SYNTHETIC HYDROGEL CARRIERS FOR BONE REPAIR
20190192738 ยท 2019-06-27
Inventors
Cpc classification
A61L2300/25
HUMAN NECESSITIES
A61L2300/412
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61L27/18
HUMAN NECESSITIES
A61M5/3294
HUMAN NECESSITIES
A61L27/18
HUMAN NECESSITIES
A61L2300/404
HUMAN NECESSITIES
A61L2430/02
HUMAN NECESSITIES
A61L27/227
HUMAN NECESSITIES
A61M5/19
HUMAN NECESSITIES
A61L2300/252
HUMAN NECESSITIES
A61L27/54
HUMAN NECESSITIES
International classification
A61L27/54
HUMAN NECESSITIES
A61L27/18
HUMAN NECESSITIES
A61L27/22
HUMAN NECESSITIES
A61M5/19
HUMAN NECESSITIES
Abstract
Disclosed herein are synthetic hydrogels suitable for delivering antimicrobial and/or bone regenerating agents to injured tissues.
Claims
1. A composition comprising an antibacterial protein, a bone morphogenetic protein, or a combination thereof, dispersed in a hydrogel matrix, wherein the hydrogel matrix comprises a crosslinked hydrophilic polymer network covalently bonded to a plurality of adhesion peptides.
2. The composition according to claim 1, comprising lysostaphin and at least one bone morphogenetic protein.
3. The composition according to claim 1, wherein the crosslinked hydrophilic polymer network has the general formula: ##STR00007## wherein polymer represents any hydrophilic polymer, C represents a core, Q represents a linker, Z represents an adhesion peptide, X represents a crosslinker, a is greater than 0, and b is greater than 1.
4. The composition according to claim 3, wherein the hydrophilic polymer comprises a multi-armed poly(ethylene glycol).
5. The composition according to claim 4, wherein the crosslinked hydrophilic polymer network has the general formula: ##STR00008## wherein C represents a core, n is an integer from 20-2,000, Q is a linking moiety, Z is an adhesion peptide, X is a crosslinker, a is greater than 0 and b is greater than 1, provided the sum of a+b does not exceed 7.
6. The composition according to claim 3, wherein C represents a group having the formula: ##STR00009## wherein q is from 1-6.
7. The composition according to claim 3, wherein Q represents a group having the formula: ##STR00010## wherein A is independent selected from O or NH, a is independently selected from 0 or 1, B is selected from hydrogen or methyl, and Z/X in each case independently represents either an adhesion peptide or crosslinker.
8. The composition according to claim 1, wherein the adhesion peptide comprises the amino acid sequence RGD.
9. The composition according to claim 1, wherein the adhesion peptide comprises the sequence GRGDSPC, CRGDS, CRGDSP, CPHSRN, CGWGGRGDSP, CGGSIDQVEPYSSTAQ, CGGRNIAEIIKDI, CGGDITYVRLKF, CGGDITVTLNRL, CGGRYVVLPR, CGGKAFDITYVRLKF, CGGEGYGEGYIGSR, CGGATLQLQEGRLHFXFDLGKGR, wherein X=Nle, CGGSYWYRIEASRTG, CGGGEFYFDLRLKGDKY, CKGGNGEPRGDTYRAY, CKGGPQVTRGDVFTMP, CGGNRWHSIYITRFG, CGGASIKVAVSADR, CGGTTVKYIFR, CGGSIKIRGTYS, CGGSINNNR, CGGSDPGYIGSR, CYIGSR, CGGTPGPQGIAGQGVV, CGGTPGPQGIAGQRVV, CGGMNYYSNS, CGGKKQRFRHRNRKG, CRGDGGGGGGGGGGGGGPHSRN, CPHSRNSGSGSGSGSGRGD, Acetylated-GCYGRGDSPG, ((GPP)5GPC), CRDGS, cyclic RGD{Fd}C, CGGRKRLQVQLSIRT, CIKVAV, CGGAASIKVAVSADR, CGGKRTGQYKL, CGGTYRSRKY,CGGYGGGP(GPP)5GFOGERPP(GPP)4GPC, CGGKRTGQYKLGSKTGPGQK, QAKHKQRKRLKSSC, SPKHHSQRARKKKNKNC, CGGXBBXBX, wherein B=basic residue and X=hydropathic residue, and CGGXBBBXXBX, wherein B=basic residue and X=hydropathic residue, or a combination thereof.
10. The composition according to claim 1, wherein the adhesion peptide comprises the amino acid sequence GRGDSPC.
11. The composition according to claim 3, wherein the crosslinker comprises an MMP- or cathepsin- or other protease-cleavable or non-cleavable peptide comprising at least two cysteine residues at each end of the sequence.
12. The composition according to claim 11, wherein the crosslinker comprises a peptide having the sequence GCRDGPQGIWGQDRCG, GCRDGPQGIAGQDRCG, GCRDVPMSMRGGDRCG, GCRDIPVSLRSGDRCG, GCRDRPFSMIMGDRCG, GCRDVPLSLTMGDRCG, GCRDVPLSLYSGDRCG, GCRDIPESLRAGDRCG, GCRDSGESPAYYTADRCG, GCRDGGYAELRMGGDRCG, GCRDGGPLGLYAGGDRCG, or GCRDGPLGLWARDRCG, 1,4-dithiothreitol poly(ethylene glycol) dithiol, or a combination thereof.
13. A composition comprising an antimicrobial protein, a bone morphogenetic protein, or a combination thereof, dispersed in a hydrogel matrix, wherein the hydrogel matrix is obtained by crosslinking a hydrophilic polymer conjugated to a plurality of adhesion peptides.
14. The composition according to claim 13, wherein the composition comprises lysostaphin and at least one bone morphogenetic protein.
15. The composition according to claim 13, wherein the hydrophilic polymer has the general formula: ##STR00011## wherein polymer represents any hydrophilic polymer, C represents a core, Q represents a linker, Z represents an adhesion peptide, Q.sup.1 represents a functional group capable of reacting with cysteine, and the sum of a.sup.1+b.sup.1 together is an integer of 3 or greater.
16. A method of repairing a tissue injury, comprising contacting the injured tissue with the composition of claim 1.
17. The method according to claim 16, wherein the tissue injury comprises a bone fracture.
18. The method according to claim 16, wherein the tissue injury is a segmental bone injury, and the composition is disposed within a hollow sleeve.
19. A method of repairing a tissue injury comprising combining a first solution comprising a hydrogel precursor having the formula: ##STR00012## wherein C represents a core, n is an integer from 20-2,000, Q is a linking moiety, Z is an adhesion peptide, X is a crosslinker, a is greater than 0 and b is greater than 1 Q.sup.1 is an electrophilic group capable of reacting with a thiol group; with a second solution comprising a crosslinker; wherein either of the first or second solutions comprise lysostaphin, a bone morphogenetic protein, or a combination thereof; and contacting injured tissue with the resulting mixture.
20. A lysostaphin delivery device comprising: a) a syringe comprising a hydrogel precursor; b) a mixing vessel comprising a crosslinking agent; and c) an injection needle; wherein either of the syringe or mixing vessel comprise lysostaphin, a bone morphogenetic protein, or a combination thereof; and wherein the syringe is in fluid communication with the mixing vessel and injection needle, in which the mixing vessel is disposed between the needle and syringe.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
DETAILED DESCRIPTION
[0033] Before the present methods and systems are disclosed and described, it is to be understood that the methods and systems are not limited to specific synthetic methods, specific components, or to particular compositions. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.
[0034] As used in the specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from about one particular value, and/or to about another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent about, it will be understood that the particular value forms another embodiment. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint.
[0035] Optional or optionally means that the subsequently described event or circumstance may or may not occur, and that the description includes instances where said event or circumstance occurs and instances where it does not.
[0036] Throughout the description and claims of this specification, the word comprise and variations of the word, such as comprising and comprises, means including but not limited to, and is not intended to exclude, for example, other additives, components, integers or steps. Exemplary means an example of and is not intended to convey an indication of a preferred or ideal embodiment. Such as is not used in a restrictive sense, but for explanatory purposes.
[0037] Disclosed are components that can be used to perform the disclosed methods and systems. These and other components are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these components are disclosed that while specific reference of each various individual and collective combinations and permutation of these may not be explicitly disclosed, each is specifically contemplated and described herein, for all methods and systems. This applies to all aspects of this application including, but not limited to, steps in disclosed methods. Thus, if there are a variety of additional steps that can be performed it is understood that each of these additional steps can be performed with any specific embodiment or combination of embodiments of the disclosed methods.
[0038] Disclosed herein are synthetic hydrogels capable of treating and preventing bacterial infection, as well as supporting bone regrowth and repair. The synthetic hydrogel can be used as a vehicle for the administration of medicaments such as antibiotics and therapeutic proteins to a patient in need thereof.
[0039] In some embodiments, the hydrogels disclosed herein can contain one or more antibacterial agents. Suitable antibacterial agents include antibacterial proteinsone such agent is lysostaphin, including variants thereof. Lysostaphin is an endopeptidase capable of specifically cleaving the cross-linking pentaglycine bridges in the cell walls of staphylococci. Because the cell wall bridges of S. aureus contain a high proportion of pentaglycine, lysostaphin is highly effective in lysing S. aureus, although activity against other species of staphylococci has been demonstrated. Moreover, lysostaphin does not require active bacterial growth to elicit its antibacterial effects. The term lysostaphin, as used herein, encompasses any enzyme or anti-staphylococcal agent having proteolytic activity, in vitro and in vivo, against glycine-containing bridges in the cell wall peptidoglycan of staphylococci. The compositions of the invention are therefore applicable against any bacteria susceptible to attack by lysostaphin activity. Lysostaphins within the scope of the invention encompass: wild-type lysostaphin and related proteins or anti-staphylococcal agents, lysostaphin mutants, variants, fully synthetic and partially synthetic lysostaphins, human or animal lysostaphins, and recombinantly expressed lysostaphin proteins. Lysostaphin variants may be generated by post-translational processing of the protein (either by enzymes present in a producer strain or by means of enzymes or reagents introduced at any stage of the process) or by mutation of the structural gene. Mutations may include site-deletion, insertion, point mutations, domain removal and replacement mutations. Lysostaphin includes, for example, lysostaphin purified from S. simulans, Ambicin L (recombinant lysostaphin produced in Bacillus sphaericus), and mature lysostaphin purified from a Lactococcus lactis expression system or an E. coli expression system, and truncated lysostaphin. In some instance, the lysostaphin can have the wild-type sequence:
TABLE-US-00001 (SEQID.57) AATHEHSAQWLNNYKKGYGYGPYPLGINGGMHYGVDFFMNIGTPVKAISS GKIVEAGWSNYGGGNQIGLIENDGVHRQWYMHLSKYNVKVGDYVKAGQII GWSGSTGYSTAPHLHFQRMVNSFSNPTAQDPMPFLKSAGYGKAGGTVTPT PNTGWKTNKYGTLYKSESASFTPNTDIITRTTGPFRSMPQSGVLKAGQTI HYDEVMKQDGHVWVGYTGNSGQRIYLPVRTWNKSTNTLGVLWGTIK.
[0040] In some embodiments, a lysostaphin variant can be employed, for instance a lysostaphin variant can a single amino acid substitution (e.g., any one of the amino acid substitutions described herein) when compared with the wild-type sequence, i.e., lysostaphin V-1; a lysostaphin variant can have two amino acid substitutions when compared with the wild-type sequence i.e., lysostaphin V-2. In other embodiments, a lysostaphin variant can have three amino acid substitutions when compared with the wild-type sequence i.e., lysostaphin V-3. In further embodiments, a lysostaphin variant can have four or more amino acid substitutions when compared with the wild-type sequence i.e., lysostaphin V-4+. In some embodiments, the lysostaphin can have an amino acid sequence that is at least 60%, more preferably at least 70%, more preferably at least 80%, more preferably 90%, more preferably at least 95% and most preferably 99% identical or homologous to the polypeptide sequence (SEQ. ID 57).
[0041] In some embodiments, other antibacterial proteins can be advantageously delivered using the inventive hydrogels, for instance endolysins, phage proteins, phage enzymatic formulations, and combinations thereof. Such proteins are often designated bacteriolytic enzymes. Bacteriolytic enzymes with activity against either gram-negative or gram-positive bacteria (or both) may be included in the inventive hydrogels. Exemplary enzymes include lytic enzymes such as lysozyme (muramidase or N-acetylmuramide glucanhydrolase)
[0042] In some embodiments, the hydrogels disclosed herein can include one or more bone morphogenetic proteins. As used herein, bone morphogenetic protein (i.e., BMP) includes wild-type proteins and variants thereof, active fragments of such wild-type and variants, or synthetic peptide mimetics thereof. A variety of osteogenic bone morphogenic proteins are known and can be used in embodiments herein either alone or in combinations of bone morphogenic proteins. The bone morphogenic protein can be or include any bone morphogenic protein, for instance: BMP-2, BMP-4, BMP-5, BMP-6, BMP-7, and/or BMP-9, preferably BMP-2. Recombinant human bone morphogenetic proteins (rhBMPs) can also be employed. Most preferably, the bone morphogenetic protein is rhBMP-2, rhBMP-4, or a heterodimer thereof. rhBMP-2 and rhBMP-7 are commercially available and such commercial forms can be used herein.
[0043] The synthetic hydrogels include a network of crosslinked hydrophilic polymer conjugated to adhesion peptides. Suitable hydrophilic polymers include polyalkylene glycol polymers, polyalkylene oxide homopolymers such as polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and block copolymers thereof, as well as poly(oxyethylated polyol), poly(olefinic alcohol), poly(vinylpyrrolidone), poly(hydroxypropylmethacrylamide), poly(-hydroxy acid), poly(vinyl alcohol), polyphosphazene, polyoxazoline, poly(N-acryloylmorpholine) and copolymers, terpolymers, and mixtures thereof. The molecular weight of the hydrophilic polymer can be from 1,000-1,000,000, from 1,000-500,000, from 1,000-250,000, from 1,000-150,000, from 1,000-100,000, from 1,000-50,000, from 5,000-100,000, from 5,000-50,000, from 10,000-100,000, from 10,000-50,000, from 20,000-100,000, from 20,000-80,000, from 20,000-60,000, from 20,000-40,000, or from 40,000-60,000.
[0044] In certain embodiments, the crosslinked hydrophilic polymer is a polyethylene glycol, i.e., PEG. The PEG can have a molecular weight from 1,000-1,000,000, from 1,000-500,000, from 1,000-250,000, from 1,000-150,000, from 1,000-100,000, from 1,000-50,000, from 5,000-100,000, from 5,000-50,000, from 10,000-100,000, from 10,000-50,000, from 20,000-100,000, from 20,000-80,000, from 20,000-60,000, from 20,000-40,000, or from 40,000-60,000.
[0045] In preferred embodiments, the crosslinked hydrophilic polymer is a branched or multi-arm polymer. As used herein, a multi-arm polymer describes a polymer having a central core with at least two polymers covalently attached thereto. Multi-arm polymers can have 2, 3, 4, 5, 6, 7, 8 or more polymer arms. Preferred multi-arm polymers, as defined above, include those with 4 arms. Generally, all of the polymers attached to the core are the same, but in some instances different hydrophilic polymers, as defined above, can be used. Suitable cores include those derived from polyols, including glycerol (3-arm), pentaerythritol (4-arm), tetraglycerol (6-arm), and hexaglycerol (8-arm). A particularly preferred polymer is a 4-arm PEG, having a total molecular weight from 1,000-1,000,000, from 1,000-500,000, from 1,000-250,000, from 1,000-150,000, from 1,000-100,000, from 1,000-50,000, from 5,000-100,000, from 5,000-50,000, from 10,000-100,000, from 10,000-50,000, from 20,000-100,000, from 20,000-80,000, from 20,000-60,000, from 20,000-40,000, or from 40,000-60,000.
[0046] In certain embodiments, the crosslinked hydrophilic polymer network can have the general formula:
##STR00001##
wherein polymer in each case independently represents any hydrophilic polymer, including those defined above, C represents a core, Q represents a linker, Z represents an adhesion peptide, X represents a crosslinker, a is greater than 0, and b is greater than 1. In some embodiments, the sum a+b is no greater than 3, no greater than 4, no greater than 5, no greater than 6, no greater than 7, no greater than 8, no greater than 9, or no greater than 10. In other embodiments, the sum a+b is at least 3, at least 4, at least 5, no at least 6, at least 7, at least 8, at least 9, or at least 10.
[0047] In some embodiments, the hydrophilic polymer can be a poly(ethylene glycol), i.e., networks having the formula:
##STR00002##
wherein C represents a core, n is an integer from 20-2,000, Q is a linking moiety, Z is an adhesion peptide, X is a crosslinker, a is greater than 0 and b is greater than 1. In some embodiments, the sum a+b is no greater than 3, no greater than 4, no greater than 5, no greater than 6, no greater than 7, no greater than 8, no greater than 9, or no greater than 10. In other embodiments, the sum a+b is at least 3, at least 4, at least 5, no at least 6, at least 7, at least 8, at least 9, or at least 10.
[0048] Suitable C groups can be derived from a polyol such as glycerol, pentaerythritol, sorbitol, mannitol, tetraglycerol, and hexaglycerol. In some instances, the core can have the general structure:
##STR00003##
wherein q is any integer, for instance 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 and represents a link to a hydrophilic polymer, as described above. Other suitable polyols include carbohydrates, including monosaccharides and di-saccharides, such as glucose, xylose, mannose, galactose, sucrose, maltose, trehalose and fructose, and cyclic polyols like cyclopropane-1,2,3-triol, cyclobutane-1,2,3,4-tetraol, cyclopentane-1,2,3,4-tetraol, cyclopentane-1,2,3,4,5-pentaol, cyclohexane-1,2,4,5-tetraol, cyclohexane-1,2,3,4,5,6-hexaol, and the like.
[0049] Suitable Q group include those formed via Michael addition between a nucleophilic group on the adhesion peptide or crosslinker, and a Michael acceptor bonded to the hydrophilic polymer. For instance, in some embodiments, Q represents a group having the formula:
##STR00004##
wherein A is independently selected from O or NH, a is independently selected from 0 or 1, B is selected from hydrogen or methyl, Z/X in each case independently represents either an adhesion peptide or crosslinker, and represents a link to a hydrophilic polymer, as described above.
[0050] In some embodiments, the adhesion peptide can include the sequence RGD. In some embodiments, the adhesion peptide can include GRGDSPC (SEQ. ID 1), CRGDS (SEQ. ID 2), CRGDSP (SEQ. ID 3), CPHSRN (SEQ. ID 4), CGWGGRGDSP (SEQ. ID 5), CGGSIDQVEPYSSTAQ (SEQ. ID 6), CGGRNIAEIIKDI (SEQ. ID 7), CGGDITYVRLKF (SEQ. ID 8), CGGDITVTLNRL (SEQ. ID 9), CGGRYVVLPR (SEQ. ID 10), CGGKAFDITYVRLKF (SEQ. ID 11), CGGEGYGEGYIGSR (SEQ. ID 12), CGGATLQLQEGRLHFXFDLGKGR, wherein X=Nle (SEQ. ID 13), CGGSYWYRIEASRTG (SEQ. ID 14), CGGGEFYFDLRLKGDKY (SEQ. ID 15), CKGGNGEPRGDTYRAY (SEQ. ID 16), CKGGPQVTRGDVFTMP (SEQ. ID 17), CGGNRWHSIYITRFG (SEQ. ID 18), CGGASIKVAVSADR (SEQ. ID 19), CGGTTVKYIFR (SEQ. ID 20), CGGSIKIRGTYS (SEQ. ID 21), CGGSINNNR (SEQ. ID 22), CGGSDPGYIGSR (SEQ. ID 23), CYIGSR (SEQ. ID 24), CGGTPGPQGIAGQGVV (SEQ. ID 25), CGGTPGPQGIAGQRVV (SEQ. ID 26), CGGMNYYSNS (SEQ. ID 27), CGGKKQRFRHRNRKG (SEQ. ID 28), CRGDGGGGGGGGGGGGGPHSRN (SEQ. ID 29), CPHSRNSGSGSGSGSGRGD (SEQ. ID 30), Acetylated-GCYGRGDSPG (SEQ. ID 31), ((GPP)5GPC) (SEQ. ID 32), CRDGS (SEQ. ID 33), cyclic RGD{Fd}C (SEQ. ID 34), CGGRKRLQVQLSIRT (SEQ. ID 35), CIKVAV (SEQ. ID 36), CGGAASIKVAVSADR (SEQ. ID 37), CGGKRTGQYKL (SEQ. ID 38), CGGTYRSRKY (SEQ. ID 39), CGGYGGGP(GPP)5GFOGERPP(GPP)4GPC (SEQ. ID 40), CGGKRTGQYKLGSKTGPGQK (SEQ. ID 41), QAKHKQRKRLKSSC (SEQ. ID 42), SPKHHSQRARKKKNKNC (SEQ. ID 43), CGGXBBXBX, wherein B=basic residue and X=hydropathic residue (SEQ. ID 44), and CGGXBBBXXBX, wherein B=basic residue and X=hydropathic residue (SEQ. ID 45). In some preferred embodiments, the adhesion peptide includes the sequence GRGDSPC. In some instances, the hydrogel can include two or more different adhesions peptides.
[0051] Suitable crosslinkers include enzymatically cleavable and non-cleavable peptide sequences. The peptide sequences will generally include a cysteine residue at each end of the sequence. Exemplary cleavable peptides include those that are cleavable by MMP, cathepsin, or other protease. Although the cysteine may be the final amino acid residue at each end of sequence, it is more preferable that the crosslinking peptides are terminated with a glycine or other inert residue. In some embodiments, the enzymatically cleavable peptide will include the dipeptide A-V, N-V, K-V, or Cit-V, in which Cit refers to citrulline. In other embodiments, the crosslinking peptides can include the sequences GCRDGPQGIWGQDRCG (SEQ. ID 46), GCRDGPQGIAGQDRCG (SEQ. ID 47), GCRDVPMSMRGGDRCG (SEQ. ID 48), GCRDIPVSLRSGDRCG (SEQ. ID 49), GCRDRPFSMIMGDRCG (SEQ. ID 50), GCRDVPLSLTMGDRCG (SEQ. ID 51), GCRDVPLSLYSGDRCG (SEQ. ID 52), GCRDIPESLRAGDRCG (SEQ. ID 53), GCRDSGESPAYYTADRCG (SEQ. ID 54), GCRDGGYAELRMGGDRCG (SEQ. ID 55), GCRDGGPLGLYAGGDRCG (SEQ. ID 56), GCRDGPLGLWARDRCG (SEQ. ID 57), wherein represents a cleavable amide bond. In some embodiments, the crosslinker is a not a peptide, for instance a di-mercapto compound such as a 1,4-dithiothreitol (1,4-dimercapto-2,3-butanediol) or poly(ethylene glycol) dithiol. In some cases, the hydrogel can include two or more cleavable crosslinkers.
[0052] The compositions can include water in an amount of at least 70% by weight relative to the total weight of the composition. In some embodiments, the water can be present in an amount of at least 75%, at least 80%, at least 85%, at least 87.5%, at least 90%, at least 92.5%, or at least 95% by weight relative to the total weight of the composition. In some embodiments, the compositions will include the hydrophilic crosslinked polymer network in an amount no greater than 30%, no greater than 25%, no greater than 20%, no greater than 15%, no greater than 12.5%, no greater than 10%, no greater than 7.5%, or no greater than 5%, by weight relative to the total volume of the hydrogel. In certain embodiments, the crosslinked hydrophilic polymer network is present in an amount from 1-8%, from 2-7%, from 2-6%, from 3-6%, from 3-5%, or from 3.5-4.5% polymer weight by total volume of the composition. In certain embodiments, the crosslinked hydrophilic polymer network is present in an amount of about 4% polymer weight by total volume of the composition.
[0053] Lysostaphin may be present in the hydrogel in a variety of concentrations. For instance, the lysostaphin may be present in a concentration of at least 10 U/mL, at least 25 U/mL, at least 50 U/mL, at least 100 U/mL, at least 150 U/mL, at least 200 U/mL, at least 250 U/mL, at least 300 U/mL, at least 350 U/mL, at least 400 U/mL, at least 450 U/mL, at least 500 U/mL, at least 550 U/mL, at least 600 U/mL, at least 650 U/mL, at least 700 U/mL, at least 750 U/mL, at least 800 U/mL, at least 850 U/mL, at least 900 U/mL, at least 950 U/mL, or at least 1,000 U/mL. In some embodiments, the lysostaphin is present in a concentration from 10-1,000 U/mL, from 50-1,000 U/mL, from 100-1,000 U/mL, from 200-1,000 U/mL, from 300-1,000 U/mL, from 400-1,000 U/mL, from 500-1,000 U/mL, from 50-750 U/mL, from 150-750 U/mL, or from 250-750 U/mL.
[0054] Bone morphogenetic protein, especially BMP-2, may be present in the hydrogel in a variety of concentrations. For instance, the bone morphogenetic protein may be present in a concentration of at least 10 ng/mL, at least 25 ng/mL, at least 50 ng/mL, at least 75 ng/mL, at least 100 ng/mL, at least 150 ng/mL, at least 200 ng/mL, at least 250 ng/mL, at least 300 ng/mL, at least 350 ng/mL, at least 400 ng/mL, at least 450 ng/mL, or at least 500 ng/mL. In some embodiments, the bone morphogenetic protein may be present in a concentration from 10-500 ng/mL, from 25-500 ng/mL, from 50-500 ng/mL, from 75-500 ng/mL, from 100-500 ng/mL, from 150-500 ng/mL, from 200-500 ng/mL, from 250-500 ng/mL, from 50-250 ng/mL, or from 150-250 ng/mL.
[0055] The crosslinked networks disclosed herein may be prepared by first conjugating an adhesion peptide to a hydrophilic polymer having the formula:
CpolymerQ.sup.1].sub.c ,
wherein C and polymer are as defined above, c is an integer greater than or equal to 3, and Q.sup.1 is an electrophilic group capable of reacting with a thiol group. In some embodiments, the hydrophilic polymer is PEG, i.e., a compound of formula:
C(CH.sub.2CH.sub.2O).sub.NQ.sup.1].sub.c,
wherein C, n, c, and Q.sup.1 are as defined above. In some embodiments, Q.sup.1 represents a group having the formula:
##STR00005##
wherein A is independently selected from O or NH, a is independently selected from 0 or 1, B is selected from hydrogen or methyl, and represents a link to a hydrophilic polymer, as described above.
[0056] The adhesion peptide can contain a single cysteine residue or thiol group, and will be combined such that there is a molar excess of Q.sup.1 groups relative to cysteine/thiol groups in the adhesion peptide. For instance, molar ratio of Q.sup.1 groups to cysteine/thiol residues can be from 10:1 to 1.5:1, from 8:1 to 1.5:1, from 6:1 to 1.5:1, from 4:1 to 1.5:1, from 3:1 to 1.5:1, from 2.5:1 to 1.5:1, from 5:1 to 2:1, from 5:1 to 3:1, or from 5:1 to 4:1. The molar ratio of nucleophilic groups in the crosslinker to unreacted Q.sup.1 groups (assuming complete reaction with adhesion peptide) can be 1:1, greater than 1:1, e.g., 1.1:1, 1.2:1, or 1.5:1, less than 1:1, e.g., 0.9:1, 0.8:1, or 0.5:1, from 0.5:1 to 1.5:1, from 0.75:1 to 1.25:1, from 0.5:1 to less than 1:1, or from 1.5:1 to greater than 1:1.
[0057] Each of the hydrophilic polymer, adhesion peptide, crosslinker, lysostaphin, and bone morphogenetic protein can be separately combined with an appropriate aqueous solution, generally buffered to a pH from 5.0-8.0, from 5.0-7.0, from 5.0-6.5, from 5.0-6.0, from 5.5-6.0, from 5.5-6.5, from 6.5-7.5, from 7.2-7.6, or from 7.3-7.5. Any physiologically compatible buffer may be used, such as 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES), phosphate buffers, carbonate buffers, tromethamine (tris) buffers, including those formed with EDTA and an acid such as acetic acid, boric acid, and the like.
[0058] The relative ratios of the components may be as follows:
TABLE-US-00002 Volume fraction of Concentration factor of Hydrogel component hydrogel component hydrogel component Hydrophilic polymer 0.3-0.5 2.5 Adhesion peptide 0.15-0.25 5 Crosslinker 0.15-0.25 5
[0059] The hydrophilic polymer may be combined with a solution of adhesive peptide such that the final adhesive peptide concentration is from 0.1-100 mM, from 0.5-75 mM, from 1-50 mM, from 5-25 mM, or from 7.5-15 mM, based on the total volume of the hydrogel. The mixture can be incubated at a temperature from 23-50 C., from 28-45 C., from 32-40 C., or at 37 C. for at least 5 minutes, at least 10 minutes, at least 15 minutes, or at least 20 minutes. The resulting product is designated the hydrogel precursor, which has the following structure:
##STR00006##
wherein C, polymer, n, Q, Q.sup.1, Z, a, and b have the meanings given above. The hydrogel precursor may be directly converted to a hydrogel by combination with the crosslinker, or may first be combined with lysostaphin and/or bone morphogenetic protein and subsequently combined with the crosslinker to form the hydrogel.
[0060] The compositions disclosed herein may be used to promote wound healing and tissue repair, especially for injured or diseased bone tissue. Injured bone tissue include bone fractures, such as stress fractures, greenstick fractures, buckle fractures, growth plate fractures, comminuted fractures, avulsion fracture, compression fracture, hairline fracture, impacted fracture, intraarticular fracture, spiral fracture, transverse fractures, oblique fractures, and pathologic fractures. In addition to the lysostaphin and/or bone morphogenetic protein, the hydrogel composition may further include additional therapeutics to facilitate healing and prevent infection. Suitable additional therapeutics include additional growth factors, additional antibiotics, antivirals, analgesics, cytokines, enzymes, aptamers, nucleic acids, and combinations thereof.
[0061] In some instances, a preformed hydrogel composition may be directly contacted with the site of tissue injury. In other instances, the composition may be administered subcutaneously adjacent or proximate to the injury. In some embodiment the hydrogel precursor is combined with the crosslinker at the site of injury at the time of administration. In such embodiments, the lysostaphin and/or bone morphogenetic protein may be first combined with either of the hydrogel precursor or crosslinker. A preferred method includes an in vivo hydrogel formation. The hydrogel precursor is loaded into a dispensing means, for instance a syringe, which is in fluid communication with a needle by way of a tube. Inside the tube is loaded the crosslinker, such that when the hydrogel precursor is expelled from the syringe, it combines with the crosslinker solution and is ejected from the needle into the directed site. The active agents, i.e., antibacterial protein and/or bone morphogenetic protein, may be combined with either the hydrogel precursor, crosslinker, or both.
[0062] Management of bone injuries and disease may require the use of an internal fixation device, such as, Kirschner wires (K-wires), pins, intramedullary rods or nails, cerclage wire, plates, wraps, and screws to stabilize bone fragments. These fixation devices may be loaded, coated, or otherwise impregnated with the hydrogel compositions described herein. In some embodiment, the fixation device will include one or more hollow chambers having one or more openings. The hydrogel can be loaded in the chamber, wherein it or constituent parts will gradually exit the chamber.
[0063] The hydrogels disclosed herein may also be used in the context of a bone graft. The hydrogel may be loaded or formed inside a wrap or sleeve, which is then placed over or around the damage tissue. In cases in which a segment of bone is completely removed, either due to severe injury or disease, the sleeve may be used to join the severed ends of the bone, with the hydrogel contained within the sleeve. Over time, bone tissue is regenerated within the sleeve, ultimately connecting the severed ends. The sleeve may be shaped to correspond to the outer surface of the missing bone fragment. The sleeve may further contain one or more openings, for instance holes or slots.
EXAMPLES
[0064] The following examples are for the purpose of illustration of the invention only and are not intended to limit the scope of the present invention in any manner whatsoever.
[0065] S. aureus strains UAMS-1 (ATCC 49230) and Xen29 (Perkin-Elmer) were grown at 37 C. on TSA or Luria-Burtani (LB) agar supplemented with 50 g/mL kanamycin, respectively.
Example 1: Lysostaphin and BMP-2 Co-Delivering Hydrogel Synthesis
[0066] Hydrogels were synthesized using 4-arm 20 kDa poly(ethylene glycol)-maleimide (PEG-4MAL) macromer (Lysan Bio) functionalized with the collagen-mimetic peptide GGYGGP(GPP)5GFOGER(GPP)5GPC (GFOGER) (New England Peptide), lysostaphin (AMBI), S. aureus UAMS-1 or Xen29, and then cross-linked using the cysteine-flanked protease degradable peptide GCRDVPMSMRGGDRCG (VPM). All components were suspended in 100 mM MES buffered PBS at a pH of 5.5-6.0. Single colonies of UAMS-1 or Xen29 were picked from agar plates and suspended in PBS to an optical density of 0.20 measured at 600 nm using a benchtop spectrophotometer (Microscan Turbidity Meter, Siemens). The bacteria suspension was diluted 100-fold for UAMS-1 studies and 10 fold for Xen29 studies. BMP-2 (R&D Systems) was prepared at 333 ng/mL in 4 mM HCl. For hydrogels with lysostaphin, the enzyme was added to PEG-MAL. Hydrogels were synthesized by mixing 4:2:2:1:1 parts PEG-4MAL, GFOGER, VPM, BMP-2, and bacteria, followed by injection into a polyimide tube with 300 m laser machined holes (Microlumen). The final hydrogel composition was 4.0% w/v 20 kDa PEG-4MAL, 1.0 mM GFOGER, 41285 CFU/gel UAMS-1, 100 ng BMP-2, with or without 1 U lysostaphin. Hydrogels were polymerized at 37 C. and 5% CO2 for 15 minutes and then swollen in PBS cut into 4 mm segments, and kept in PBS until implantation.
Example 2: Murine Radial Segmental Defect Infection Model
[0067] All live animal experiments were performed in accordance with the Institutional Animal Care and Use Committee at Georgia Institute of Technology under veterinary supervision. Male 10-12 weeks old C57/B6 mice (Jackson Laboratories) were anesthetized via isoflurane inhalation. Depilatory cream was used to remove fur from the right forelimb. The limb was surface disinfected by applying 70% isopropyl alcohol followed by chlorohexidine solution. 1 mg/kg slow release buprenorphine was injected intraperitoneally before surgery as an analgesic. A 1 cm incision was made on the right forelimb over the radius, followed by blunt dissection of the radius. A 2.5 mm section of the radius was then excised using a custom-made double-bladed bone cutting device. A 4 mm polyimide implant tube containing the hydrogel was then fitted over each end of the radius. For mice receiving local gentamicin therapy, infected UAMS-1 containing implants were dipped in 10 mg/mL gentamicin followed by dipping in 0.9% w/v sodium chloride prior to implantation. The wound was sutured closed and an X-ray image (MX-20 Radiography System, Faxitron) was taken of the radius to confirm appropriate implant placement. Mice placed under warming lamp and monitored until ambulatory.
Example 3: Recovery of Bacteria from Tissue Samples
[0068] Mice were euthanized via CO.sub.2 inhalation and the right forelimb was sterilized with 70% isopropyl alcohol and the skin was removed. The implant tube, surrounding tissue and bone were removed, weighed, and kept on ice. Tissue samples from the mouse forelimb were homogenized using bead beating tubes (1.4 mm zirconium beads, OPS Diagnostics) in combination with the FastPrep 24 (MP Biomedicals) set to 6 m/s for a total of 5 successive runs, 40 s in duration. Liver samples were homogenized for 10 sec using a Lab Gen 7 (Cole Palmer) tissue homogenizer in 1275 mm sterile tubes. Single cell bacterial suspensions were then prepared by a series of sonication and vortexing steps (10 min sonication, 30 sec vortex, 5 min sonication, 30 sec vortex, 30 sec sonication, 30 sec vortex). These single cell suspensions were then serially diluted in PBS, plated on agar plates, incubated overnight at 37 C., and enumerated. Bacterial counts were normalized to tissue weight and reported as CFU/mg or CFU/implant if tissue weights were not recorded.
Microcomputed Tomography and Bone Volume Quantification
[0069] Animals were anesthetized via isoflurane inhalation and a 3.2 mm length sectioned centered over the radial defect was imaged using a VivaCT system (Scano Medical) with the following imaging parameters: 145 A intensity, 55 kVp energy, 200 ms integration time, and 15 m resolution. Contours of the radius within the implant tube were drawn on each 2D section and a Gaussian filter was applied (sigma=1, support=1, threshold=540 mg HA/ccm) to quantify bone volume.
[0070] Mechanical Testing of Radii
[0071] Briefly, mice were euthanized via CO.sub.2 inhalation and the right forelimb was dissected, wrapped in saline soaked gauze, and frozen at 20 C. until the time of analysis. Samples were thawed under running deionized water, and the radius and ulna and surrounding tissue was removed from the forelimb. The ulna was then cut at its midpoint using a scalpel blade to ensure the mechanical integrity of the radius was evaluated. Samples were potted in woods metal containing blocks. Torsion to failure testing was performed using a Bose Electroforce ELF 3200 system in conjunction with a 0.07 N.Math.m torque sensor (Transducer Techniques) by applying a constant rotation of 3 degree per second. The maximum recorded torque value was reported.
Dot Blot for Anti-Lysostaphin Antibody Generation
[0072] Pre-exposure blood samples were collected at the time of surgery via cheek bleed. Post-exposure blood samples were collected 4 weeks after surgery by cardiac puncture after CO.sub.2 euthanasia. Blood samples were clotted, centrifuged, and serum was collected and stored at 80 C. until analysis. The dot blot assay was performed using a vacuum driven Manifold I Spot Blot System (Schleicher & Schuell). The nitrocellulose membrane was coated with lysostaphin (AMBI, 100 g/mL), blocked, washed, and then 10,000 fold diluted serum samples were exposed to the membrane. A mouse anti-lysostaphin polyclonal IgG (Antibody Research Corporation) was used as a positive control. Anti-lysostaphin antibodies were detected using an AlexaFluor 488-conjugated polyclonal goat anti-mouse IgG antibody (Abcam). A Typhoon FLA 9500 gel imager (GE Healthcare) was used to image the membrane. ImageQuant (GE Healthcare) was used to quantify blot intensity. Positive results were determined to be five times the average intensity of serum samples from animals that were not exposed to lysostaphin.
Liver Function Analysis
[0073] Mice were euthanized by CO.sub.2 inhalation and blood was taken via cardiac puncture. Serum was separated and samples were sent for blood chemistry testing at Antech Diagnostics.
Histology of Tissue Samples
[0074] Mice were euthanized via CO.sub.2 asphyxiation and the right forelimb was dissected, fixed in 10% neutral buffered formalin, and decalcified in formic acid. Sampled were then processed and embedding in paraffin. Sections (5 m) of the radius and implant tube were cut, and stained with either hematoxylin and eosin, safranin-O and fast green, or gram stain using standard methods. Color images of the tissue sections were taken with a Nikon Eclipse E600 microscope using a Plan Fluor 20objective (Nikon), Micropublisher 5.0 RTV (Q imaging) color camera, and Q-Capture software (Q imaging).
In Vivo Flow Cytometry Analysis
[0075] Mice were euthanized via CO.sub.2 asphyxiation and the right forelimb was dissected. The implant tube and surrounding tissue were removed, weighed, and digested in collagenase type 1-A (1 mg/mL, Sigma) at 37 C. for 45 min. Following digestion, samples were separated using a cell strainer to form a single cell suspension. The single cell suspensions were stained for flow cytometry using standard methods. The samples were analyzed on a FACS-Aria IIIu flow cytometer (BD Biosciences). The antibodies used for cell staining were: AlexaFluor 488 conjugated anti-CD206 (BioLegend), BV421 conjugated anti-CD19 (BioLegend), BV605 conjugated anti-CD4 (BioLegend), BV785 anti-CD8a (BioLegend), PE/Cy7 conjugated anti-CD3 (BioLegend), BV510 conjugated anti-Ly-6C (BioLegend), APC conjugated anti-F4/80 (BioLegend), APC/Cy7 conjugated anti-Ly-6G (BioLegend), and PE conjugated anti-CD86 (BioLegend). Live/dead staining was performed using the Zombie Red fixable viability kit per manufacturer's instructions (BioLegend). Precision Counting Beads (BioLegend) were used to report cell numbers.
In Vivo Cytokine Array Analysis
[0076] Following euthanasia via CO.sub.2 inhalation, the right forelimb was dissected and the implant tube and surrounding tissue was removed for processing. The samples were placed in RIPA buffer, minced, and sonicated. The homogenate was centrifuged at 10,000 g for 5 minutes and the supernatant was filtered using a 0.45 m spin filter, snap frozen in liquid nitrogen, and stored at 80 C. until the time of analysis. A MilliPlex 25-plex mouse cytokine array kit (Millipore Sigma) was used to quantify tissue concentrations of G-CSF, GM-CSF, IFN-, IL-1, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-9, IL-10, IL-12p40, IL-12p70, IL-13, IL-15, IL-17, IP-10, KC, MCP-1, MIP-1, MIP-1, MIP-2, RANTES, and TNF- per the manufacturer's instructions. Results were read using a Luminex system (Luminex Corporation) and normalized to total protein content of the sample measured with a bicinchoninic acid (BCA) assay kit (Pierce by ThermoFisher). Samples below or above the detection limit of the assay were reported as the minimum or maximum value respectively.
Statistics
[0077] All data is plotted as individual data points (biological replicates) with a line indicating the mean and the error bars representing the standard deviation of the mean. A P value less than 0.05 was deemed statistically significant. Statistical comparisons between two groups were made with the Student's t Test. Multivariate parametric data was analyzed using ANOVA with Tukey's post-hoc test and non-parametric data was analyzed using the Kruskall-Wallis test with Dunn's multiple comparison test. A two-way ANOVA with a Bonferroni correction was used to identify statistically significant cytokines. A chi-square test was used to assess for differences in the frequency of anti-lysostaphin antibody generation. All calculations were performed using Prism (GraphPad). Hierarchal cluster analysis was performed on the cytokine data using JMP Pro 13.
TABLE-US-00003 TEST VOLUME CATALOG ANTIBODY CLONE FLUOR (L) # CD206 C068C2 AF488 0.75 141709 CD19 6D5 BV421 1.575 115537 CD4 GK1.5 BV605 1.5 100451 CD8 53-6.7 BV785 1.5 100749 LY6C HK1.4 BV510 1.575 128033 F480 BM8 APC 1.575 123115 CD3 145-2C11 PE-Cy7 1.575 100319 LY6G 1A8 APC-Cy7 1.5 127623 CD11B M1/70 BV711 1.575 101241 CD86 GL-1 PE 1.5 105007 Zombie Red n/a n/a 1 423109 Fixable Viability Kit
Immune cell profiling antibody characteristics. Details regarding flow cytometry antibody targets, clones, fluorophores, test volume used per sample, and BioLegend catalog number.
[0078] The compositions and methods of the appended claims are not limited in scope by the specific compositions and methods described herein, which are intended as illustrations of a few aspects of the claims and any compositions and methods that are functionally equivalent are intended to fall within the scope of the claims. Various modifications of the compositions and methods in addition to those shown and described herein are intended to fall within the scope of the appended claims. Further, while only certain representative compositions and method steps disclosed herein are specifically described, other combinations of the compositions and method steps also are intended to fall within the scope of the appended claims, even if not specifically recited. Thus, a combination of steps, elements, components, or constituents may be explicitly mentioned herein or less, however, other combinations of steps, elements, components, and constituents are included, even though not explicitly stated. The term comprising and variations thereof as used herein is used synonymously with the term including and variations thereof and are open, non-limiting terms. Although the terms comprising and including have been used herein to describe various embodiments, the terms consisting essentially of and consisting of can be used in place of comprising and including to provide for more specific embodiments of the invention and are also disclosed. Other than in the examples, or where otherwise noted, all numbers expressing quantities of ingredients, reaction conditions, and so forth used in the specification and claims are to be understood at the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, to be construed in light of the number of significant digits and ordinary rounding approaches.