IDENTIFICATION OF SECRETED PROTEINS AS DETECTION MARKERS FOR CITRUS DISEASE
20190195873 ยท 2019-06-27
Inventors
Cpc classification
G01N2021/8466
PHYSICS
G01N33/581
PHYSICS
C12Y111/01007
CHEMISTRY; METALLURGY
G01N33/92
PHYSICS
International classification
Abstract
Secreted proteins as detection markers for insect vector and graft transmitted citrus disease are described. Method and kits for detecting the secreted proteins are provided.
Claims
1. A method of detecting secreted protein in a citrus plant, the method comprising forming a mixture of a sample from a citrus plant with a first antibody specific for a protein identical or substantially identical to a protein as listed in Table 1 or Table 2; incubating the mixture with a polypeptide linked to solid support, wherein the polypeptide is the protein as listed in Table 1 or Table 2 or a protein comprising a fragment of at least 20 contiguous amino acids thereof; washing unbound components of the mixture from the polypeptide linked to solid surface; and detecting the presence or amount of first antibody bound the polypeptide linked to solid surface, thereby detecting secreted protein from Spiroplasma citri or Candidatus Liberibacter asiaticus.
2. The method of claim 1, wherein the first antibody is a polyclonal antibody, optionally generated by a method comprising immunizing a mammal with an adjuvant and the protein or an immunogenic fragment thereof and purifying antibody that specifically binds to the protein from blood of the mammal.
3. The method of claim 1, wherein the protein comprises SEQ ID NO:29 or a fragment of at least 20 contiguous amino acids thereof.
4. The method of claim 1, wherein the citrus plant is not artificially infected or graft-inoculated with a bacterial pathogen.
5. The method of claim 1, wherein the detecting comprises detecting the first antibody by contacting a labeled secondary antibody to the first antibody bound to the polypeptide linked to solid surface, washing away unbound secondary antibody, and determining an amount of secondary antibody specifically binding to the first antibody.
6. The method of claim 1, wherein the solid support is a well in a microtiter dish.
7. The method of claim 1, wherein the protein is detected and wherein the method further comprises destroying the plant.
8. A kit for detecting citrus stubborn disease or detecting citrus greening disease (Huanglongbing or HLB), the kit comprising a protein from Table 1 or Table 2 or a protein comprising a fragment of at least 20 contiguous amino acids thereof, wherein the protein is linked to a solid support.
9. The kit of claim 8, wherein the protein comprises SEQ ID NO:29 or a fragment of at least 20 contiguous amino acids thereof.
10. The kit of claim 8, further comprising a first antibody that specifically binds to the protein.
11. The kit of claim 8, wherein the first antibody is a polyclonal antibody, optionally generated by a method comprising immunizing a mammal with an adjuvant and the protein or an immunogenic fragment thereof and purifying antibody that specifically binds to the protein from blood of the mammal.
12. The kit of claim 8, further comprising a secondary antibody that binds to the first antibody.
13. The kit of claim 8, wherein the solid support is a well in a microtiter dish.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
[0041] Methods for serologically diagnosing CSD using S. citri-specific secreted protein or HLB using C. liberibacter-specific secreted protein in a sample are provided. Bacterial pathogens secrete effector proteins into their hosts during infection. These effectors are usually unique for specific pathogen species or even subspecies. It has been discovered that secreted effector proteins can be used as detection markers for diagnosis of bacterial diseases. Antibodies generated to specifically recognize suitable effector proteins can be used to develop serological detection methods such as enzyme-linked immunosorbent assay (ELISA) and imprint detection. The method described herein is particularly efficient for detecting disease in trees where detection of pathogens using nucleic acid-based methods, such as polymerase chain reaction, is challenging due to the uneven distribution of the pathogens in the infected trees. Furthermore, many bacterial pathogens reside in plant transportation systems, i.e. xylem and phloem; therefore, effectors secreted from the pathogens can be dispersed through nutrient and water transportation.
[0042] The method described below is advantageous over other detection methods such as nucleic acid-based detections in two ways: 1) it can overcome the problem of erratic distribution and low titer of the pathogens in the host plant; 2) antibody-based serological detection methods allow rapid and economical processing of a large amount of samples in applications like field surveys.
II. Definitions
[0043] As used herein and in the appended claims, the singular forms a, and, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a plant includes a plurality of such plants and reference to the tree includes reference to one or more trees known to those skilled in the art, and so forth.
[0044] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this disclosure belongs. Although any methods and reagents similar or equivalent to those described herein can be used in the practice of the disclosed methods and compositions, the exemplary methods and materials are now described.
[0045] Also, the use of or means and/or unless stated otherwise. Similarly, comprise, comprises, comprising include, includes, and including are interchangeable and not intended to be limiting.
[0046] It is to be further understood that where descriptions of various embodiments use the term comprising, those skilled in the art would understand that in some specific instances, an embodiment can be alternatively described using language consisting essentially of or consisting of.
[0047] Two nucleic acid sequences or polypeptides are said to be identical if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. When percentage of sequence identity is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions, where amino acids residues are substituted for other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and therefore do not change the functional properties of the molecule. Where sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated according to, e.g., the algorithm of Meyers & Miller, Computer Applic. Biol. Sci. 4:11-17 (1988) e.g., as implemented in the program PC/GENE (Intelligenetics, Mountain View, Calif., USA).
[0048] The phrase substantially identical, used in the context of two nucleic acids or polypeptides, refers to a sequence that has at least 60% sequence identity with a reference sequence. Alternatively, percent identity can be any integer from 60% to 100%. Some embodiments include at least: 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, or 99%, compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below.
[0049] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[0050] A comparison window, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection.
[0051] Algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI) web site. The algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits acts as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=1, N=2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0052] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.01, more preferably less than about 10.sup.5, and most preferably less than about 10 .sup.20.
[0053] Conservatively modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are silent variations, which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is the only natural codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
[0054] As to amino acid sequences, one of skill will recognize that individual substitutions, in a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art.
[0055] The following six groups each contain amino acids that are conservative substitutions for one another: [0056] 1) Alanine (A), Serine (S), Threonine (T); [0057] 2) Aspartic acid (D), Glutamic acid (E); [0058] 3) Asparagine (N), Glutamine (Q); [0059] 4) Arginine (R), Lysine (K); [0060] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and [0061] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
(see, e.g., Creighton, Proteins (1984)).
[0062] The phrase specifically binds, when used in the context of describing a binding relationship of a particular molecule to a protein or peptide, refers to a binding reaction that is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under designated binding assay conditions, the specified binding agent (e.g., an antibody) binds to a particular protein at least two times the background and does not substantially bind in a significant amount to other proteins present in the sample. Specific binding of an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein or a protein but not its similar sister proteins. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein or in a particular form. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity). Typically a specific or selective binding reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
[0063] A label, detectable label, or detectable moiety is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means. For example, useful labels include .sup.32P, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins that can be made detectable, e.g., by incorporating a radioactive component into the peptide or used to detect antibodies specifically reactive with the peptide. Typically a detectable label is attached to a molecule (e.g., antibody) with defined binding characteristics (e.g., a polypeptide with a known binding specificity), so as to allow the presence of the molecule (and therefore its binding target) to be readily detectable.
[0064] The term plant includes whole plants, shoot vegetative organs and/or structures (e.g., leaves, stems and tubers), roots, flowers and floral organs (e.g., bracts, sepals, petals, stamens, carpels, anthers), ovules (including egg and central cells), seed (including zygote, embryo, endosperm, and seed coat), fruit (e.g., the mature ovary), seedlings, plant tissue (e.g., vascular tissue, ground tissue, and the like), cells (e.g., guard cells, egg cells, trichomes and the like), and progeny of same. The class of plants that can be used in the methods of the invention includes angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, bryophytes, and multicellular and unicellular algae. It includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid, haploid, and hemizygous. In some embodiments, the secreted protein is detected in a biological sample from a citrus plant. For example, the biological sample can comprise fluid or sap from bark, fruit, a leaf, a leaf petriole, a branch, a twig, or other tissue from an infected or control plant. In some embodiments, the citrus plant is an orange tree, a lemon tree, a lime tree, or a grapefruit tree. In one embodiment, the citrus plant is a navel orange, Valencia orange, sweet orange, mandarin orange, or sour orange. In one embodiment, the citrus plant is a lemon tree. In one embodiment, the citrus plant is a lime tree. In some embodiments, the plant is a relative of a citrus plant, such as orange jasmine, limeberry, and trifoliate orange.
[0065] Antibody refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen. The recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively. Typically, the antigen-binding region of an antibody or its functional equivalent will be most critical in specificity and affinity of binding. See Paul, Fundamental Immunology.
III. Detailed Description of Embodiments
[0066] Herein is provided a serological detection method for monitoring the effectors secreted from the pathogens into the phloem, wherein the pathogen secreted proteins are markers for citrus stubborn disease. The method includes using an antibody to detect a secreted protein of the bacterial pathogen Spiroplasma citri. Because the causal pathogens Candidatus Liberibacter and Spiroplasma citri reside in the phloem of infected trees, secreted proteins are dispersed throughout the tree along with the transportation flow in the host vascular system. Therefore, although the pathogens cells have a restricted and sporadic distribution pattern, the pathogen proteins are not restricted to the infection sites. This allows for robust detection and overcomes the difficulty from the uneven distribution of the pathogen cells in infected trees. Furthermore, direct detection of pathogen-associated patterns are more reliable and highly selectivity, especially compared to detections of host changes, which may not be specific to a particular disease.
[0067] Accordingly, in some embodiments, methods of detecting citrus stubborn disease or citrus greening disease, or the presence of the causative agents, Spiroplasma citri, and Candidatus Liberibacter asiaticus, respectively, by detecting one or more secreted protein from the causative agents are provided.
[0068] Surprisingly, it has been discovered that the presence of citrus stubborn disease can be detected by detecting a secreted protein as described herein in untreated (unpurified) sap from infected citrus, even trees that are naturally infected and thus have a lower titer of bacteria than an artificially-infected tree. This is particularly surprising as spiralin, a highly-expressed protein from Spiroplasma citri cannot be detected from unpurified sap (see, e.g.,
[0069] Further, in some embodiments, the plant that does not comprise grafting-inoculated citrus tissue or other artificially-inoculated tissue. In some instances, the sample is from phloem-rich tissue.
[0070] The methods described herein can be used to detect a secreted protein that is not abundant on S. citri cells. For instance, the secreted protein can be present at a lower level than spiralin which has been shown to be the most abundant protein at the membrane of S. citri cells (see, Duret et al., Appl. Environ. Microbiol., 69:6225-6234 (2003)). Detection of the presence of the secreted protein in a plant sample indicates that the plant has citrus stubborn disease.
[0071] In some embodiments, the secreted protein is detected with an antibody. The antibody can recognize (specifically bind) a secreted protein from S. citri or Candidatus Liberibacter, wherein the secreted protein can indicated CSD or HLB, respectively.
[0072] Antibody reagents can be used in assays to detect the presence of, or protein expression levels, for the at least one secreted protein in a citrus sample using any of a number of immunoassays known to those skilled in the art. Immunoassay techniques and protocols are generally described in Price and Newman, Principles and Practice of Immunoassay, 2nd Edition, Grove's Dictionaries, 1997; and Gosling, Immunoassays: A Practical Approach, Oxford University Press, 2000. Gosling (2000) describes: Rabbits, hamsters, guinea pigs and chickens are the most commonly used animals for polyclonal antibody production in the laboratory. . . . Sheep, pigs, donkeys and horses are generally only used when large volumes of serum are required and the choice of species is usually dictated by the availability of suitable facilities and by cost . . . . There are a wide variety of standard immunization protocols and many are designed to maximize the response of the immune system to a particular type of antigen or to influence the properties of the antibodies generated . . . . Adjuvants are generally essential components in immunization protocols and they are particularly necessary when immunizing with soluble proteins . . . . A common immunization protocol for both rabbits and mice involves a primary immunization with complete Freund's adjuvant, followed by a number of boosts with Freund's incomplete adjuvant given at intervals of 2-4 weeks until the response is optimum. A variety of immunoassay techniques, including competitive and non-competitive immunoassays, can be used. See, e.g., Self et al., Curr. Opin. Biotechnol., 7:60-65 (1996). In some embodiments, a competitive immunoassay comprises linking (covalently or non-covalently) a protein to a solid support and then contacting the protein with a mixture of an antibody that binds the protein and a sample. If there is target protein in the sample, then a quantity of the antibody will be bound to target protein in the sample and so will not be available to bind to the protein linked to the solid support. One can quantify the amount of antibody binding the protein on the solid support following wash of unbound components. The amount of antibody bound to the protein on the solid support is inversely proportional to the amount of target protein in the sample. In some embodiments the protein linked to the solid support is a polypeptide comprising a protein of Table 1 or Table 2 or a fragment of at least 20, 30, 40, 50, 70, or 100 contiguous amino acids of a protein of Table 1 or Table 2. The term immunoassay encompasses techniques including, without limitation, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL). If desired, such immunoassays can be automated. Immunoassays can also be used in conjunction with laser induced fluorescence. See, e.g., Schmalzing et al., Electrophoresis, 18:2184-93 (1997); Bao, J. Chromatogr. B. Biomed. Sci., 699:463-80 (1997). Liposome immunoassays, such as flow-injection liposome immunoassays and liposome immunosensors, are also suitable for use in the present invention. See, e.g., Rongen et al., J. Immunol. Methods, 204:105-133 (1997). In addition, nephelometry assays, in which the formation of protein/antibody complexes results in increased light scatter that is converted to a peak rate signal as a function of the protein concentration, are suitable for use in the methods of the present invention. Nephelometry assays are commercially available from Beckman Coulter (Brea, CA; Kit #449430) and can be performed using a Behring Nephelometer Analyzer (Fink et al., J. Clin. Chem. Clin. Biochem., 27:261-276 (1989)).
[0073] In some embodiments, the immunoassay includes a membrane-based immunoassay such as an dot blot or slot blot, wherein the biomolecules (e.g., proteins) in the sample are not first separated by electrophoresis. In such an assay, the sample to be detected is directly applied to a membrane (e.g., PVDF membrane, nylon membrane, nitrocellulose membrane, etc.). Detailed descriptions of membrane-based immunoblotting are found in, e.g., Gallagher, S R. Unit 8.3 Protein Blotting:Immunoblotting, Current Protocols Essential Laboratory Techniques, 4:8.3.1-8.3.36 (2010).
[0074] Specific immunological binding of the antibody to the protein of interest can be detected directly or indirectly. Direct labels include fluorescent or luminescent tags, metals, dyes, radionuclides, and the like, attached to the antibody. An antibody labeled with iodine-125 (.sup.125I) can be used. A chemiluminescence assay using a chemiluminescent antibody specific for the nucleic acid is suitable for sensitive, non-radioactive detection of protein levels. An antibody labeled with fluorochrome is also suitable. Examples of fluorochromes include, without limitation, DAPI, fluorescein, Hoechst 33258, R-phycocyanin, B-phycoerythrin, R-phycoerythrin, rhodamine, Texas red, and lissamine. Indirect labels include various enzymes well known in the art, such as horseradish peroxidase (HRP), alkaline phosphatase (AP), -galactosidase, urease, and the like. A horseradish-peroxidase detection system can be used, for example, with the chromogenic substrate tetramethylbenzidine (TMB), which yields a soluble product in the presence of hydrogen peroxide that is detectable at 450 nm. An alkaline phosphatase detection system can be used with the chromogenic substrate p-nitrophenyl phosphate, for example, which yields a soluble product readily detectable at 405 nm. Similarly, a -galactosidase detection system can be used with the chromogenic substrate o-nitrophenyl--D-galactopyranoside (ONPG), which yields a soluble product detectable at 410 nm. An urease detection system can be used with a substrate such as urea-bromocresol purple (Sigma Immunochemicals; St. Louis, Mo.).
[0075] A signal from the direct or indirect label can be analyzed, for example, using a spectrophotometer to detect color from a chromogenic substrate; a radiation counter to detect radiation such as a gamma counter for detection of .sup.125I; or a fluorometer to detect fluorescence in the presence of light of a certain wavelength. For detection of enzyme-linked antibodies, a quantitative analysis can be made using a spectrophotometer such as an EMAX Microplate Reader (Molecular Devices; Menlo Park, Calif.) in accordance with the manufacturer's instructions. If desired, the assays of the present invention can be automated or performed robotically, and the signal from multiple samples can be detected simultaneously.
[0076] The antibodies or the secreted proteins (e.g. such as found in Table 1 or Table 2 or a fragment thereof specifically recognized by the antibody) can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), in the physical form of sticks, sponges, papers, wells, and the like. An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
[0077] Comparative proteomic methods including mass spectrometry (MS) can be used to identify secreted proteins from pathogenic bacteria. For instance, secreted protein profiles from S. citri cells cultures with or without induction of citrus ploem extracts can be determined by MS. Genomic sequencing analysis can be performed to identify gene sequences encoding the secreted proteins. Protein sequence analysis can be used to determine the location of signal peptide cleavage sites based on the amino acid sequence. Secreted proteins for use in the method described herein can be identified using sequence analysis and bioinformatic prediction programs in diseased plants. Expression analysis can also be performed to confirm the presence of the secreted proteins. For instance, the probability of the protein being a Sec-secreted protein can be predicted from a protein's N-terminal secretion signal (e.g., a higher value indicates a greater probability).
[0078] Exemplary secreted proteins from Spiroplasma citri whose presence in a citrus sample is indicative of the pathogen (or the corresponding disease citrus stubborn disease) include, the protein encoded by Gene ID: CAK98563 or substantially identical variants. The amino acid sequence of CAK98563 (SEQ ID NO:1) is found in Uniprot No. Q14PL6. Additional secreted proteins from Spiroplasma citri include those described in Table 1 or substantially identical variants thereof. In some embodiments, a protein secreted from S. citri, including any one of those of Table 1, can be used in the method described herein as a detection marker for CSD.
TABLE-US-00001 TABLE 1 Secreted proteins from Spiroplasma citri Probability of N- terminal Amino acid SEQ ID secretion position of NO: Protein name signal cleavage site 1 CAK98563 0.777 23 2 CAK99824 0.843 23 3 CAK99227 0.998 29 4 CAK99727 0.906 30 5 CAL0019 0.75 27 6 CAK98956 0.99 29 7 P123-family protein variant A 8 P123-family protein variant B
[0079] Exemplary secreted proteins from Candidatus Liberibacter asiaticus whose presence in a citrus sample is indicative of the pathogen (or the corresponding disease citrus greening disease, also known as Huanglongbing or HLB) include those described in Table 2 or substantially identical variants:
TABLE-US-00002 TABLE 2 Secreted proteins predicted from Candidatus Liberibacter asiaticus Proba- bility MW of N- SEQ (kD) of terminal ID mature secretion NO: Protein Name protein Protein function signal 9 CLIBASIA_00460 9 hypothetical protein 0.667 10 CLIBASIA_00995 35 porin outer 0.55 membrane protein 11 CLIBASIA_01135 33 glycine betaine ABC 0.718 transporter 12 CLIBASIA_01295 24 flagellar L-ring 0.637 protein 13 CLIBASIA_01300 17 hypothetical protein 0.546 14 CLIBASIA_01600 35 carboxypeptidase 0.816 15 CLIBASIA_03230 16 hypothetical protein 0.705 16 CLIBASIA_03070 49 pilus assembly 0.723 protein 17 CLIBASIA_02610 45 iron-regulated protein 0.462 18 CLIBASIA_02470 13 putative secreted 0.452 protein 19 CLIBASIA_02425 19 outer membrane 0.884 protein 20 CLIBASIA_02250 20 extracellular solute- 0.55 binding protein 21 CLIBASIA_02145 21 hypothetical protein 0.746 22 CLIBASIA_02120 31 periplasmic solute 0.721 binding protein 23 CLIBASIA_04025 9 hypothetical protein 0.501 24 CLIBASIA_04040 15 hypothetical protein 0.681 25 CLIBASIA_04170 28 rare lipoprotein A 0.56 26 CLIBASIA_04520 33 hypothetical protein 0.603 27 CLIBASIA_04580 10 hypothetical protein 0.795 28 CLIBASIA_05115 17 hypothetical protein 0.664 29 CLIBASIA_05315 14 hypothetical protein 0.706 (also referred to herein as SDE1) 30 CLIBASIA_00100 15 ABC transporter 0.588 protein 31 CLIBASIA_02075 44 chemotaxis protein 0.624 32 CLIBASIA_03120 4 hypothetical protein 0.65 33 CLIBASIA_04560 19 hypothetical protein 0.57 34 CLIBASIA_05640 5 hypothetical protein 0.668 35 CLIBASIA_05320 7 hypothetical protein 0.83
[0080] In some embodiments, a protein secreted from S. citri, including any one of those of Table 1, can be used in the method described herein as a detection marker for CSD.
[0081] Also provided are kits, e.g., for use in diagnostic and research applications. The kits can comprise any or all of the reagents to perform the methods described herein. The kits can also comprise a scalpel, razor blade or other implement for obtaining a plant or sap sample from a citrus tree. In addition, the kits can include instructional materials containing directions (i.e., protocols) for the practice of the methods. While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
IV. Examples
Example 1
[0082] This example illustrates a method for serological diagnosis of CSD using a S. citri-specific secreted protein ScCCPP1 which is encoded by CAK98563.
[0083] In the study, scCCPP1 was identified using mass spectrometry of the supernatant portion of a bacterial culture of S. citri. The protein was determined to be in relatively high abundance. Using an antibody generated against ScCCPP1 as the antigen, specific signals from S. citri-infected trees were detected using a direct tissue imprint assay. The results demonstrate that this method is suitable for field surveys.
[0084] Western blot analysis with rabbit polyclonal anti-ScCCPP1 antibody showed that the secreted pathogen protein was present in the total protein extracts harvested from S. citri cells. ScCCPP1 was also detect uninduced S. citri cells in phloem extracts, as well as induced S. citri cells in either phloem extracts or sucrose only (
[0085] Western blot analysis, as shown in
[0086] In a simple imprint assay, samples of process-free sap from leaves or young branches were obtained from S. citri-infected trees. The plant tissues were removed from the adult trees using a razor blade. The samples were printed on a nitrocellulose membrane by pressing the freshly cut cross section of leaf petioles or branches on the membrane, which left faint green-colored marks from the sap in the samples. The membranes were then be taken back to the lab and incubated with a rabbit anti-ScCCPP1 polyclonal antibody for one hour at room temperature (about 22 C.). The membranes were washed with a wash solution to remove any unbound primary antibody. A secondary antibody recognizing rabbit antibodies and conjugated with HRP was added to the membranes and incubated for one hour at room temperature (about 22 C.). The membranes were washed with a wash solution to remove any unbound secondary antibody. Detection was performed using a chemilluminescent reagent and standard autoradiography technique.
[0087] Citrus trees that were graft-infected with two S. citri strains (S616 and C189) were examined using an antibody against ScCCPP1 or an antibody against spiralin. ScCCPP1 was detected in imprinted leaf petiole samples from S616-infected trees and C189-infected trees (
[0088] Strong signals of ScCCPP1 were observed in imprints of phloem-rich tissues (e.g., barks) from S. citri-infected citrus trees in the field (
[0089] Comparison of the imprint method to a nucleic acid-based quantitative PCR (Q-PCR) assay showed that the imprinting immunoassay provides more consistent and more robust detection of CSD infection (
[0090] The results also show that the positive signals were mainly present from the regions corresponding to the phloem-rich tissues. This is consistent with the primary location of the antigen. Remarkably, the anti-ScCCPP1 polyclonal antibody gave more reliable and consistent results than an antibody against spiralin protein, which is a major cell membrane component of the bacterial pathogen and one of the most abundant proteins of present in S. citri. These data demonstrate that the presence of CAK98563 indicates citrus stubborn disease in plants even in the absence of S. citri cells. The results also confirm that pathogen secreted proteins can be used as detection markers for phloem-limited bacterial diseases of citrus.
Example 2
Competitive Indirect ELISA for HLB Detection Protocol
[0091] 1-SAMPLE PROCESSING. Approximately 0.2 g of freeze-dried citrus tissues (bark of young branches or midrib of leaves) is used for each test (each sample is tested in triplicate). The tissues are cut into small pieces using blades and ground into fine powder in liquid nitrogen. The powder is then aliquoted in 1.5 mL tubes with 0.05 g sample in each tube.
[0092] 2-PLATE COATING. Coat 96-well plates (Immulon 2 HB Flat Bottom MicroTiter Plates, Thermo Fisher Scientific Inc.) with 100 L of 1 g/mL purified SDE1 (CLIBASIA_05315) protein [SEQ ID NO:29] (in 1 PBS* buffer) in each well. Seal the plate with an adhesive plate sealing film and incubate for 4 hours at 37 C. or overnight at 4 C. in the dark with shaking.
[0093] 3-WASHING. Use a plate washer (HydroFlex microplate washer, Tecan, USA), wash the plate with the washing buffer* (300 L, per well, orbital shake at medium speed for 1 minute) for 4 times. Tap out remaining liquid on paper tower.
[0094] 4-BLOCKING. Add 200 L of blocking buffer* to each well. Seal the plate and incubate at 37 C. for one hour or at room temperature for 2 hours in the dark.
[0095] 5-WASHING. Washing the wells as described in Step #3.
[0096] 6-SAMPLE PREPARATION. While the plate is in the blocking step (#4), suspend the citrus tissue powder in 1 mL of 1 PBS buffer, and mix by a vortex for 15 seconds. Incubate the suspension on ice for 10 minutes and then vortex again. Centrifuge at 10,000 rpm for 5 minutes at 4 C. Collect the supernatant in a clean tube. Keep it on ice.
[0097] 7-PRIMARY ANTIBODY PREPARATION. The primary antibody of anti-SDE1 is diluted in RX buffer* with a final concentration of 100 ng/mL. Mix equal volume of plant extract prepared in Step #6 and the antibody solution. Incubate for 30 minutes at room temperature, preferably with shaking. Include positive (purified antigen spiked in healthy citrus extract or HLB-infected tissue if available) and negative controls (1 PBS buffer and healthy citrus tissue).
[0098] 8-COMPETITIVE SYSTEM INCUBATION. Add 100 L of plant sample-primary antibody mixture prepared in Step #7 to each well prepared in Step #5. Each sample is tested in triplets (i.e. 3 wells per sample). Seal the plate and incubate at room temperature for one hour or at 4 C. for overnight with shaking.
[0099] 9-WASHING. Washing the wells as described in Step #3.
[0100] 10-SECONDARY ANTIBODY INCUBATION. Dilute the secondary antibody (goat-anti-rabbit IgG horseradish peroxidase (HRP)) to 1/5000 in the RX* buffer. Add 100 L of the diluted antibody to each well. Seal the plate and incubate at 37 C. for one hour with shaking.
[0101] 11-WASHING. Washing the wells as described in Step #3.
[0102] 12-SIGNAL DETECTION. One-step Ultra 3,3,5,5-Tetramethylbenzidine (TMB)-ELISA Reagent (Thermoscientific TMB Substrate Reagent, Cat. No. 34028, 34029) is used to detect positive signals. Bring the substrate to room temperature prior to use. Add 50 L of the substrate into each well. Incubate at room temperature for 1-5 minutes or until color development, and then add 50 L of the Stop Solution* to stop the color reaction. Read the optical density (OD) of each well at 450 nm using a microplate reader (Tecan M200Pro).
[0103] 13-DATA ANALYSIS. Take the averaged OD of the three repeats from each sample (S) and calculate a ratio compared to the average OD of the healthy citrus tissue control (H).
Buffers:
[0104] *1Phosphate Buffered Saline (PBS): 80.0 g NaCl, 14.4 g Na.sub.2HPO.sub.4, 2.4 g KH.sub.2PO.sub.4, 2.0 g KCl Add ddH.sub.2O up to 10 L, pH=7.4
[0105] *Wash Buffer (1 PBS with 0.1% Tween-20)
[0106] *Blocking Buffer (3% non-fat milk in 1PBS)
[0107] *RX Buffer (1 PBS, 0.1% Tween-20, 3% non-fat milk)
[0108] *Stop Solution (2M H.sub.2SO.sub.4)
Results
[0109] Binding of Anti-SDE1 with SDE1 In Vitro
[0110] The sensitivity of this ELISA protocol was determined by calibration curves using purified SDE1 antigen. A serial dilutions of purified SDE1 proteins (5000, 1250, 312.5, 78, 19.5, 5 and 0 ng/mL) were spiked into either 1 PBS or healthy citrus extract (Rio Red grapefruit) and OD450 was determined in each sample (
Evaluation of the Competitive ELISA Protocol for HLB Detection using Citrus Samples
[0111] The competitive ELISA protocol was tested using field citrus samples from Texas. We received freeze-dried midrib tissues from trees grouped into two groups (10 positive samples and 5 negative samples) based on HLB symptoms and diagnostic results from Taqman qPCR (Li et al., 2006).
[0112] Our results from competitive ELISA show that the average of S/H ratio for the positive samples was 0.60, whereas that of the negative samples is 0.88 (
[0113] Note that we found two negative samples that showed relatively low S/H ratios, which indicate they might be infected. Indeed, being called negative may not necessarily mean that these trees were actually free of the HLB-associated bacteria. It has been observed multiple times that qPCR-based diagnosis, which detects specific DNA sequence from HLB-associated bacterium, did not provide correct diagnosis for all infected trees due to the uneven distribution of the bacterial cells in infected trees, especially at the early infection stage when the bacterial titer is low and the trees do not exhibit disease symptoms.
Comparison of the Competitive ELISA Method with qPCR
[0114] We further applied the ELISA method in a larger scale test using 108 samples with the goal of comparing results obtained from the qPCR-based diagnosis. These samples were collected by our colleagues in Texas and we tested them simultaneously by TaqMan qPCR and the competitive ELISA protocol.
[0115] We first conducted a statistical analysis using the dataset to generate a cut-off value for putative positive samples based on the S/H ratio of OD450. Based on the diagnosis provided by qPCR (which may or may not be accurate, since this method is known to miss positive samples), we separated samples into known positives and known negatives, and then compared the ELISA values for every sample. A two sample t-test with equal variance was used to determine the difference between the two groups. This analysis showed a significant difference between the two groups, with a P value<0.001. The S/H ratios were squared before applying the t-test to meet the normality assumption. We further calculated the true positive and false positive rates, and used Receiver Operating Characteristic (ROC) curve to determine the cutoffs, which is S/H=0.92, with a sensitivity of 0.86 and a specificity of 0.58 (
[0116] Based on the qPCR, we found 36 positive samples and 72 negative samples. From the 36 qPCR-positive samples, 32 were also detected as positive by ELISA using the cutoff value generated in
[0117] From the comparison, the current ELISA might have 4 false negative, and 26 putative false positive. However, when we compared to previous qPCR results using different tissue collected from the same trees, 10 trees (from the 26 that were ELISA positive but PCR negative) have been shown to be HLB positive, again, using different tissues from the same tree. These results suggest that these 10 trees were HLB-infected, although the tissue collected for testing in this trial probably did not have the bacteria, thus resulting in the (false) negative diagnosis by qPCR. Notably, these tissues contain the secreted protein SDE1, leading to positive results by ELISA.
[0118] Taken together, our data showed that the ELISA protocol, by detecting a different biomarker, provide additional and complementary information with qPCR and in some cases could better detect HLB when the tested samples do not have the bacterial cells although the tree might be infected. Therefore, it is a useful detection method that enhances HLB diagnosis.
[0119] We also evaluated the ELISA method for HLB detection using fresh citrus tissues in Florida (trial performed in Southern gardens company, Clewiston, Fla.). We collected leaf midrib tissues from 20 field trees and tested them by both ELISA and qPCR. We found matches in results for 16 samples (9 positive and 7 negative), one false negative, and three potential false positive (Table 3). Again, the three samples that showed negative results in qPCR but positive results in ELISA may not mean that the ELISA assay gave false positive diagnosis. HLB infection rate in Florida citrus trees is estimated to be >90%. It is likely that the three PCR-negative trees are actually infected, but the tissues that were collected for testing did not have the HLB-associated bacterium. This does not affect the ELISA test because the biomarker, i.e. SDE1, is a secreted protein and its location in infected trees is independent on the location of the bacterial cells.
[0120] Table 3 depicts a comparison of ELISA and qPCR diagnosis of HLB using 20 fresh citrus tissues in Florida. Comparison of ELISA and qPCR results showed matches in 16 samples (highlighted in green). One sample was tested PCR positive but ELISA negative, which indicates a False Negative (FN) for ELISA. Three samples were tested PCR negative but ELISA positive. These may potential be False Positives (FP?) for ELISA, but could also be due to False Negatives of qPCR.
TABLE-US-00003 TABLE 3 A comparison of ELISA and qPCR diagnosis of HLB sample qPCR diagnosis ELISA diagnosis R2T26 + (FN) R2T42 R2T58 R2T60 + + R2T75 + + R2T88 + (FP?) R2T90 + + R2T103 + + R2T106 + + R2T107 R2T108 R2T119 + + R2T121 R2T122 + + R2T123 + + R2T124 + (FP?) R2T135 + + R2T138 R3T25 + (FP?) R3T27
[0121] All publications, patents, accession numbers, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
[0122] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
TABLE-US-00004 CAK98563proteinfromSpiroplasmacitri(411aa;46,015Da) SEQIDNO:1 MRKLLSIFAATTLVTTSAASAVACSGAPQGNLIPIFMYNGNQKFSHAPTVTRKSINGIDDVTQS GKDENGAPYEYSLQGGRMGLINGLINNAINPILNGINLTKDNSATTGKGAKWTDEQIAAGLEGQ KEQLVQTAKTDAQDPFNSSKKINQKAIWKDLFNNYSTSFDSSYSQVAFLANENKAILNKTNDNL VTMTGNAEKTNNKNWVKEHTWPDGKKSPYTPSSLKVLSPIASILEWFNDPKNSYNQGYNQIDQN RGYQSARYLAIAIPNVTIRFEFQGEHNCFTFTVTIDKLVAYANYLVYENPNSTKDNPSYGHQWF FLSYGFYDFESLKDDDYHHYNFNAIPDDVKIDKNIKVALGFFKKNDDKGILTADEDKEVGKRGQ FPTAETDYTFPALKWKINVNSITDQYK CAK99824proteinfromSpiroplasmacitri(566aa;63,899Da) SEQIDNO:2 MKKILSILGAMSILSSTGTSIYACTKKDFERFTDPAIVDEVKRWIIAKINSENESNVVKYSFND IFTKAALKEMTTRLLDTNISKFFYASEEATRARYTGVTIDVNQPDSLLIKQFINFVEQVALDNL STKYSTGISNSTPLETTIAGQGYAPDYQSEGWYVGGSQSYFWKGTGKPNYMQSRKGQGEANFEI KSKSAGANYTDFNAMSEDDKKAALKTRFKDYYTHVEIPAVIDKIITATYLHQNEIKRYGSGNNS SIYLNRNSALFNALQSWDTISGARWKSYIKMVWELKLDKEELDKLFADKGPLANVEKLNSDLTN NQDILMKILKEMFNAKKDNIFNNMIKDGIDPIFGISGFKGFVGIDKNKNPNDIFTTLNNADSYK QKVIDTATPGIIKSGEGTDPSSYQFLDTNKRYGSFVLTLPIYAVDLMKNMNINYKNDNKNNKEL SLTWYGSGGTPTDLDQAWLAQQGGIKRSLSWLYNKKGYLGTYDENGQPLYNDNGTPVDITKNIK GQILKWIEYTFAKQQNLQTAAKTRLYSLVFANNPENVYSQTLYDAIGSYIIKED CAK99227proteinfromSpiroplasmacitri(730aa;82,870Da) SEQIDNO:3 MRKLLNILAAATLAATPALTASCKTKAKSAEDKYKDSSVENLPNGPLKSKILQTTLFTKATIAN RHENLNTYTPSMLQMLMRLPDSYKDKDGNIVDIDYYRGKYLNKNNGMPLTTLSSNYDYMNLLDN ELYNTEKQTKKKISDYSDKDPLPSIPNLTKNSNMLNYWYDGGPLSNYSIVKEILPTKCDDKRIN QNIVDACNKAIFEMPRTTYFYNFNMDYSPMATKDIKFDTDTNQNFIINNQKFAAGGPFKTAQKS EEQDKLSIILQLISMADMFTDRSQSKTYINQLNKFLALSGDSDGTFMGSILGAIYYQIFASPKL PNDPTKENANYTFAKLGVTKALQLLRKDSTERQAIKQKIDVFFDAQSQVFSDLLAVRPMQPGLD LNKPEGQYKNRDAMWNGKTPNLRLVDLLFKKDASTKSLAELFTDFGEYLDDLYTKADVECQEEA NNSISSFLKLAANVVTPGFKVVLQSMSKMMLSKSEGGLGTLSVNDINRFVVALSKGILQSANAL TEVSKLPWSEATDQEQNQTKITQLLTGSDDPSTPTKDSFMDLAFTWFNDSTQPVRALLNKLYFD PDSETRKDLLAINNALYEYSNNLLLGANWNISNGQLEENKLSYDIEYKGTGDADVVANLDLHQN WYIPKSEIKTYQDLNAAYLNALGNRDLDWFMKYDGLGNNYQKVHYKYKVTWMNINPGDDSHQYW VISNIQWFAKDISGQWKRYYDAIEND CAK99727proteinfromSpiroplasmacitri(291aa;33,893Da) SEQIDNO:4 MKWLLTLFSVFVLGFGSSLGVVSCTVRAKHEPDDNDELDHNQDLEILNQIKKEAKQTLSTWWQT KTMIDIIKDYQEQISSFKELVTQVKTKNDGSLTLTSIAISKYCFLNQLLIGFKAEFNNLNQHLQ NRYSNYYVDTMPLFLGENDISFNLYNINFDKIAKLLADTAQAVLGITVQVNIAYEVRFKGLPTE DNIQVSITTTNDSEVLNNIQDKVENYFVNFLDTIFKAKNYRIISKQFNIKTDIVWPIISKELND RNISFQHIIFNFLYYGQQIYLIFIPLNIWTLTRLF CAL00019proteinfromSpiroplasmacitri(308aa;34,572Da) SEQIDNO:5 MAKIGGKSSIALPTLFEIGGNSPTEKAIGDVAVLQIKKILEADSQYIDATEMMMMSAKQISMED GFEQGQYVFPERMVWGNDYDSSAGAEQQSVGVRRATVMMDQMLTFKYDVPSFDTVRFMESPVEV RTNTIGEWMRTITRNWYSNMNAIYLQGVIDSCIATGQYIILPIPTDADSAQQTFYKINDIAINL VQKINALMFGTKKEDLMVHVAMPAFAQFTKAYTKILDQIAADTLATGQLWRKMIVGVDVFESWY LGRQFNKGKETGINKDLDFNLNFSQTVGAWGFIGHKEDCAMPQGWKSIQQVN CAK98956proteinfromSpiroplasmacitri(373aa;41,700Da) SEQIDNO:6 MKRFFTLLAVLNVATGSTVMVASFTIAQGAHLNPVDSLLLIGKDIDTSKAIDDAKSNLQFTNYY ILGDSLSDSHGIEKLVKNSFKLDIKIGTNDPNNLENYQNGSLSNGNTAAVLLNAKLGFDKIRPG IPNDYAGDFGRNYAIGGATAVDVVGTAGMLLNRVTIEKQAQALVSQHKLRSTDLVLFEIGGNDL FQIIDTTDPQTELELMHQSVERIKIALFTLLNNGIRKILFSDAPNVSAIPRYNNQNTDDTLKKR ANNISTEFHARVAKMIELANTYYKNAIRNWGLYDNLSVLMTEFKARHPKGNITVNFNNLNLDFI KIIEEKMLNAQRNPALPANANIDDYFFFDIVHPTREVHQLAMEHYYQTIKEWT P123proteinvariantAfromSpiroplasmacitri(463aa; 52,865Da) SEQIDNO:7 MLRQFGGLIGSNSLTFGCMLKLTDKIKTHYYSATGQDLGTKVYSTIDLGQNRINVNGGTDEIVI LSQDFQALDKDTPLTNLDNKLDFNPTVDGTLESYVIDLINLQTIGKTNFKITTYSENPFTLNDN ITAFQNFQGEWQTMAKFIKPNGNVQAWNSVIKTSALDYDLLEETTFFYPQAVLPPDPFTYKPYT VNILDSNTIKPLKANITAAKQCTSSISFIWQKDWINLFNNKYDNVYYELEVDLKQINTTITTWE QLLNAYSSIQFNNLNNLQVKCAPPNIENFIPNRNINILGGYSTCENNLGWFSNGKLKVKGDKQI DKVNFNGSLIYDLANIKENKKTTLFTGETTGLPSGYYQNRYSFSKNCDFSFLLQITKLSDNDDN KIKELYVQAWHTNDMKLKIRFTKVVFPDFSFYYSDMPVVKLYKYFGNDKNISIDIDNSNILGIR NDSINPISITFIPRS P123proteinvariantBfromSpiroplasmacitri(1067aa;123, 417Da) SEQIDNO:8 MSRINPSVMEELRRQAHDTLIDIRENIRDNRHWMVFPFNVYSSYIPDTETGWKPNNAKPSDYGS YTRIFDNMESTIAQWQGSLKIVQKYKGEEINILTIDDFNKQPINSTIWANNETPFAIKLKDENE NNYWKLIDGENIYDINKMLEYLKQYKLSYFINNDNKADNFYTKEVKVGKYWDAYMIDDRSSIQF GDAKFEQVFTQQSTERQYTLLILDEDAEKLNINDYYNFYTVFNDRGLNIGGGDINSAPQDRQWL YPSNVINYYSPYDGSFLWQEITFSSINDKISHSGLSVRQFIQTSAPGEGYCFPKITYDKKLNKG IVELDEVLLKDPGVRAMAVKFYGNPILFDMPVIGRPIIKGEFNKKVMNSRDLLMYNMYPAPPDK INTYAAPEVSWYNIQGIQPTMITGYEDWKKDMESRYDFWNQKNSEGIVITDKVTSTATNPTVGT TINEEDNNSEFYWSKSWKITPPNKVKVNSGSVDNIISTQASSYFRRKDEFGNTVGQVQIEYNKM GSCNVWDILNINNFINRQITVLPLNYTHKLVFNPFTIPGGVGKFLNFISFGIPWGWVINQDKKT WPNFQWLNGFMSANVYSFYNDAFWSEKSKGKGYLPFEIFREQGNDKVGAIFGANATSLGFTTLL TDKCKGTVYTNDGKITEQITYSTYNLKQLNEKTNRIYLINEQTKAVEAQTPVSDSEKDNDCEFL QTPDGTNCSYIIDMFSIQALYKGNFEIIFYADNPYTNNEEDYLRLSVWSFRGKTKSVLNNYLRD MTTNYKTSFLLPHDYEIPTFNYPQYVLPPVPYNYQPYTKDIMPAGVVQTLKTKITAPAQCKENF PPVNLFDDTAEHNAYYETEIDLRQIDPTIQSIDKFKSAYKTIEISNLGNLQVECGPPNIENFIP NRNVDILGGLNCNINLGSLANITLQESGRSQTDKVNFDNIRTLYTNNITNEVQTFEPIAYTNGL QGDDYENRYFASDKRVVLDFLLQITKLSNNNDNDKIKETYLQAYYTNDVKLKIRISKIININLL LDSTMHWKYFGNNKNIVLDVDNPNVLGIRNKSENPVKIIFIPR CLIBASIA_00460proteinfromCandidatusLiberibacterasiaticus (98aa) SEQIDNO:9 MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAVYTKK EELIDGKKAMITTDNFMGGEPIIFIKYLFEEDKK CLIBASIA_00995proteinfromCandidatusLiberibacterasiaticus (351aa) SEQIDNO:10 MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSL QARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFT VPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAG LSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAV WASGDNSYYDKSKYSVFAGYKFDVAKSIIISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEA QASVAFNDNFVKKGVAIDKGVDLSVGLKKSF CLIBASIA_01135proteinfromCandidatusLiberibacterasiaticus (309aa) SEQIDNO:11 MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIKLLAV PVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVGFALGIKSY QDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASFSQIRRDQRNNIP AVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPNISRLLKNIKFSVALEN EMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPSRQLERFMNN CLIBASIA_01295proteinfromCandidatusLiberibacterasiaticus (238aa) SEQIDNO:12 MYRYSFIVLCYSSLLFGCHSSISEITGIPQMSPMGSSLDENNRMPFLGIDFKNSDSTKKSYSLW RDSHAALFKDSRALNVGDILTVDIRIDDQAVFDNQTGRSRNNSLHRKLSGGFSLFGQQTPQMNG NLNYDGGGASSGKGSISRAEKLNLLIAAIVTAILENGNLIISGSQEVRVNDEIRSLNVTGIVRP QDVDAHNSVSYDKIAEARISYGGKGRTTELLRPPIGHQLIENLSPL CLIBASIA_01300proteinfromCandidatusLiberibacterasiaticus (175aa) SEQIDNO:13 MILLPIIYYYKKRDMLSQLLFLLFFFLQGFANQSYGDPTLVDREIQQYCTNVIDSVRERDYLSQ KKVLEDLQKDIEQRVILLENHKKEYNLWFQKYDSFIMSYNKNILDIYKKMDSDSAALQLEQIDP DISSHILMRLSPRQSSLIMSKMNPKSATMITNVVANMLKFKKLKRSS CLIBASIA_01600proteinfromCandidatusLiberibacterasiaticus (336aa) SEQIDNO:14 MRQFLVIIAMAMLSNIFPFLSIAETNKLPYYTLLDTNTGHVIAENYPDHPWNPASLTKLMTAYV VFSFLKEKKAMLTTPIIISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAVAIAESLC KTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDFPQYMHYFQIKG LEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIAVILGALDRNTRNKVS ASLLSMGFYNKTDRKKINYIIKDFYQQNLSNEVPNISEEVCTTQKEIINYNTQMKEAKDKESHF IDFEKITLLKNKITKK CLIBASIA_03230proteinfromCandidatusLiberibacterasiaticus (162aa) SEQIDNO:15 MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVPKNDE KYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISACASDDKGNK STLCVECPSPSTPGQYDLNHCAECENTTSKGLCP CLIBASIA_03070proteinfromCandidatusLiberibacterasiaticus (474aa) SEQIDNO:16 MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPV DVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLR RFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAG EDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSF ETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTP TVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEG IPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRV NKIYGPKEASEVEGQNYKGAIGFIYK CLIBASIA_02610proteinfromCandidatusLiberibacterasiaticus (412aa) SEQIDNO:17 MYFITIISIVFTLPSHALSIVPNVSLEKVLQNYATIAHAKYEDALMCARTLDSAIETLVTTPNK KNLENARLQWIRARIPYQQSEVYRFGNKIVDTWDKKVNAWPLDEGFIDYVDSSYGKENEENNLY TANIIANSKIIVNEKEIDLSIISPDLLRKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPG NRPYTDFDIGNCTGGHCRRRVEYLKVVSKILVSDLEEMMKAWGPDGQATKDLMKDINAGLNSII TGMTSLSYNELAGERMNLGLILHDPEQEIDCFSDNTYASYLNDVIGIISSYTGEYIRMNGEKIH GASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESFDQMISENNPEGNKIVRNLIND LITQTESLRKIRIALDLIEPNRVIGNVP CLIBASIA_02470proteinfromCandidatusLiberibacterasiaticus (131aa) SEQIDNO:18 MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEKHQRE LFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCPEGDLLCPF INN CLIBASIA_02425proteinfromCandidatusLiberibacterasiaticus (205aa) SEQIDNO:19 MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEV SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG FYNTISLGVGMKF CLIBASIA_02250proteinfromCandidatusLiberibacterasiaticus (195aa) SEQIDNO:20 MFKRTIYTYLLLLCGFTEAFSTENTTKYLTLYTDQNQSVMLPIIHSFEERTGVKISPIYTSSIQ RPPITQGSPVDVIITKDETSLALNEDLLHKLPAHLIKKNSFVLKNENKKLMRISFDTQVLAYST KRIKIADLPKSVFDLTNAQWKKRLSIAPNNISFHRLLNTMEQTPNKTVVQDFIKNITANEILTK YKR CLIBASIA_02145proteinfromCandidatusLiberibacterasiaticus (210aa) SEQIDNO:21 MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV CYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS ISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELGNN LSDSGLNEQDHNDVQISK CLIBASIA_02120proteinfromCandidatusLiberibacterasiaticus (294aa) SEQIDNO:22 MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTS ADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWM SLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEG CLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETN ASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTLF CLIBASIA_04025proteinfromCandidatusLiberibacterasiaticus (96aa) SEQIDNO:23 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKPNTSS IKIKNNIIEPQPGPSRWEGGWNGERYVREWER CLIBASIA_04040proteinfromCandidatusLiberibacterasiaticus (159aa) SEQIDNO:24 MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQ AAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEK RQGTTDGINNQSNATNDPSSKDKIAENTKED CLIBASIA_04170proteinfromCandidatusLiberibacterasiaticus (276aa) SEQIDNO:25 MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGR YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY LRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIP LPNGYSPPRKMGKIPIPSRF CLIBASIA_04520proteinfromCandidatusLiberibacterasiaticus (304aa) SEQIDNO:26 MIRKYVLALVFFLVPCTASVAQKVRLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNL DADIVFLQEMGSYNAVAKVFPKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSY PLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLK DWITQKKESLVPFVIAGDFNRKINYLGNNDDFWKTIDPNDSLIRFPKEKDSRCNANKNLRNKIP IDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYDF CLIBASIA_04580proteinfromCandidatusLiberibacterasiaticus (116aa) SEQIDNO:27 MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKPEICL LWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH CLIBASIA_05115proteinfromCandidatusLiberibacterasiaticus (185aa) SEQIDNO:28 MFLNVLKDFFVPRIRFLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSV PVTVEPLEGVRHGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSY NNRAAFEKRSQDTVLIEEMKRGKELVVSAKSKRGTNTRYIYSLIGLSDSLADIRKCN CLIBASIA_05315proteinfromCandidatusLiberibacterasiaticus (154aa) SEQIDNO:29 MRKNLLTSTSSLMFFFLSSGYALSGSSFGCCGEFKKKASSPRIHMRPFTKSSPYNNSVSNTVNN TPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQKHISRTRIDSSP PPGHIDPHPDHIRNTLALHRKMLEQS CLIBASIA_00100proteinfromCandidatusLiberibacterasiaticus (208aa) SEQIDNO:30 MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPIT EKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQI ISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS SEIIDWTLSSLPLSDN CLIBASIA_02075proteinfromCandidatusLiberibacterasiaticus (396aa) SEQIDNO:31 MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKET GVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEE SSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI TQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIP YYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQ IESIDVLLAEAR CLIBASIA_03120proteinfromCandidatusLiberibacterasiaticus (60aa) SEQIDNO:32 MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS CLIBASIA_04560proteinfromCandidatusLiberibacterasiaticus (195aa) SEQIDNO:33 MKSKNILIVSTLVICVLSISSCDLGDSIAKKRNTIGNTIKKSINRVIQENNKPRNMTIFKTEVK RDIRRASRLSLEEKSKNADKPTVIENQADNINIEVEVATNLNPNHQASEIDIAIENLPDLKSNH QASEIDIAIENLPDLKSNHQASEIDIAIENLPDHQVDRNHTLSNLRGACYQPSLVSNSSLKLWD VAF CLIBASIA_05640proteinfromCandidatusLiberibacterasiaticus (68a) SEQIDNO:34 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLTKGAK LSSD CLIBASIA_05320proteinfromCandidatusLiberibacterasiaticus (85aa) SEQIDNO:35 MSKFVVRIMFLLSAISSNPILAANEHSSVSEQKRKETTVGFISRLVNKRPVANKRCPNATKQTP PDHGSKYDTREVLMLFGGLNN