCES™. To study proliferation behavior of T-cell responses during various treatments their expansion was measured by 5-(and-6)-carboxyfluorescein diacetate, succinimidyl ester (CFSE) dilution. For CFSE dilution experiments, 5×10.sup.5 (5×105) naive CD4+/CD8+ T cells were labeled with 2 μM CFSE for 13 min, followed by two washes and then incubation with splenocytes. Splenocytes were extracted from the spleen of wild type C57Bl/6 mice. Then the cells were incubated in ammonium-chloride-potassium (ACK) lysing buffer (GIBCO™) for 5 min at room temperature to remove red blood cells. The remaining cells were then treated with ova peptide as above to present to T cells. Trypan Blue was purchased from CALBIOCHEM™. Cells were analyzed on a CYTEK™ DxP10 flow cytometer using FLOWJO™ software (TREESTAR/BD™).
[0314] For intracellular staining of GranzymeB and Foxp3, the recommended protocol by EBIOSCIENCE™ Foxp3/Transcription Factor Staining Buffer Set was followed. The following antibodies were used for intracellular staining from BIOLEGEND™: Foxp3 (clone MF-14, AF647, Cat #126408); GZMB (clone GB11, AF647, Cat #515406), Mouse IgG1, kappa (κ) Isotype Ctrl (clone MOPC-21, AF647, Cat #400130).
Migration Assay
[0315] The migration assay to evaluate the role of chemokines on recruitment of T cells and melanoma cancer in the presence and absence of magnetic particles was performed using regular Transwell migration (Majedi, F. S. et al. Cytokine Secreting Microparticles Engineer the Fate and the Effector Functions of T-Cells. Adv. Mater. 30, 1703178 (2018)). The number of migrated cells was evaluated after 4 h using an automatic cell counter.
In Vivo Tumor Suppression Assay
[0316] 2-5×10.sup.5 (2-5×105) B16F10-OVA tumor cells were subcutaneously injected into right or both (in the contralateral tumor model) right and left flanks of C57BL/6J WT mice (6-8 weeks old). These melanoma-derived cells are transfected to express chicken ovalbumin peptide (OVA)34. Five days after tumor cell injection, scaffolds were surgically implanted subcutaneously into the same approximate region of the tumors in both flanks. For cell-loaded studies, ex vivo activated OT-I T cells were transferred either intravenously using retro-orbital injections (100 microliters [μL] per animal) or implantable scaffolds at the same day. Tumor size was assessed over time using a digital caliber until day 22 at which animals were sacrificed and the tumor, draining lymph nodes, and spleen were extracted. Tumor mass was measured using a digital balance before digesting the tumor tissue for flow cytometry or fixing it for tissue sectioning. Tumors were digested by incubating in collagenase and DNase I (50 micrograms/mL [μg/mL]) at 37° C. for 15 min. These enzymes were inactivated with ethylenediamine tetra-acetic acid (EDTA) (20 microliters/mL [μL/mL] of solution). Tissues were then mechanically disaggregated and passed through a 0.7 micron [μm] cell strainer to obtain a single-cell suspension. Cells were then stained with the fluorochrome-conjugated antibodies on ice. For intracellular staining, cells were permeabilized with Granzyme B Fix/Perm buffer according to the manufacturer's instructions (BIOLEGEND™) before staining. Detection of apoptotic cells in tumor tissue was achieved using Terminal deoxynucleotidyl transferase-mediated dUTP nick-end labeling (TUNEL) staining following the manufacturer's directions. TUNEL-positive cells indicated as apoptotic melanoma cells. Tissue sections were imaged by a fluorescence microscope (KEYENCE™ BZ-X800, Osaka, Japan).
Statistical Analysis
[0317] The Kruskal-Wallis rank sum test, one-way analysis of variance (ANOVA) and two-tailed Student's t-test were utilized as appropriate to analyze the data at a significance of alpha (α) or p<0.05. Quantitative data were expressed as mean±standard deviation (SD). To determine the number of specimens for the proposed experiments, power analysis was conducted based on our preliminary data.
Example 11: Production of Scaffolds Having Microparticles with Enhanced Loading Capacity for Cytokines and Artificial Antigen Presenting Cells (aAPCs)
[0318] Implantable porous silica scaffolds were made as described herein. To create scaffolds with stimulatory capability, mesoporous silica microparticles were embedded in the pores of the scaffolds.
[0319] To enhance loading capacity of cytokines within these particles, their surfaces were modified with heparin (
[0320] To test the capacity of these heparin-conjugated particles, the key T cell growth factor IL-2 was loaded. Heparin modification improved loading by over 10-fold (
[0321] To provide T cells with activation signals, the surfaces of these mesoporous silica microparticles were also decorated with antibodies that stimulate T cell activation (anti-CD3 and anti-CD28). The silica particles themselves are known to safely degrade over time. Testing of degradation of these enhanced silica microparticles demonstrated that the particles' masses are lost over 15-20 days (
[0322] Loading efficiency on unmodified and heparin-functionalized silica microparticles was tested using IL-2 as the test compound.
[0323] The presence of heparin significantly increased the affinity of positively charged proteins, isoelectric point (pI)>7.5 (see, e.g., Majedi, F. S. et al. Cytokine Secreting Microparticles Engineer the Fate and the Effector Functions of T-Cells. Adv. Mater. 30, 1703178 (2018); Hasani-Sadrabadi, M. M. et al. Mechanobiological Mimicry of Helper T Lymphocytes to Evaluate Cell-Biomaterials Crosstalk. Adv. Mater. 30, 1-10 (2018)). To prepare IL-2 loaded silica microparticles, microparticles were incubated with cytokine in PBS buffer containing bovine serum albumin (BSA; 0.1% w/v) and were gently shaken overnight at 4° C. The microparticles were then centrifuged and washed several times to remove unabsorbed cytokines. The concentration of IL-2 in the removed supernatant was measured using enzyme-linked immunosorbant assay (ELISA) to estimate the binding capacity of microparticles. Here, heparin-functionalized mesoporous silica microparticles (5 μm [microns] in diameter) were synthesized and optimized to encapsulate and deliver IL-2 (
[0324] Change in physical properties of silica particles summarized in TABLE 1. Heparin-based conjugates (silica-heparin) was developed at several conjugation densities (
TABLE-US-00002 TABLE 1 Change in physical characteristics of mesoporous silica microparticles after surface functionalization with APTES and heparin. Diameter Pore Diameter Surface Area Pore Volume (μm) (nm) (m.sup.2/g) (ml/g) 5 11.5 384 1.1 15 9 430 0.97 Pore Diameter Surface Area Volume (nm) (m.sup.2/g) (ml/g) Unmodified 11.5 384 1.1 Anime-modified 10.4 250 0.65 Heparin-functionalized 7.9 119 0.23
Example 12: Silica-Heparin Particles are Potent aAPCs for In Vitro T Cell Expansion
[0325] The activation of CD8 T cells following co-culturing with silica-based microparticles was studied. To serve as aAPCs the surfaces of IL-2 loaded silica-heparin beads were decorated with aCD3/aCD28 to provide the anchor for T cells through which they can engage with the beads and get activated as a result (
[0326] To evaluate the efficiency of these aAPCs in vitro, they were co-cultured with CD8+ and CD4+ T cells under various conditions. Plain silica-heparin particles, IL-2 loaded silica-heparin particles, aCD3/aCD28 decorated silica-heparin particles free of IL-2, and DYNABEADS™ supplemented with free IL-2 were compared with IL-2 loaded, aCD3/aCD28 decorated silica-heparin particles (
[0327] These particles strongly interacted with T cells and induced activation and proliferation of naive T cells. The presence of IL-2 helped reduce the population of undivided cells and resulted in an increased expression of activation markers such as CD25 on activated T cells (
Example 13: 3D Scaffolds for T Cell Expansion Mimic Conditions of Lymph Nodes
[0328] These particles provided activation cues for cultured T cells, but in order to mimic the natural niche that T cells experience during their activation, the activation platform was transformed into a 3D matrix. Here, a biocompatible alginate scaffold was engineered, which was further decorated with 0.06 μmole RGD per mg alginate RGD peptides to facilitate T cell attachment and trafficking. To achieve the optimal physical properties the stiffness of the hydrogel was engineered to be similar to the stiffness that T cells experience in lymph nodes during activation (see, e.g., Meng, K. P., Majedi, F. S., Thauland, T. J. & Butte, M. J. Mechanosensing through YAP controls T cell activation and metabolism. J. Exp. Med. 217, (2020)). Here, 40 mM calcium sulfate (CaSO4) was used as a crosslinker which resulted in relatively stiff (40 kPa) gels (see, e.g., Majedi, F. S. et al. T-cell activation is modulated by the 3D mechanical microenvironment. bioRxiv 580886 (2019)). The 3D porosity was then created by lyophilization to let the cells experience 3D trafficking while receiving the activation signals (
Example 14: Post-Conjugation of 3D Scaffolds to Ensure Availability of Antibodies to T Cells for T Cell Expansion
[0329] To overcome any unavailability, the 3D scaffolds were post-conjugated with anti-CD3/CD28 antibodies to ensure the availability of these antibodies to T cells. As for longer term in vivo treatments where the scaffold starts to degrade, embedded aAPC beads can also become available to cells (
Example 15: Proliferation, Activation, and Cytokine Secretion of Both CD8+ and CD4+ T Cells in the 3D Scaffolds for Improved T Cell Expansion
[0330] Proliferation, activation, and cytokine secretion of both CD8+ and CD4+ T cells was compared in the designed 3D scaffolds under different conditions (
[0331] The release rate of IL-2 from the 3D alginate-RGD scaffold loaded with aAPCs was measured over time using ELISA (
[0332] Due to the huge surface area that our microporous scaffold offers, T cell's expansion was improved by up to 9-fold upon scaffold post conjugation (
Example 16: Stiffness and Functionality Maintained in 3D Scaffolds Over Time
[0333] To optimize mechanical stiffness to be similar to that of lymph nodes, this feature was tested over time to determine the effects of particle dispersion within the scaffolds. While post-conjugation of scaffolds did not change their stiffness, loading of aAPCs within them slightly increased their stiffness (
Example 17: Functionality of 3D Scaffolds Maintained Following X-Ray Sterilization
[0334] For sterilization of scaffolds, X-ray irradiation (GULMAY MEDICAL™ RS320 x-ray unit) was used to irradiate the fabricated scaffolds before in vitro or in vivo functional tests, following ISO 11137-2:2013 recommended protocols (Corrigendum, T. Sterilization ofhealthcare products—Radiation—Part 2: Establishing the sterilization dose. Order A J. Theory Ordered Sets Its Appl. (2009); European Committee for Standardization. Sterilization of health care products—Radiation. BE EN ISO 11137-2:2013 (2013)). A sterilization dose of 25 kGy (2.5 Mrads) was used, because it has been reported that this dose does not alter the properties of pharmaceuticals (see, e.g., Abuhanoglu, G. & Özer, A. Y. Radiation effects on pharmaceuticals. Fabad Journal of Pharmaceutical Sciences (2010)). Physical and biological properties, including changes in mechanical stiffness or change in T cell activation after sterilization process, were tested. Results showed non-significant changes in mechanical properties of scaffolds after receiving three cycles of 25 kGy sterilization dose (
Example 18: Localized Delivery In Vitro of Immunostimulants in 3D Scaffolds
[0335] Another hurdle ordinarily faced in the treatment of most solid tumors is the abundance of TGF-β which plays a key role in induction of Tregs in tumor microenvironment and leads to immune suppression (see, e.g., Park, J. et al. Combination delivery of TGF-β inhibitor and IL-2 by nanoscale liposomal polymeric gels enhances tumour immunotherapy. Nat. Mater. 11, 895-905 (2012)). TGF-β abundance and activity has been well documented in a number of murine tumor models (see, e.g., Park, J. et al. Combination delivery of TGF-β inhibitor and IL-2 by nanoscale liposomal polymeric gels enhances tumour immunotherapy. Nat. Mater. 11, 895-905 (2012); Gorelink, L. & Flavell, R. A. Immune-mediated eradication of tumors through the blockade of transforming growth factor-β signaling in T cells. Nat. Med. (2001). doi:10.1038/nm1001-1118; Liu, V. C. et al. Tumor Evasion of the Immune System by Converting CD4+CD25− T Cells into CD4+CD25+T Regulatory Cells: Role of Tumor-Derived TGF-β. J. Immunol. (2007). doi:10.4049/jimmunol.178.5.2883; Yingling, J. M., Blanchard, K. L. & Sawyer, J. S. Development of TGF-β signalling inhibitors for cancer therapy. Nature Reviews Drug Discovery (2004). doi:10.1038/nrd1580) and may be a key counteracting player in IL-2 therapies where they seek to enhance CTLs activity. TGF-β in tumor cell growth and maintaining an immunologically cold tumor microenvironment plays a pivotal role (see, e.g., Yingling, J. M., Blanchard, K. L. & Sawyer, J. S. Development of TGF-β signalling inhibitors for cancer therapy. Nature Reviews Drug Discovery (2004). doi: 10.1038/nrd1580; Kano, M. R. et al. Improvement of cancer-targeting therapy, using nanocarriers for intractable solid tumors by inhibition of TGF-0 signaling. Proc. Natl. Acad. Sci. U.S.A (2007). doi:10.1073/pnas.0611660104).
[0336] While the exact source of TGF-β in a tumor microenvironment and the immunoprotective pathways behind its signaling blockade are not fully known, studies on combinatorial delivery of a TGF-β receptor-I inhibitor SB505124 plus an immunostimulant such as IL-2 has shown promising results in mouse melanoma model (see, e.g., Park, J. et al. Combination delivery of TGF-β inhibitor and IL-2 by nanoscale liposomal polymeric gels enhances tumour immunotherapy. Nat. Mater. 11, 895-905 (2012); Town, T. et al. Blocking TGF-β-Smad2/3 innate immune signaling mitigates Alzheimer-like pathology. Nat. Med. (2008). doi:10.1038/nm1781). However, the toxicity of systemic administration of immunostimulants, which block their therapeutic effects and use, has been widely reported (see, e.g., https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3909428/).
[0337] The scaffold enables efficient, overtime, local delivery of these agents in the tumor bed (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3909428/).
[0338] Here two of the commercially available TGF-β inhibitors, SB505124 and LY2157299 (Galunisertib) (see, e.g., Stauber, A. J., Credille, K. M., Truex, L. L., Ehlhardt, W. J. & Young, J. K. Nonclinical Safety Evaluation of a Transforming Growth Factor β Receptor I Kinase Inhibitor in Fischer 344 Rats and Beagle Dogs. J. Clin. Toxicol. 04, (2014); Rodón, J. et al. Pharmacokinetic, pharmacodynamic and biomarker evaluation of transforming growth factor-β receptor i kinase inhibitor, galunisertib, in phase 1 study in patients with advanced cancer. Invest. New Drugs (2015). doi:10.1007/s10637-014-0192-4; Yingling, J. M. et al. Preclinical assessment of galunisertib (LY2157299 monohydrate), a first-in-class transforming growth factor-β receptor type I inhibitor. Oncotarget (2018). doi:10.18632/oncotarget.23795; Can be tuned to be in the range of 2 weeks to 6 months), were tested at different doses (
[0339] Due to the hydrophobic nature of this drug (LY2157299), poly(lactic-co-glycolic acid (PLGA) was selected as a carrier to load and release the selected TGF-β inhibitors. PLGA renders a slow, controlled biodegradation due to its compact structure. TGF-βi encapsulated PLGA nanoparticles with the size of about 200 nm were then fabricated and tested for their suppression capability against Treg formation (
Example 19: Reduced Tregs in the Presence of 3D Scaffolds Due to Sustained Local Release
[0340] Once their functionality was confirmed in vitro, the particles with LY2157299 were loaded within the 3D scaffolds along with IL-2 releasing silica-heparin micro particles (
Example 20: 3D Scaffolds Enriched with Chemoattractant Tested for Both Active and Naïve T Cell Recruitment
[0341] Once the capability of the 3D formulation for T cell activation, proliferation, and Treg suppression had been confirmed, the next step to make them suitable for in vivo functionality was to advertise them for the tissue resident T cells. To this end, the scaffolds were enriched with chemokine (C-C motif) ligand 21 (CCL21) as a chemoattractant to guide naive and active T cells (Weninger, W. et al. Naive T Cell Recruitment to Nonlymphoid Tissues: A Role for Endothelium-Expressed CC Chemokine Ligand 21 in Autoimmune Disease and Lymphoid Neogenesis. J. Immunol. (2003). doi:10.4049/jimmunol.170.9.4638; Liu, C. et al. The role of CCL21 in recruitment of T-precursor cells to fetal thymi. Blood (2005). doi: 10.1182/blood-2004-04-1369) towards the synthetic lymph node. Different concentrations of CCL21 were mixed with alginate-RGD scaffold and were tested for both active and naive, CD8+ or CD4+ T cell recruitment using a transwell setup (
[0342] Because these scaffolds were designed to be implanted adjacent to the tumor tissue, recruitment of B16F10-OVA cells was also tested as a control, demonstrating that CCL21 have no significant effect on tested tumor cells (
Example 21: Implanting Synthetic Lymph Nodes for In Vivo T Cell Training
[0343] Upon demonstrating the scaffolds to be successful in vitro in terms of T cell recruitment, activation, expansion, and Treg suppression (
[0344] Typically, mice received subcutaneous injections of B16-F10 cells to their right flank followed by the scaffold implantation adjacent to the tumor once it was palpable. Without any further treatment animal's health was monitored and were euthanized 17 days afterwards. Implanted scaffolds, tumors, tumors' draining lymph nodes, and spleens were then retrieved for further studies (
[0345] Hematoxylin and eosin (H&E) staining of the scaffold adjacent to the tumor showed successful tissue integration and recruitment of T cells via the implanted microporous scaffolds (
Example 22: Clearance of Tumors In Vivo
[0346] In this set of studies, blank scaffolds free of any particles or chemokines were used as controls along with PBS control. Tumor representative images were taken at the end of the experiments, their masses were measured (
Example 23: Status of Cells Recruited by Implanted Synthetic Lymph Nodes (ISL)
[0347] The status of recruited cells by our implanted synthetic lymph nodes (ISL) was assessed (
Example 24: Activation of T Cells Recruited by the Implanted Synthetic Lymph Nodes
[0348] Tumor clearance potency of the implanted synthetic lymph nodes (ISL) was interesting as the scaffold offers polyclonal activation and expansion of endogenous T cells via conjugated anti-CD3/CD28 antibodies while providing IL-2 cytokine.
[0349] Despite the lack of tumor specific training, T cells that were recruited and trained in the ISL recognized the tumor and were capable of clearing it, suggesting that any changes might have happened to the population of endogenous tumor reactive T cells and that recruiting endogenous T cells in the ISL adjacent to the tumor allowed for dual exposure of them to both anti-CD3/CD28 antibodies which is provided by the ISL and antigens presented on the tumor simultaneously. As a result, either T cells had higher chances of recognizing tumor cells and killing them, or the ISL was recruiting and expanding tissue resident T cells which along the way results in activation and expansion of tumor-specific resident T cells and this plus suppression of Treg population is enough to suppress the tumor growth and clear it.
[0350] In order to confirm activation of the recruited T cells by the ISL the level of CD44 expression as an activation marker was assessed (
[0351] Moreover, the population of endogenous OTI T cells within the scaffold were no different from the control scaffold (
Example 25: Characterization of Tumor Infiltrated T Cells
[0352] Mice bearing B16-F10-Ova tumors were euthanized 22 days after tumor injection. Three out of the seven mice that received the ISL had absolutely no tumor. Detectable tumors in the remainder of mice were then lysed and checked for the presence of polyclonal or tumor specific T cells (
[0353] We then assessed the level of granzyme B (GZMB) expression of tumor infiltrating T cells in our ISL and we found a 40 percent increase in activated GZMB+ T cells (
Example 26: Reduction of Immunosuppression by Tumor Cells
[0354] One of the major hurdles in most solid tumors, such as melanoma, is the immunosuppressive environment which tumor cells promote by inducing formation of Treg. In the scaffold platform, TGF-βi (LY2157299) releasing PLGA nanoparticles were designated to reverse tumor's immunosuppressive environment to an immunostimulant one to observe the effects of the ISL in rearranging T cell population around the tumor microenvironment. Treg population was observed to have been suppressed by about 30 percent with the scaffold formulation that carries TGF-βi (
Example 27: Effects of Scaffolds on CD8+ T Cells and OT-I Cells in Tumor Draining Lymph Nodes
[0355] Furthermore, to determine whether local treatment caused any changes in the population of activated T cells elsewhere a study was performed to assess whether there were CD8+ T cells in the draining lymph node (
Example 28: Observations of Scaffolds with Respect to Potential Side Effects or Autoimmune Reactions
[0356] One of the major challenges that hampers the therapeutic efficacy of systemic administration of small molecules is the side effects that come with them due to their off-target distribution in other tissues. There was no observation of any meaningful changes in the percentages of GZMB+ or PD-1 expressing T cells in our ISL vs. control scaffold or PBS control (
[0357] As systemic administration of TGF-βi can result in autoimmune disease (Wrzesinski, S. H., Wan, Y. Y. & Flavell, R. A. Transforming growth factor-β and the immune response: Implications for anticancer therapy. Clinical Cancer Research (2007). doi:10.1158/1078-0432.CCR-07-1157), the local release of TGF-βi adjacent to the tumor will result in suppression of Tregs in the draining lymph node was assessed. Results showed no significant changes in Treg populations in the draining lymph node (
Example 29: Effects of the Scaffolds on the Spleen
[0358] Additionally, changes in the population of T cells in the spleen were assessed, and it was found that activated CD8+ T cells were slightly (about 6%) increased using the ISL compared to control scaffold (
[0359] Moreover, no significant changes in the population of activated, GZMB+ T cells or PD-I expressing CD8+ T cells were observed in the spleen using the ISL vs. control conditions (
Example 30: Scaffolds with Chemokines Recruit T Cells
[0360] In order to advertise the scaffolds specifically for T cells, chemokine (C-C motif) ligand 21 (CCL21) was selected as a chemokine. CCL21, as one of the major ligands of C-C chemokine receptor type 7 (CCR7), is considered as the principal integrin activating chemokine. CCL21 has a possible role in recruitment of effector cells (Lin, Y., Sharma, S. & John, M. S. CCL21 cancer immunotherapy. Cancers (2014). doi:10.3390/cancers6021098; Novak, L., Igoucheva, O., Cho, S. & Alexeev, V. Characterization of the CCL21-mediated melanoma-specific immune responses and in situ melanoma eradication. Mol. Cancer Ther. (2007). doi:10.1158/1535-7163.MCT-06-0709). On the other hand, stromal cell-derived factor 1 alpha (SDF-1α) is another common chemokine known to regulate migration of many types of cells, especially progenitor cells (Cencioni, C., Capogrossi, M. C. & Napolitano, M. The SDF-1/CXCR4 axis in stem cell preconditioning. Cardiovasc. Res. 94, 400-407 (2012); Dunussi-Joannopoulos, K. et al. Efficacious immunomodulatory activity of the chemokine stromal cell-derived factor 1 (SDF-1): local secretion of SDF-1 at the tumor site serves as T-cell chemoattractant and mediates T-cell-dependent antitumor responses. Blood 100, 1551-1558 (2002)). To verify which chemokine serves our purpose best, all the components of the scaffolds were maintained identically except for the chemokine. As shown in
[0361] However, the percentage of recruited CD8+ via CCL21 was slightly higher and the population of non-CD8+ cells recruited in the scaffolds containing SDF-1α were visibly higher (
Example 31: Stability of Stored Scaffolds Over Time
[0362] In order to test the stability and shelf-life of lyophilized scaffolds after 6-months in 4° C. both fresh and 6-month old scaffolds were implanted in mice and checked for their capability of T cell recruitment and activation (
[0363] As shown in
[0364] The fact that the percentage of activated GZMB+ T cells and Tregs in the tumors were similar in old vs. fresh scaffolds confirms that the scaffolds preserve the functionality of loaded drugs and chemokines to a great extent (
Example 32: Treatment of the Primary Tumor with a Scaffold Suppresses a Secondary Tumor
[0365] In order to assess the impact of local boosting of T cells adjacent to the primary tumor on formation of systemic immunity, mice were inoculated with a second tumor contralateral to the primary one on the same day on which the scaffolds were implanted (
[0366] Strikingly, tumor growth in the secondary tumor was suppressed by about 40 percent upon local treatment of the primary tumor with scaffolds. Percentage of tumor-infiltrating CD8+ T cells was increased by more than two times in the contralateral tumor of the mice that received scaffold treatment (
[0367] The population of activated GranzymeB secreting CD8+ T cells was considerably improved in the contralateral tumor, as well as primary tumor, which indicates that some of the tumor recognizing T cells that were trained adjacent to primary tumor were able to travel to the distant tumor (
[0368] The population of Tregs in both tumors was also studied. Because the release of TGFβi is local to the primary tumor where the scaffold is implanted, suppression of regulatory T cells was only observed in the primary tumor, and no significant difference was noticed in the secondary tumor (
[0369] The T cells recruited by scaffolds were studied further (
[0370] The populations of central memory T cells were also noticeably higher in the draining lymph nodes of both primary and secondary confirming the idea that local treatment has partially resulted in systemic immunization against the tumor (
[0371] With respect to the spleen, while the population of CD8+ T cells were improved in the mice treated with full scaffolds (
Example 33: ISL Boosts the Efficacy of Adoptive T Cell Therapy
[0372] ISL offers the capability of not only facilitating tumor infiltration by T cells and T cell expansion, but also renders the possibility of recruiting naïve tissue/tumor resident T cells and activating them while hampering the immunosuppressive microenvironment of the tumor.
[0373] Melanoma model mice were injected subcutaneously with 2×10.sup.5 (2×105) Ova peptide expressing B16-F10 melanoma cells followed by OTI T cell-loaded ISLs once the tumor was palpable (day 5), when mice were randomized to four groups. Mice were sedated and received a small incision next to the just-palpable tumor and either a TGF-βi or plain Alg-RGD scaffold was inserted (
[0374] The area and mass of the tumors were then tracked while a blank scaffold (loaded with OT-I CD8+ T cells but free of any modification), IV injection of OT-I T cells, and PBS were used as controls (
[0375] The populations of tumor infiltrating T cells were studied (
[0376] The population of activated tumor infiltrating CD8+ T cells was studied (
[0377] The FACS representatives clearly demonstrated that a considerably smaller number of activated T cells reached and infiltrated tumors upon IV injection of OTIs compared to their local delivery within scaffolds. Treg in the tumors was reduced two-fold and no significant chance in Tregs in the proximal lymph node or spleen (
[0378] Interestingly, even when gated only on V-alpha2+(Vα2+) OTI T cells present in the tumor, a higher percentage of those preactivated OTI stayed active in the tumor upon local delivery via scaffolds compared to IV injection (
[0379] As a measure of tumor clearance, a terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) assay was used to observe DNA degradation in the groups. The TUNEL assay was used as a measure of apoptotic tumor cells where the microscopy images showed drastically higher percentage of tumor apoptosis in the full scaffold that delivered OTIs (
[0380] As a measure of the locality of the effects of the scaffolds, the tumor draining lymph node was studied further (
[0381] A similar trend was also observed in the spleens of mice treated with different formulations, where no meaningful differences were noted in the population of CD8+s, GZMB secreting T cells, and PD-1+ T cells in the mice treated with scaffolds, as compared to PBS controls, while IV injection of OTIs increased the population of GZMB+ T cells or PD-1 expressing T cells (
[0382] These studies show that the full scaffold had effects on the tumor but no effects on a distal lymph node or spleen. Thus, the local and not systemic activity of the scaffold of the invention is demonstrated.
[0383] While certain features of the invention have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those of ordinary skill in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes as fall within the true spirit of the invention.