Ketoreductase mutant and method for producing chiral alcohol
20220403421 · 2022-12-22
Inventors
- Hao HONG (Morrisville, NC, US)
- Gage JAMES (Morrisville, NC, US)
- Yi HSIAO (Tianjin, CN)
- Na ZHANG (Tianjin, CN)
- Xuecheng JIAO (Tianjin, CN)
- Kejian ZHANG (Tianjin, CN)
- Yiming YANG (Tianjin, CN)
- Xiang WANG (Tianjin, CN)
- Yanqing ZHANG (Tianjin, CN)
Cpc classification
C12N15/70
CHEMISTRY; METALLURGY
International classification
C12N15/70
CHEMISTRY; METALLURGY
Abstract
Disclosed are a ketoreductase mutant and a method for producing a chiral alcohol. The ketoreductase mutant has an amino acid sequence obtained by the mutation of the amino acid sequence shown in SEQ ID NO: 1, and the mutation includes a mutation siteK200H. In the present disclosure, the mutant obtained by mutation takes a ketone compound as a raw material, the chiral alcohol may be efficiently produced by stereoselective reduction, and the stability is greatly improved, which is suitable for popularization and application to the industrial production of the chiral alcohol.
Claims
1. A ketoreductase mutant, wherein the ketoreductase mutant has an amino acid sequence obtained by the mutation of the amino acid sequence shown in SEQ ID NO: 1, and the mutation comprises a mutation site K200H.
2. The ketoreductase mutant according to claim 1, wherein the mutation also comprises at least one of the following mutation sites: A15, K28, G36, K39, G43, Q44, A46, V47, F59, K61, T65, K71, A94V, A144, M146, Y152, N156, I86, K208 or K237; or the amino acid sequence of the ketoreductase mutant is an amino acid sequence having the mutation site in a mutated amino acid sequence, and having more than 95% identity with the mutated amino acid sequence.
3. The ketoreductase mutant according to claim 2, wherein the mutation also comprises at least one of the following mutation sites: A15C, K28A/E/M/Q/R/S, G36C, K39I/V, G43C/M, Q44R, A46C, V47C, F59C, K61E/H, T65A, K71R, A94V, A144T, M146I, Y152F, N156S, I86V, K208R or K237E.
4. The ketoreductase mutant according to claim 3, wherein the mutation comprises any one of the following mutation site combinations: Q44R+N156S+K200H, Q44R+N156S+K200H+G201D, Q44R+N156S+K200H+G201D+M146I, Q44R+N156S+K200H+G201D+M146I+K61H, Q44R+N156S+K200H+G201D+M146I+K61H+I86V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I, or Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M.
5. The ketoreductase mutant according to claim 1, wherein the occurrence of the amino acid mutation comprises any one of the following mutation site combinations: I86V+M146I+K200H, M146I+K200H, M146L+N156S+K200H, M146L+K200H, K200H+G201D, Q44R+M146I+K200H, K61E+K200H+K237E, I86V+M146I+K200H, M146I+K200H+G201D, M146L+K200H+G201D, N156S+K200H+G201D, K200H+G201D+K237E, K28E+M146I+K200H+G201D, K28E+M146L+K200H+G201D, K28E+N156S+K200H+G201D, Q44R+M146L+K200H+G201D, Q44R+N156S+K200H+G201D, I86V+M146I+K200H+K61H, I86V+M146I+K200H+K208R, I86V+M146I+K200H+G201D, I86V+M146L+K200H+G201D, Q44R+N156S+K200H+G201D, Q44R+N156S+K200H+G201D+M146I, Q44R+N156S+K200H+G201D+M146I+K61H, Q44R+N156S+K200H+G201D+M146I+K61H+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+T65A, Q44R+N156S+K200H+G201D+M146I+K61H+I86V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R, Q44R+N156S+K200H+G201D+M146I+K61H+I86V+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+I86V+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+I86V+T65A, Q44R+N156S+K200H+G201D+M146I+K61H+I86V+A94V, Q44R+N156S+K200H+G201D+M146I+K61H+I86V+K208R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+T65A, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+V47C+F59C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+G43C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28Q, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28M, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28A, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28S, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+I86V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+G36C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+I39V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+K71R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+A144T, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+Y152F, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+K28E, or Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+G36C.
6. A DNA molecule, wherein the DNA molecule encodes the ketoreductase mutant according to claim 1.
7. A recombinant plasmid, wherein the recombinant plasmid contains the DNA molecule according to claim 6.
8. The recombinant plasmid according to claim 7, wherein the recombinant plasmid is pET-22a (+), pET-22b (+), pET-3a (+), pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18 or pUC-19.
9. A host cell, wherein the host cell contains the recombinant plasmid according to claim 7.
10. The host cell according to claim 9, wherein the host cell comprises a prokaryotic cell or a eukaryotic cell; preferably, the prokaryotic cell is Escherichia coli.
11. A method for producing a chiral alcohol, comprising a step of catalyzing a reduction reaction of a latent chiral ketone compound to produce the chiral alcohol by a ketoreductase, wherein the ketoreductase is the ketoreductase mutant according to claim 1.
12. The method according to claim 11, wherein the chiral ketone compound has the following structural formula ##STR00007## wherein R.sub.1 and R.sub.2 are each independently an alkyl, a cycloalkyl, an aryl or a heteroaryl, or R.sub.1 and R.sub.2 form a heterocyclyl, a carbocyclyl or a heteroaryl together with carbon in a carbonyl, heteroatoms in the heterocyclyl or the heteroaryl is each independently at least one of nitrogen, oxygen or sulfur, an aryl group in the aryl, a heteroaryl group in the heteroaryl, a carbocyclyl group in the carbocyclyl or a heterocyclyl group in the heterocyclyl is each independently unsubstituted or substituted with at least one of a halogen, an alkoxy, or an alkyl; R.sub.1 and R.sub.2 are each independently a C.sub.1˜C.sub.5 alkyl, a C.sub.5˜C.sub.10 cycloalkyl, a C.sub.5˜C.sub.10 aryl or a C.sub.5˜C.sub.10 heteroaryl, or R.sub.1 and R.sub.2 form a C.sub.5˜C.sub.10 heterocyclyl, a C.sub.5˜C.sub.10 carbocyclyl or a C.sub.5˜C.sub.10 heteroaryl together with carbon in a carbonyl, heteroatoms in the C.sub.5˜C.sub.10 heterocyclyl or the C.sub.5˜C.sub.10 heteroaryl are each independently at least one of nitrogen, oxygen or sulfur, an aryl group in the C.sub.5˜C.sub.10 aryl, a heteroaryl group in the C.sub.5˜C.sub.10 heteroaryl, a carbocyclyl group in the C.sub.5˜C.sub.10 carbocyclyl or a heterocyclyl group in the C.sub.5˜C.sub.10 heterocyclyl is each independently unsubstituted or substituted with at least one of a halogen, an alkoxy, or an alkyl.
13. The method according to claim 11, wherein the reaction system for producing the chiral alcohol by reducing the ketone compound with the ketoreductase further comprises a coenzyme, a coenzyme regeneration system and a buffer.
14. The method according to claim 13, wherein the concentration of the ketone compound in the reaction system is 1 g/L˜200 g/L.
15. The method according to claim 13, wherein the pH value of the reaction system is 5˜9, and the reaction temperature of the reaction system is 4˜60° C.
16. The method according to claim 13, wherein the coenzyme is NADH.
17. The method according to claim 16, wherein the coenzyme regeneration system includes: isopropanol, coenzyme NAD.sup.+ and ketoreductase.
18. The method according to claim 13, wherein the buffer is a phosphate buffer, a Tris-hydrochloric acid buffer, a sodium barbital-hydrochloric acid buffer or a citric acid-sodium citrate buffer.
19. The method according to claim 12, wherein the structure of the ketone compound is ##STR00008## wherein, R.sub.3 is H, F, Cl, Br or CH.sub.3, R.sub.4 is H, F, Cl, Br or CH.sub.3, and R.sub.5 is H, F, Cl, Br, CH.sub.3, OCH.sub.3 or CH.sub.2CH.sub.3.
20. The method according to claim 12, wherein the ketone compound is ##STR00009##
Description
DETAILED DESCRIPTION OF THE EMBODIMENTS
[0029] It should be noted that embodiments in the present disclosure and features of the embodiments may be combined with each other in the case without conflicting. The present disclosure is described in detail below with reference to the embodiments.
Definitions
[0030] “Ketoreductase” and “KRED” are used interchangeably in the present disclosure, and refer to a polypeptide capable of reducing a ketone group into a corresponding alcohol thereof. Specifically, the ketoreductase polypeptide of the present disclosure is capable of stereoselectively reducing a ketone compound into a corresponding alcohol product. The polypeptide usually uses cofactor reduced nicotinamide adenine dinucleotide (NADH) or reduced nicotinamide adenine dinucleotide as a reducing agent. In the present disclosure, the ketoreductase includes a naturally occurring (wild-type) ketoreductase and a non-naturally occurring ketoreductase mutant produced by artificial treatment.
[0031] “Naturally occurring” or “wild-type” is opposite to “mutant”, and refers to a form found in nature. For example, a naturally occurring or wild-type polypeptide or polynucleotide sequence is a sequence that exists in an organism, it may be isolated from a source in nature, and which has not been intentionally modified by human manipulation.
[0032] In the present disclosure, “recombinant” when used with reference to, e.g., a cell, nucleic acid, or polypeptide, refers to a material, or a material corresponding to the natural or native form of the material, that has been modified in a manner that would not otherwise exist in nature, or is identical thereto but produced or derived from synthetic materials and/or by manipulation using recombinant techniques. Non-limiting examples include, among others, recombinant cells expressing genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise expressed at a different level.
[0033] “Percentage of sequence identity” refers to comparison between polynucleotides, and is determined by comparing two optimally aligned sequences over a comparison window, herein a portion of a polynucleotide sequence in a comparison window may include addition or deletion (namely, gaps) compared with a reference sequence, which is used for the optimal alignment of the two sequences. The percentage may be calculated as follows: by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Optionally, the percentage may be calculated as follows: by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Herein, the “reference sequence” refers to a designated sequence used as a basis for sequence comparison. The reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or a polypeptide sequence.
[0034] Site-directed mutation: refers to the introduction of a desired change (usually a change that represents a favorable direction) into a target DNA fragment (may be a genome, or a plasmid) by methods such as a polymerase chain reaction (PCR), including addition, deletion, point mutation of bases and the like. The site-directed mutation may rapidly and efficiently improve the characters and representation of a target protein expressed by DNA, and is a very useful means in genetic research work.
[0035] A KRED mutant E144A+L152Y+L198Q+E201G+G6S+L146M+147V+D42E+T199V derived from Acetobacter pasteurianus 386B (as a template of the present disclosure, it has the amino acid sequence of SEQ ID NO: 1. In the present disclosure, “E144A” is taken as an example, it means “original amino acid+site+mutated amino acid”, namely, E in the 144-th site is changed into A) may catalyze a target substrate to obtain a product, but its stability needs to be further improved. The present disclosure seeks to improve the stability of KRED by a method of directed evolution.
TABLE-US-00001 SEQ ID NO: 1: MARVASKVAIVSGAANGIGKATAQLLAKEGAKVVIGDLKEE EGQKAVAEIKAAGGEAAFVKLNVTDEAAWKAAIGQTLKLYG RLDIAVNNAGIAYSGSVESTSLEDWRRVQSINLDGVFLGTQ VAIEAMKKSGGGSIVNLSSIAGMVGDPMYAAYNASKGGVRL FTKSAALHCAKSGYKIRVNSVHPGYIWTPMVAGQVKGDAAA RQKLVDLHPIGHLGEPNDIAYGILYLASDESKFVTGSELVI DGGYTAQ
[0036] In the present application, firstly, a mutation site is introduced into KRED by a mode of the site-directed mutation, the activity of the mutant is detected, and the mutant with the improved activity is selected. Herein the stability of the mutant E144A+L152Y+L198Q+E201G+G6S+L146M+147V+D42E+T199V+K200H is improved by about 3 times compared to a starting template. Subsequently, the mutation is continued with E144A+L152Y+L198Q+E201G+G6S+L146M+147V+D42E+T199V+K200H as a template, in order to obtain a mutant with more significant stability improvement.
[0037] The method for introducing the site-directed mutation by using the whole-plasmid PCR is simple and effective, and is a method used more at present. A principle thereof is that after a pair of primers (forward and reverse) containing mutation sites are annealed with a template plasmid, “cyclic extension” is performed by using a polymerase, and the so-called cyclic extension is that the polymerase extends the primer according to the template, is returned to a 5-terminal of the primer and terminated after one circle, and subjected to a cycle of repeatedly heated and annealed extension, this reaction is different from rolling circle amplification, and does not form multiple tandem copies. Extension products of the forward and reverse primers are paired to form an open-circle plasmid with an incision after annealed. A Dpn I enzyme-digested extension product, because the original template plasmid is derived from conventional Escherichia coli, is modified by dam methylation, and is sensitive to Dpn I so as to be shredded, but a plasmid with a mutant sequence synthesized in vitro is not cut because it is not methylated, so it may be successfully transformed in subsequent transformation, and a clone of a mutant plasmid may be obtained. The above mutant plasmid is transformed into an Escherichia coli cell, and over-expressed in the Escherichia coli. After that, a crude enzyme is obtained through a method of ultrasonic cell-break. An optimum condition of transaminase induced expression is as follows: 25° C., and inducing in 0.1 mM IPTG for 16 h. In a typical embodiment of the present disclosure, a ketoreductase mutant is provided. The ketoreductase mutant has an amino acid sequence obtained by the mutation of the amino acid sequence shown in SEQ ID NO: 1, and the mutation includes a mutation site K200H. In the present disclosure, the mutant obtained by mutation takes a ketone compound as a raw material, the chiral alcohol may be efficiently produced by stereoselective reduction, and the stability is greatly improved, which is suitable for popularization and application to the industrial production of the chiral alcohol.
[0038] Preferably, the mutation includes at least one of the following mutation sites: A15, K28, G36, K39, G43, Q44, A46, V47, F59, K61, T65, K71, A94V, A144, M146, Y152, N156, I86, K208 or K237, or the amino acid sequence of the ketoreductase mutant is an amino acid sequence having the mutation site in a mutated amino acid sequence, and having more than 95% identity with the mutated amino acid sequence. The above mutation sites may further improve the stability of the enzyme. Preferably, the mutation include at least one of the following mutation sites: A15C, K28A/E/M/Q/R/S, G36C, K39I/V, G43C/M, Q44R, A46C, V47C, F59C, K61E/H, T65A, K71R, A94V, A144T, M146I, Y152F, N156S, I86V, K208R or K237E. Herein, “/” represents “or”.
[0039] In a typical embodiment of the present disclosure, the mutation includes any one of the following mutation site combinations: Q44R+N156S+K200H+G201D, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I, Q44R+N156S+K200H Q44R+N156S+K200H+G201D, Q44R+N156S+K200H+G201D+M146I, Q44R+N156S+K200H+G201 D+M146I+K61H, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V Q44R+N156S+K200H+G201D+M146I+K61H+K208R Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+A150, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I, or Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M.
[0040] More preferably, the occurrence of the amino acid mutation includes any one of the following mutation site combinations: I86V+M146I+K200H, M146I+K200H, M146L+N156S+K200H, M146L+K200H, K200H+G201 D, Q44R+M146I+K200H, K61E+K200H+K237E, I86V+M146I+K200H, M146I+K200H+G201 D, M146L+K200H+G201 D, N156S+K200H+G201 D, K200H+G201 D+K237E, K28E+M146I+K200H+G201 D, K28E+M146L+K200H+G201 D, K28E+N156S+K200H+G201D, Q44R+M146L+K200H+G201D, Q44R+N156S+K200H+G201D, I86V+M146I+K200H+K61H, I86V+M146I+K200H+K208R, I86V+M146I+K200H+G201 D, I86V+M146L+K200H+G201 D, Q44R+N156S+K200H+G201 D, Q44R+N156S+K200H+G201 D+M146I, Q44R+N156S+K200H+G201 D+M146I+K61H, Q44R+N156S+K200H+G201 D+M146I+K61H+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+T65A, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V+K28E, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V+K39I, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V+T65A, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V+A94V, Q44R+N156S+K200H+G201 D+M146I+K61H+I86V+K208R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K28E, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+T65A, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+K28E, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+V47C+F59C, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+G43C, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28E, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28Q, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28M, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28A, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+K28S, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+I86V, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+G36C, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+139V, Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+K71R, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+A144T, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+Y152F, Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+K28E or Q44R+N156S+K200H+G201 D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+G36C.
[0041] According to a typical embodiment of the present disclosure, a DNA molecule is provided. The DNA molecule encodes the above ketoreductase mutant. The above ketoreductase encoded by the DNA molecule has the good activity.
[0042] The above DNA molecule of the disclosure may also exist in the form of an “expression cassette”. The “expression cassette” refers to a linear or circular nucleic acid molecule that encompasses DNA and RNA sequences capable of guiding expression of a specific nucleotide sequence in an appropriate host cell. Generally, including a promoter which is effectively linked with a target nucleotide, it is optionally effectively linked with a termination signal and/or other control elements. The expression cassette may also include a sequence required for proper translation of the nucleotide sequence. A coding region usually encodes a target protein, but also encodes a target function RNA in a sense or antisense direction, for example an antisense RNA or an untranslated RNA. The expression cassette including a target polynucleotide sequence may be chimeric, which means that at least one of components thereof is heterologous to at least one of the other components thereof. The expression cassette may also be existent naturally, but obtained with effective recombinant formation for heterologous expression. According to a typical embodiment of the present disclosure, a recombinant plasmid is provided. The recombinant plasmid contains any one of the above DNA molecules. The DNA molecule in the above recombinant plasmid is placed in an appropriate position of the recombinant plasmid, so that the above DNA molecule may be correctly and smoothly replicated, transcribed or expressed.
[0043] Although a qualifier used in the disclosure while the above DNA molecule is defined is “contain”, it does not mean that other sequences which are not related to a function thereof may be arbitrarily added to both ends of the DNA sequence. Those skilled in the art know that in order to meet the requirements of recombination operations, it is necessary to add suitable enzyme digestion sites of a restriction enzyme at two ends of the DNA sequence, or additionally increase a start codon, a termination codon and the like, therefore, if the closed expression is used for defining, these situations may not be covered truly.
[0044] A term “plasmid” used in the present disclosure includes any plasmid, cosmid, bacteriophage or agrobacterium binary nucleic acid molecule in double-stranded or single-stranded linear or circular form, preferably a recombinant expression plasmid, which may be a prokaryotic expression plasmid or may be a eukaryotic expression plasmid, preferably the prokaryotic expression plasmid, in some embodiments, the recombinant plasmid is selected from pET-22a (+) pET-22b (+), pET-3a (+), pET-3d (+), pET-11a (+), pET-12a (+), pET-14b (+), pET-15b (+), pET-16b (+), pET-17b (+), pET-19b (+), pET-20b (+), pET-21a (+), pET-23a (+), pET-23b (+), pET-24a (+), pET-25b (+), pET-26b (+), pET-27b (+), pET-28a (+), pET-29a (+), pET-30a (+), pET-31b (+), pET-32a (+), pET-35b (+), pET-38b (+), pET-39b (+), pET-40b (+), pET-41a (+), pET-41b (+), pET-42a (+), pET-43a (+), pET-43b (+), pET-44a (+), pET-49b (+), pQE2, pQE9, pQE30, pQE31, pQE32, pQE40, pQE70, pQE80, pRSET-A, pRSET-B, pRSET-C, pGEX-5X-1, pGEX-6p-1, pGEX-6p-2, pBV220, pBV221, pBV222, pTrc99A, pTwin1, pEZZ18, pKK232-18, pUC-18 or pUC-19. More preferably, the above recombinant plasmid is pET-22b (+).
[0045] According to a typical embodiment of the present disclosure, a host cell is provided, and the host cell contains any one of the above recombinant plasmids. The host cell suitable for the present disclosure includes, but is not limited to, a prokaryotic cell, yeast or a eukaryotic cell. Preferably the prokaryotic cell is eubacteria, for example Gram-negative bacteria or Gram-positive bacteria. More preferably, the prokaryotic cell is an Escherichia coli BL21 cell or an Escherichia coli DH5a competent cell.
[0046] According to a typical embodiment of the present disclosure, a method for producing a chiral alcohol is provided. The method includes a step of catalyzing a reduction reaction of a latent chiral ketone compound to produce the chiral alcohol by a ketoreductase, and the ketoreductase is any one of the above ketoreductase mutants. Since the ketoreductase mutant of the present disclosure has the good activity characteristics, the chiral alcohol prepared by using the ketoreductase mutant of the present disclosure may increase the reaction rate, improve the substrate concentration, reduce the amount of the enzyme, and reduce the difficulty of post-treatment.
[0047] In the present disclosure, the chiral ketone compound includes, but is not limited to, those with the following structural formula
##STR00004##
herein R.sub.1 and R.sub.2 are each independently an alkyl, a cycloalkyl, an aryl or a heteroaryl, or R.sub.1 and R.sub.2 form a heterocyclyl, a carbocyclyl or a heteroaryl together with carbon in a carbonyl, heteroatom in the heterocyclyl or the heteroaryl is each independently at least one of nitrogen, oxygen or sulfur, an aryl group in the aryl, a heteroaryl group in the heteroaryl, a carbocyclyl group in the carbocyclyl or a heterocyclyl group in the heterocyclyl is each independently unsubstituted or substituted with at least one of a halogen, an alkoxy, or an alkyl; and preferably, R.sub.1 and R.sub.2 are each independently a C.sub.1˜C.sub.8 alkyl, a C.sub.5˜C.sub.10 cycloalkyl, a C.sub.5˜C.sub.10 aryl or a C.sub.5˜C.sub.10 heteroaryl, or R.sub.1 and R.sub.2 form a C.sub.5˜C.sub.10 heterocyclyl, a C.sub.5˜C.sub.10 carbocyclyl or a C.sub.5˜C.sub.10 heteroaryl together with carbon in a carbonyl, heteroatoms in the C.sub.5˜C.sub.10 heterocyclyl and the C.sub.5˜C.sub.10 heteroaryl are each independently at least one of nitrogen, oxygen or sulfur, an aryl group in the C.sub.5˜C.sub.10 aryl, a heteroaryl group in the C.sub.5˜C.sub.10 heteroaryl, a carbocyclyl group in the C.sub.5˜C.sub.10 carbocyclyl or a heterocyclyl group in the C.sub.5˜C.sub.10 heterocyclyl is each independently unsubstituted or substituted with at least one of a halogen, an alkoxy, or an alkyl.
[0048] Preferably, the structure of the ketone compound is
##STR00005##
herein, R.sub.3 is H, F, Cl, Br or CH.sub.3, R.sub.4 is H, F, Cl, Br or CH.sub.3, and R.sub.5 is H, F, Cl, Br, CH.sub.3, OCH.sub.3 or CH.sub.2CH.sub.3.
[0049] More preferably, the ketone compound is
##STR00006##
[0050] The host cell previously described in the present disclosure may be used for the expression and isolation of the ketoreductase, or optionally, they may be used directly to convert a ketone substrate into a chiral alcohol product. Preferably, the prokaryotic cell is Escherichia coli.
[0051] The reduction reaction described above generally requires a cofactor, it is typically NADH or NADPH, and the reduction reaction may include a system for regenerating the cofactor, for example D-glucose, coenzyme NAD.sup.+, and glucose dehydrogenase GDH; a formate compound, coenzyme NAD.sup.+ and formate dehydrogenase FDH; or isopropanol, coenzyme NAD.sup.+ and alcohol dehydrogenase ADH. In some embodiments using the purified ketoreductases, such cofactors and optionally such cofactor regeneration systems may be usually added to a reaction medium with the substrate and the ketoreductase. Similar to the ketoreductase, any enzymes including the cofactor regeneration system may be in the form of an extract or a lysate of such cells, or added to a reaction mixture as a purified enzyme. In embodiments using the cell extract or the cell lysate, the cell used to produce the extract or the lysate may be an enzyme expressed that only contains the cofactor regeneration system or contains the cofactor regeneration system and the ketoreductase. In embodiments using a whole cell, the cell may be an enzyme expressed that contains the cofactor regeneration system and the ketoreductase.
[0052] Whether the whole cell, the cell extract, or the purified ketoreductase is used, a single ketoreductase may be used, or optionally, a mixture of two or more ketoreductases may be used.
[0053] The reaction system for producing the chiral alcohol by catalyzing the reduction reaction on the chiral ketone compound by the ketoreductase further includes a coenzyme, a coenzyme regeneration system and a buffer.
[0054] Due to the higher catalytic activity of the ketoreductase mutant of the present disclosure, the concentration of the substrate may be increased, the production efficiency may be improved, and the concentration of the chiral ketone compound in the reaction system is 1 g/L˜200 g/L.
[0055] The pH value of the reaction system is 5˜9, and the reaction temperature of the reaction system is 4˜60° C.; and the buffer is a phosphate buffer, a Tris-hydrochloric acid buffer, a sodium barbital-hydrochloric acid buffer or a citric acid-sodium citrate buffer.
[0056] The beneficial effects of the present disclosure are further described below in combination with the embodiments.
[0057] In the present application, an enzyme activity detection method is as follows:
[0058] 1. Reagent Preparation:
[0059] Substrate (R)-1-(2,4-dichloroacetophenone) mother solution 60 mM: 56.7 mg substrate is weighed and dissolved in 5 mL of 0.1 M phosphate buffer (PB) with pH 7.0, and it is placed in a water bath kettle at 50° C. for dissolving.
[0060] NADH mother solution 10 mM: 33.17 mg NADH is weighed and dissolved in 5 mL of 0.1 M PB with pH 7.0.
[0061] 2. Enzyme Activity System:
[0062] The enzyme is firstly added, then a mixture of the substrate (R)-1-(2,4-dichloroacetophenone), NADH and Buffer is added, it is placed in a microplate reader, and the enzyme activity is detected at 30° C. and 340 nm wavelength.
[0063] A detection system is shown in Table 1.
TABLE-US-00002 TABLE 1 System Addition amount Final concentration Enzyme mutant 20 μL N/A Substrate 50 μL 10 mM NADH 10 μL 0.33 mM 0.1M PB pH 7.0 buffer 220 μL N/A
[0064] The stability is expressed as the residual activity, namely the percentage value of the activity after the treatment to the activity before the treatment.
[0065] The KRED mutant E144A+L152Y+L198Q+E201G+G6S+L146M+147V+D42E+T199V is referred to as a “template” in the present disclosure, and the listed mutation sites are mutations performed on the basis of the “template”.
Embodiment 1
[0066] The “template” and the mutant are incubated at 45° C. and 53° C. for 1 h respectively, and then the activities thereof are measured. Compared with those without incubation, the stability is expressed as a percentage of its residual activity and initial activity. The thermal stability of all mutants is measured at 53° C. and results are shown in Table 2.
TABLE-US-00003 TABLE 2 Stability Mutant (%) Template +++ (45° C.) Template .sup. + (53° C.) K200H ++ I86V + M146I + K200H +++ M146I + K200H +++ M146L + N156S + K200H ++++ M146L + K200H +++ K200H + G201D +++ Q44R + M146I + K200H +++ K61E + K200H + K237E ++ I86V + M146I + K200H +++ M146I + K200H + G201D ++++ M146L + K200H + G201D +++ N156S + K200H + G201D ++++ K200H + G201D + K237E +++ K28E + M146I + K200H + G201D ++++ K28E + M146L + K200H + G201D +++ K28E + N156S + K200H + G201D ++++ Q44R + M146L + K200H + G201D +++ Q44R + N156S + K200H + G201D ++++ I86V + M146I + K200H + K61H ++++ I86V + M146I + K200H + K208R ++++ I86V + M146I + K200H + G201D +++ I86V + M146L + K200H + G201D +++ + represents the stability, + represents residual activity 0-5%, ++ represents residual activity 5-10%, +++ represents residual activity 10-50%, and ++++ represents residual activity 50-95%.
Embodiment 2
[0067] Combining saturation mutations may obtain a mutant with a synergistic effect among several mutation sites, and may optimize the composition of an amino acid thereof. Q44R+N156S+K200H+G201D is taken as a template, the mutation site combination is performed. At this time, the enzyme solution treatment condition is that it is treated at 65° C. for 1 h, and then the activity thereof is measured. Compared with those without incubation, the stability is expressed as a percentage of its residual activity and initial activity.
[0068] Preparation method of enzyme solution in high-throughput screening: a 96-well plate is centrifuged to remove a supernatant medium, and 200 μL of enzymatic solution (lysozyme 2 mg/mL, polymyxin 0.5 mg/mL, and pH=7.0) is added to each well, it is incubated at 37° C. and crushed for 3 h. Enzyme activity detection method: an enzyme is firstly added, then a mixture of substrate (R)-1-(2,4-dichloroacetophenone), NADH and Buffer is added, it is placed in a microplate reader, the enzyme activity is detected at 30° C. and 340 nm wavelength, and results are shown in Table 3.
TABLE-US-00004 TABLE 3 Stability Mutant (%) Q44R + N156S + K200H + G201D + Q44R + N156S + K200H + G201D + M146I ++ Q44R + N156S + K200H + G201D + M146I + K61H +++ Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K28E Q44R + N156S + K200H + G201D + M146I + K61H + +++ T65A Q44R + N156S + K200H + G201D + M146I + K61H + +++ I86V Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R Q44R + N156S + K200H + G201D + M146I + K61H + +++ I86V + K28E Q44R + N156S + K200H + G201D + M146I + K61H + +++ I86V + K39I Q44R + N156S + K200H + G201D + M146I + K61H + ++ I86V + T65A Q44R + N156S + K200H + G201D + M146I + K61H + ++++ I86V + A94V Q44R + N156S + K200H + G201D + M146I + K61H + +++ I86V + K208R Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + K28E Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + K39I Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K28E Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K39I Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + T65A Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K39I + K28E + represents the stability, + represents residual activity 0-5%, ++ represents residual activity 5-10%, +++ represents residual activity 10-50%, and ++++ represents residual activity 50-95%.
Embodiment 3
[0069] The mutation is continued with Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I as a template. At this time, the enzyme solution treatment condition is that it is treated at 71° C. for 1 h, and then the activity thereof is measured. Compared with those without incubation, the stability is expressed as a percentage of its residual activity and initial activity.
[0070] Preparation method of enzyme solution in high-throughput screening: a 96-well plate is centrifuged to remove a supernatant medium, and 200 μL of enzymatic solution (lysozyme 2 mg/mL, polymyxin 0.5 mg/mL, and pH=7.0) is added to each well, it is incubated at 37° C. and crushed for 3 h. Enzyme activity detection method: an enzyme is firstly added, then a mixture of substrate (R)-1-(2,4-dichloroacetophenone), NADH and Buffer is added, it is placed in a microplate reader, the enzyme activity is detected at 30° C. and 340 nm wavelength, and results are shown in Table 4.
TABLE-US-00005 TABLE 4 Stability Mutant (%) Q44R + N156S + K200H + G201D + M146I + K61H + + K208R + A94V + K39I Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + A15C + A46C Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + V47C + F59C Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + G43C Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + K28E Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + A15C + A46C + K28R Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + K28Q Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + K28M Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + A15C + A46C + K28A Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + A15C + A46C + K28S Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K39I + A15C + A46C + G43M Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + A15C + A46C + I86V Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + G43M Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K39I + A15C + A46C + G43M + G36C Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + G43M + 139V Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + G43M + K71R Q44R + N156S + K200H + G201D + M146I + K61H + ++ K208R + A94V + K39I + A15C + A46C + G43M + A144T Q44R + N156S + K200H + G201D + M146I + K61H + +++ K208R + A94V + K39I + A15C + A46C + G43M + Y152F Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K39I + A15C + A46C + G43M + K28E Q44R + N156S + K200H + G201D + M146I + K61H + ++++ K208R + A94V + K39I + A15C + A46C + G43M + G36C + represents the stability, + represents residual activity 0-5%, ++ represents residual activity 5-10%, +++ represents residual activity 10-50%, and ++++ represents residual activity 50-95%.
Embodiment 4
[0071] In the process of improving the stability of an enzyme, the overall rigidity of the enzyme is improved, so a mutant with the improved stability also shows the improved tolerance to chemicals such as glutaraldehyde and organic solvents such as methanol. This is also the extrinsic manifestation of the improved overall rigidity of the mutant.
[0072] The previously described mutant is tested for the glutaraldehyde tolerance and the methanol tolerance. Herein the glutaraldehyde tolerance is tested by incubating with 1% glutaraldehyde for 1 h, and then measuring the residual activity, and the glutaraldehyde tolerance is expressed as a percentage of the activity without incubation and the activity with incubation. The methanol tolerance is tested by incubating with 60% methanol solution for 1 h, and then measuring the residual activity, and the methanol tolerance is expressed as a percentage of the activity without incubation and the activity with incubation. Results are shown in Table 5.
TABLE-US-00006 TABLE 5 Glutaraldehyde Methanol tolerance tolerance Mutant (%) (%) Template * # K200H ** ## I86V + M146I + K200H ** ## M146L + K200H ** ## M146L + N156S + K200H ** ## K200H + G201D ** ## Q44R + M146I + K200H ** ## K61E + K200H + K237E ** ## I86V + M146I + K200H ** ## M146I + K200H + G201D ** ## M146L + K200H + G201D ** ## N156S + K200H + G201D ** ## K200H + G201D + K237E ** ## K28E + M146I + K200H + G201D ** ## K28E + M146L + K200H + G201D ** ## K28E + N156S + K200H + G201D *** ### Q44R + M146L + K200H + G201D ** ## Q44R + N156S + K200H + G201D ** ## I86V + M146I + K200H + K61H ** ## I86V + M146I + K200H + K208R ** ## I86V + M146I + K200H + G201D ** ## I86V + M146L + K200H + G201D ** ## Q44R + N156S + K200H + G201D + *** ### M146I Q44R + N156S + K200H + G201D + ** ## M146I + K61H Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K28E Q44R + N156S + K200H + G201D + ** ## M146I + K61H + T65A Q44R + N156S + K200H + G201D + *** ### M146I + K61H + I86V Q44R + N156S + K200H + G201D + *** ### M146I + K61H + I86V + K28E Q44R + N156S + K200H + G201D + *** ### M146I + K61H + I86V + K39I Q44R + N156S + K200H + G201D + *** ### M146I + K61H + I86V + T65A Q44R + N156S + K200H + G201D + *** ### M146I + K61H + I86V + A94V Q44R + N156S + K200H + G201D + *** ### M146I + K61H + I86V + K208R Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V + K28E Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V + K39I Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V + T65A Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V + K39I + K28E Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V + K39I Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + V47C + F59C Q44R + N156S + K200H + G201D + *** ### M146I + K61H + K208R + A94V + K39I + G43C Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + K28E Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + K28R Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + K28Q Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + K28M Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + K28A Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + I86V Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + G36C Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + I39V Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + K71R Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + A144T Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + Y152F Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + K28E Q44R + N156S + K200H + G201D + **** #### M146I + K61H + K208R + A94V + K39I + A15C + A46C + G43M + G36C * represents the glutaraldehyde tolerance, * represents residual activity 0-5%, ** represents residual activity 5-10%, *** represents residual activity 10-50%, and **** represents residual activity 50-95%. # represents the methanol tolerance, # represents residual activity 0-5%, ## represents residual activity 5-10%, ### represents residual activity 10-50%, and #### represents residual activity 50-95%.
Embodiment 5
[0073] A mutant Q44R+N156S+K200H+G201D+M146I+K61H+K208R+A94V+K39I+A15C+A46C+G43M+G36C is used to verify reactions of different substrates, and results are shown in Table 6.
[0074] 1) 2 g substrate 2-chloroacetophenone is added to a 25 mL reaction flask, and 0.1 M PB pH7.0, 2 g isopropanol, 20 mg NAD+, and 0.05 g a ketoreductase mutant are added, and mixed uniformly, the total volume is 10 mL, it is placed in a 200 rpm shaker at 50° C., and reacted for 16 hours.
[0075] 2) 2 g substrate 3-fluoroacetophenone is added to a 25 mL reaction flask, and 0.1 M of PB pH7.0, 2 g isopropanol, 20 mg NAD+, and 0.05 g a ketoreductase mutant are added, and mixed uniformly, the total volume is 10 mL, it is placed in a 200 rpm shaker at 50° C., and reacted for 16 hours.
[0076] 3) 2 g substrate 4-methoxyacetophenone is added to a 25 mL reaction flask, and 0.1 M of PB pH7.0, 2 g isopropanol, 20 mg NAD.sup.+, and 0.05 g a ketoreductase mutant are added, and mixed uniformly, the total volume is 10 mL, it is placed in a 200 rpm shaker at 50° C., and reacted for 16 hours.
[0077] 4) 2 g substrate ethyl acetoacetate is added to a 25 mL reaction flask, and 0.1 M of PB pH7.0, 2 g isopropanol, 20 mg NAD.sup.+, and 0.05 g a ketoreductase mutant are added, and mixed uniformly, the total volume is 10 mL, it is placed in a 200 rpm shaker at 50° C., and reacted for 16 hours.
TABLE-US-00007 TABLE 6 Number Substrate Conversion rate (%) ee 1 2-chloroacetophenone 99 >99% 2 3-fluoroacetophenone 99 >99% 3 4-methoxyacetophenone 99 >99% 4 Ethyl acetoacetate 99 >99%
[0078] The above are only preferred embodiments of the present disclosure, and are not intended to limit the present disclosure. For those skilled in the art, the present disclosure may have various modifications and changes. Any modifications, equivalent replacements, improvements and the like made within the spirit and principle of the present disclosure shall be included within a scope of protection of the present disclosure.