Targeting non-coding RNA for RNA interference

Abstract

A broad and extensive new category of targets for ribonucleic acids (RNAs) with interference activity (iRNAs), exclusive of the traditional messenger RNA (mRNA) targets have been discovered. iRNAs can be used to manipulate biological processes that do not explicitly involve mRNA and can be directed at non-coding RNAs, such as ribosomal RNAs (rRNAs) and transfer RNAs (tRNAs). iRNA sequences targeted at ribosomal rRNAs and tRNAs have been designed and tested. iRNA that targets a non-coding RNA is called non-coding interfering RNA (nciRNA). nciRNAs cause degradation of non-coding RNAs in vivo, and are highly active in biological assays. nciRNAs can be used as programmed toxins for specific targeting of eukaryotic pathogens and for protection of plants and structures from insects and weeds.

Claims

1. A noncoding inhibitory ribonucleicacid polynucleotide (nciRNA) comprising a nucleotide sequence complementary to a eukaryote non-coding RNA target (ncRNA) a) wherein binding of the nciRNA to the target ncRNA causes degradation of the target ncRNA; b) wherein the target ncRNA is ribosomal RNA (rRNA); wherein the nciRNA is produced within the eukaryote by processing of a single-stranded RNA precursor comprising the sequence of SEQ ID NO: 1.

2. The nciRNA of claim 1, wherein the single-stranded RNA precursor further comprises a polynucleotide sequence for purification of the RNA.

3. The nciRNA of claim 1, wherein the single-stranded RNA precursor further comprises a nucleotide sequence that has high affinity for a bacteriophage or viral capsid protein and enables incorporation of the single-stranded RNA precursor polynucleotide to within a viral particle.

4. The nciRNA of claim 1, wherein the eukaryote is Reticulitermes flavipes.

5. The nciRNA of claim 1, wherein the target nciRNA is expressed in an organism within a phylogenetic kingdom selected from the group consisting of Animalia, Plantae, and Protista.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is an image of a denaturing polyacrylamide gel of RNA which was packaged into a VLP by co-expression of the capsid protein and the RNA in vivo. The most intense band in the lane labeled product RNA corresponds to the encapsulated RNA including the duo tags, which is 751 nucleotides in length. mRNA encoding the capsid protein is shown as the faint band in the left lane below the position of the 650 nt size marker band. The single band corresponding to the 650 nucleotide size marker is the shown in the lane on the right.

(2) FIG. 2 is a scatter dot plot showing the number of RNA interference publications over a period of time (years). The data displayed was acquired from the NCBI Pubmed database, using the search term RNA Interference.

(3) FIG. 3 is a scatter dot plot of synthesized data intended to illustrate the survival of the Eastern subterranean termite Reticulitermes flavipes (as a fraction of the starting quantity), over time (in days), for termites consuming filter paper containing 300 g nciRNA.sup.aPTC(+) or a control containing buffer (.circle-solid.), respectively.

(4) FIG. 4 is a scatter dot plot to illustrate the survival of the Eastern subterranean termite Reticulitermes flavipes (as a fraction of the starting quantity), over time (in days), for termites consuming filter paper containing 600 g VLP-nciRNA.sup.aPTC(+) or a control containing buffer (.circle-solid.), respectively.

DETAILED DESCRIPTION OF THE INVENTION

(5) I. Definitions

(6) The term host cell refers to prokaryotic and eukaryotic cells into which a recombinant expression vector can be introduced.

(7) The terms transformed and transfected encompass the introduction of a nucleic acid (e.g., a vector) into a cell by a number of techniques known in the art.

(8) The term specifically binds to a target refers to a binding reaction which is determinative of the presence of the molecule in the presence of a heterogeneous population of other biologics.

(9) Localization Signal or Localization Sequence or Recognition Sequence or Targeting Signal or Targeting Sequence or Recognition Tag or Recognition polynucleotide are used interchangeably and refer to a signal that directs a molecule to a specific cell, tissue, organelle, or intracellular region. The signal can be polynucleotide, polypeptide, or carbohydrate moiety or can be an organic or inorganic compound sufficient to direct an attached molecule to a desired location.

(10) The term vector refers to a replicon, such as a plasmid, phage genome, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment or the expression of the inserted segment as RNA or protein. The vectors described herein can be expression vectors.

(11) The term expression vector refers to a vector that includes one or more expression control sequences.

(12) The term gene refers to a DNA sequence that encodes through its template or messenger RNA a sequence of amino acids characteristic of a specific peptide, polypeptide, or protein. The term gene also refers to a DNA sequence that encodes an RNA product. The term gene as used herein with reference to genomic DNA includes intervening, non-coding regions as well as regulatory regions and can include 5 and 3 ends.

(13) The term iRNA refers to a ribonucleic acid (RNA) molecule which can bind by complementary base pairing to target messenger RNA transcripts (mRNAs), or to non-coding RNAs, usually causing translational repression or target degradation which results in gene silencing or other downstream effects such as translational suppression by degradation of ribosomal RNA. Exemplary iRNA molecules include but are not limited to siRNA and microRNA.

(14) The terms target gene and target sequence are used interchangeably and refer to a sequence that can hybridize with an iRNA and induce gene silencing and other downstream effects.

(15) The terms individual, individual, subject, and patient are used interchangeably herein, and refer to a mammal, including, but not limited to, humans, rodents, such as mice and rats, and other laboratory animals.

(16) The terms virus like particle, or VLP refer to a viral or phage capsid formed from the assembly of viral or phage coat proteins, that does not contain viral genetic material. A VLP-RNA is a recombinant virus like particle containing a capsid of viral or bacteriophage coat proteins that can contain one or more RNA molecules enclosed within the capsid.

(17) II. Compositions for Non-Coding RNA Interference

(18) A broad and extensive category of targets (non-coding RNA) for interfering RNAs has been discovered. RNA with interference activity can be used to manipulate biological processes that do not explicitly involve messenger RNA and can be directed at non-coding RNAs, such as ribosomal RNA and transfer RNA. RNAs with interfering activity against non-coding targets (nciRNAs) are disclosed. Compositions for the efficient expression and delivery of nciRNAs are also provided. In some embodiments, nciRNAs are enclosed within virus like particles (VLPs).

(19) A. RNA Interference of Non-Coding Targets

(20) A traditional iRNA (an RNA molecule with interference activity) of appropriate sequence will prevent or reduce protein expression from a specific gene by causing degradation of mRNA. When an iRNA molecule forms complementary Watson-Crick base pairs with an mRNA, it induces mRNA cleavage by accessory proteins. The source of the iRNA can be viral infection, transcription, or introduction from exogenous sources.

(21) iRNA sequences targeted at non-coding RNAs, such as ribosomal RNAs (rRNAs) and transfer RNAs (tRNAs), have been designed and tested. iRNA that targets a non-coding RNA is referred to as RNA with interfering activity against non-coding targets (nciRNA). nciRNAs cause degradation of non-coding RNAs in vivo, and are highly active in biological assays. nciRNAs can be used as programmed toxins for specific targeting of eukaryotic pathogens and for protection of plants and structures from insects and weeds. Furthermore, in vivo synthesis of nciRNA and nciRNA precursors in prokaryotic expression systems such as Escherichia coli is adaptable and reliable.

(22) 1. Targets of nciRNA

(23) An nciRNA polynucleotide is highly specific for a non-coding target RNA within a target organism or group of organisms. Typically the target organism is a eukaryotic organism, such as a plant, animal, alga or fungus. Typically the target gene is not a naturally occurring viral gene.

(24) nciRNAs can be specifically designed to have interference activity against a target non-coding RNA. Non-coding RNAs include ribosomal RNA (rRNA), transfer RNA (tRNA), small nucleolar RNA (snoRNA), small nuclear RNA (snRNA or URNA) and extracellular RNA (exRNAs). In some embodiments the target for nciRNA is the translational machinery of eukaryotic cells, such as the rRNAs of either the small or large ribosomal subunit. In some embodiments an nciRNA is designed to target two or more non-coding RNAs. In other embodiments the nciRNA is designed to target a single non-coding RNA. The one or more target non-coding RNAs can be of any desired sequence and may be of any size. In one embodiment the nciRNA is the large subunit ribosomal RNA (28S rRNA).

(25) An exemplary nciRNA sequence targeting the large subunit ribosomal RNA (28S rRNA) is 5

(26) TABLE-US-00001 (SEQIDNO.1) rGUCCGAGUAAUUUACGUUUUGAUACGGUUGCGGAACUUGCGGGGUGCC UAUUGAAGCAUGAGCCGGCGACUCAGCCGUAAGGCUGGACCCGAAACC GGGCGAGCUAGCCCUGGCCAGCCGUAAGGCGAACCGGUGGGGGAUGCA AACCCCUCGGAUGAGCUGGGGCUAGGAGUGAAAAGCUAACCGAGCCCG GAGAUAGCUGGUUCUGCCGUAAGGCAGCGUUGCCGUAAGGCAAGUGCG AAUGCCGGCAUGAGUAACGAGCGGGAGAACCCUCGCCAAGGAACUCUG CAAGCCGUAAGGCCUCUGGCGACUGUUUACCAAAAACACAGCGCCGUAA GGCGCGAGCCGUAAGGCUAACGACCGGAGCGCUGUCUCGGCGAGGGACC CGGUGAAAUUGAACUGGCCGUGAAGAUGCGGCCUACCCGUGGCAGGAC GAAAAGACCCCGUGGAGCUUUACUGCCGUAAGGCAGUUUGACUGGGGC GGUCGGCCGUAAGGCUAAAAGUUACCCCGGGGAUAACAGGCUGAUCGC CGUAAGGCGGUUUGGCACCUCGAUGUCGGCUCGUCGCGCCGUAAGGCU UGGGCUGUUCGCCCAUUAAAGCGGCACGCGAGCUGGGUUCAGAACGUC GUGAGACAGUUCGGUCUCUAUCCGCCACGGGCUUCCUCGUGCUUAGUA ACUAAGGAUGAAAUGCAUGUCUAAGACAGCAUCUUCGC3.

(27) 2. Target Organisms

(28) nciRNAs can be designed for essentially any desired degree of species specificity. In some embodiments nciRNAs are directed at one organism or group of organisms, such as a single species. In other embodiments nciRNAs are designed to have RNA interference activity in a broad range of target organisms or species. The target RNA can be universally conserved amongst eukaryotes, or can be conserved amongst a group of organisms. Exemplary groups include eukaryotes within a kingdom, such as the kingdom Animalia, the kingdom Plantae or the kingdom Protista. In other embodiments the target RNA is universally conserved amongst eukaryotes in a given phylum. Exemplary phyla include Arthropoda, Brachiopoda, Chorrdata, Mollusca, Nematoda and Annelida. In other embodiments the target RNA is universally conserved amongst all eukaryotes within a phylogenetic class or order. In some embodiments the target RNA is universally conserved amongst all eukaryotes within a genus, or within a species. For example, it is possible to target the rRNA of Isoptera (termites) and Hymenoptera (bees, wasps and ants) or to target the rRNA of Isoptera and not Hymenoptera.

(29) 3. Structure of nciRNAs

(30) Typically nciRNAs are polynucleotides of 21-23 nucleotides in length. The nucleotide sequence of an nciRNA polynucleotide is complementary to the sequence of the non-coding target RNA. In some embodiments the sequence of the nciRNA is 100% complementary to the sequence of the target RNA. In other embodiments the nciRNA is less than 100% complementary to the target RNA. The sequence of the nciRNA can be at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, or at least 70% complementary to the nucleotide sequence of the target gene, so that sequence variations that can occur, for example due to genetic mutation, evolutionary divergence and strain polymorphism can be tolerated.

(31) 4. dsRNA Precursors of nciRNAs

(32) In some embodiments, nciRNAs are produced in the target organism from RNA precursors. In some embodiments a nciRNA precursor is a double stranded RNA (dsRNA) that is at least 24 nucleotides in length. Precursor dsRNA is processed into a biologically active nciRNA by the activity of the endogenous cellular enzymes within the target organism. Exemplary enzymes that process precursor RNAs into nciRNAs include the enzyme Dicer, as well as other Dicer-like enzymes and accessory proteins such as the RNA-induced Silencing Complex (RISC). Typically the dsRNA precursor of nciRNA contains one or more nucleotide sequences that are complimentary to one or more non-coding RNAs that are to be targeted for down-regulation. The nciRNA precursor can be from 24 nucleotides to many kilo-bases in length. nciRNA precursors can be designed to encode nciRNAs that target one or more non-coding RNAs.

(33) 5. Activity of nciRNAs

(34) In some embodiments the nciRNA is designed to induce sequence-specific degradation of the target non-coding RNA. In one embodiment the nciRNA provides an efficient mechanism of mortality in eukaryotic cells. The targeting of non-coding RNAs offers a variety of new targets with utility in basic research and in applications ranging from medicine to agriculture.

(35) 6. Modifications

(36) In some embodiments RNA designed for nciRNA activity, or precursor polynucleotide is designed to include a nucleotide sequence that confers a function not directly associated with RNA interference. Exemplary functions include, but are not limited to purification, targeting or identification of the nciRNA or precursor. In some embodiments the RNA includes a sequence that assists in the purification of RNA. In one embodiment the sequence that assists in purification forms an RNA aptamer. In another embodiment the RNA is designed to contain a sequence that enables the targeting of the expressed RNA to a particular location within the cell or outside of the cell, or enables incorporation of the RNA into a cellular pathway or process. In one embodiment the targeting sequence enables incorporation of the RNA into a viral or bacteriophage capsid. A single RNA may contain one or more modification sequences that confer different properties or functions to the RNA. In some embodiments the RNA is designed to include a sequence to assist purification in addition to a sequence that confers high affinity for a bacteriophage or viral coat protein. In one embodiment a recognition tag is at the opposite end of the RNA polynucleotide to a purification tag.

(37) In some embodiments genes are designed to include accessory elements to facilitate cloning into appropriate expression vectors for the expression the desired RNAs. The genes can be designed for the expression of single or double-stranded RNAs.

(38) B. Compositions for Delivery, Storage and Protection

(39) Compositions for the delivery, protection and storage of nciRNA and precursor polynucleotides are disclosed. Virus-like particles (VLPs) can protect enclosed RNAs from chemical, photo- and enzymatic degradation. The RNA in a VLP is stabilized against degradation by nucleases, hydroxyl radical, UV light, and Mg.sup.2+-mediated inline attack. VLPs eliminate requirements for chemical modification to stabilize and deliver RNA. The high-stability of VLPs containing RNAs enables storage for long periods of time and allows for a broad range of application methods, including distribution as aerosols, solutions, powders, etc. The VLPs containing RNAs are readily taken up by many cell types and efficiently deliver RNA to biological targets. Furthermore, production and usage of VLPs containing RNA is water-based and environmentally sound.

(40) 1. Virus-Like Particles Containing nciRNAs

(41) In some embodiments nciRNAs or precursor polynucleotides are enclosed within virus-like particles (VLPs) to facilitate production, storage, protection and delivery of the nciRNA or precursor polynucleotides. VLPs are symmetric, multi-protein structures that self-assemble into 30 nm-scale particles with virus-like morphology. On their exterior, VLPs resemble bacteriophages and viruses, but internally, VLPs can lack native genomic material (RNA or DNA required for integration, reverse transcription, replication, infection, etc.). Mutations and chemical modifications of VLP surfaces confer a variety of chemical and physical properties to VLPs. VLPs can be engineered as nano-containers that protect and deliver cargo such as nciRNAs.

(42) VLPs that contain RNA designed for interference activity of non-coding RNAs (nciRNAs) or precursor polynucleotides of nciRNAs are called VLP-nciRNAs. VLPs containing nciRNAs offer several advantages over traditional RNA synthesis, packaging and delivery methods. VLPs containing nciRNAs are disclosed for the delivery of one or more nciRNAs or precursor polynucleotides within a viral capsid vessel. RNAs can be designed for production of VLPs containing nciRNAs in a single-step process, according to the disclosed compositions and methods. In one embodiment RNA is designed for use in a simple, robust, general and adaptable in vivo system (in Escherichia coli) that spontaneously produces and packages the RNA into VLPs. To enable packaging of RNA within VLPs, nciRNAs or precursor polynucleotides are designed to include a nucleotide sequence that is a viral coat protein recognition tag. In certain embodiments the nucleotide sequence that is a viral coat protein recognition tag is a hairpin structure which enables spontaneous uptake and assembly into VLPs. Recognition tags that confers high affinity for a bacteriophage or virus coat protein are known in the art and include, but are not limited to the enterobacteria q beta bacteriophage coat protein (See, for example, Witherell, et al., Biochemistry, 28:71-76 (1989)) and the PP7 coat protein (see Lim and Peabody, Nucleic Acids Res., 30 (19) 4138-4144 (2002)). In one embodiment the recognition tag is a 29-nucleotide RNA hairpin structure specific for the bacteriophage q beta coat protein.

(43) In one embodiment the sequence of the RNA tag is 5

(44) TABLE-US-00002 (SEQIDNO:2) CAGCAAGUUCCGCAACCGUAUCAAAACGUAAAUUACUCGGAC3.

(45) The VLPs containing nciRNAs include bacteriophage or viral coat proteins. Coat proteins are known in the art and include the enterobacteria bacteriophage Q beta coat protein and the bacteriophage PP7 coat protein. An exemplary nucleotide sequence for genes encoding the bacteriophage Q beta coat protein gene is

(46) TABLE-US-00003 (SEQIDNO.3)fromGenBank:M99039.1. 46 atggcaaaattagag 61 actgttactttaggtaacatcgggaaagatggaaaacaaactctggtcctcaatccgcgt 121 ggggtaaatcccactaacggcgttgcctcgctttcacaagcgggtgcagttcctgcgctg 181 gagaagcgtgttaccgtttcggtatctcagccttctcgcaatcgtaagaactacaaggtc 241 caggttaagatccagaacccgaccgcttgcactgcaaacggttcttgtgacccatccgtt 301 actcgccaggcatatgctgacgtgaccttttcgttcacgcagtatagtaccgatgaggaa 361 cgagcttttgttcgtacagagcttgctgctctgctcgctagtcctctgctgatcgatgct 421 attgatcagctgaacccagcgtattga

(47) An exemplary amino acid sequence for the bacteriophage Q beta coat protein gene is

(48) TABLE-US-00004 (SEQIDNO.4) 10203040 MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAG 50607080 AVPALEKRVTVSVSQPSRNRKNYKVQVKTQNPTACTANGS 90100110120 CDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASP 130 LLIDAIDQLNPAY.
III. Methods of Making and Using nciRNA

(49) RNA designed for interference of non-coding RNA targets or nciRNA precursor polynucleotides can be produced in vivo using standard techniques. VLPs containing nciRNA and/or precursor polynucleotides can be produced in a single step process, according to the disclosed methods. nciRNA technology has a broad range of potential applications.

(50) A. Production of nciRNAs

(51) 1. Expression of RNA

(52) nciRNAs or precursor polynucleotides can be expressed by any of the means for producing RNAs that are known in the art. Typically the gene or genes encoding RNA polynucleotide(s) are cloned into an expression system for expression of the RNA in vivo. In some embodiments, the in vivo expression of RNA occurs in a prokaryote. Useful prokaryotic and eukaryotic systems for expressing and producing polypeptides are well known in the art. An exemplary strain of Escherichia coli used to express the protein and RNA is the BL21(DE3) strain.

(53) Expression cassettes that are designed for the transcription of nciRNA or precursor polynucleotides can be easily transferred to a transformation vector for transfer to the host organism. Representative transformation vectors and transformation techniques are well known in the art. In some embodiments the transcription system produces both strands and the RNA is dsRNA.

(54) In one embodiment the coat protein is expressed in the pCDF-1b expression vector. Typical expression vectors for the expression of RNA include pET-28b and pUC-19.

(55) In some embodiments the expression system is an inducible expression system. Inducible expression systems are known in the art (see, for example, Studier, Protein Expr Purif, 41: 207-234. (2005)). Prokaryotes commonly utilized for the expression of iRNA include, but are not limited to bacteria such as Escherichia spp., Bacillus spp. and Thermophilus spp.

(56) The one or more genes encoding nciRNA or precursor polynucleotides and the one or more genes encoding the coat protein of a bacteriophage or virus can be encoded within the same expression construct, or may be encoded within two or more different expression constructs. The genes can be under the control of the same or different promoter elements. In some embodiments the expression of the VLP containing RNA is under the control of an inducible promoter. An exemplary inducible promoter is the Isopropyl--D-thiogalactopyranoside (IPTG) inducible promoter.

(57) 2. Production of VLPs Containing nciRNAs

(58) The use of VLPs to enclose RNA further extends the range of potential nciRNA applications and facilitates the storage and delivery of nciRNAs. Methods for single-step production of VLPs containing nciRNAs are disclosed. The methods can be used, for example, for the production of nciRNA or precursor polynucleotides and packaging into VLPs. Typically, the expression of the RNA in a prokaryotic expression system is greater when the RNA is sequestered and packaged into VLPs than when RNA is produced alone. The nciRNA or precursor polynucleotides and VLPs self-assemble with high specificity into VLPs containing nciRNAs when the RNA is fused to an appropriate tag (for example, an RNA hairpin sequence). The methods do not impose any limitation on the structure of nciRNAs or precursor polynucleotides. VLP packaged RNAs can be long or short, single-stranded or double-stranded, and be a few nucleotides to many kilo-bases in length.

(59) For the expression of VLPs containing nciRNAs or precursor polynucleotides a host organism is engineered to express genes for the coat protein of a bacteriophage or virus in addition to one or more nciRNAs or precursor polynucleotides that include a nucleotide sequence that is a viral coat protein recognition tag. The recognition tag enables the spontaneous uptake and assembly of the RNA into the VLP. Recognition tags that confer high affinity for bacteriophage or virus coat proteins are known in the art. Techniques and methods for the design and production of recombinant expression constructs to express RNAs are well known in the art. Techniques and methods for the design and production of recombinant expression constructs to express the coat proteins of a bacteriophage or virus are also well known in the art (see above). In some embodiments the genes encoding nciRNA are included within the same expression vector as the genes encoding the viral coat proteins. In some embodiments the genes encoding an nciRNA or precursor polynucleotides and the genes encoding the viral coat proteins are under the control of the same promoter. The promoter can be an inducible promoter. In some embodiments the host organism for in vivo production of VLPs containing nciRNAs is Escherichia coli.

(60) The disclosed methods provide genes encoding the expression of one or more nciRNAs or precursor polynucleotides and genes encoding viral or bacteriophage coat proteins that spontaneously assemble in vivo into intact s VLPs that encapsulate the nciRNAs (VLP-nciRNAs). In one embodiment, nciRNAs or precursor polynucleotides are expressed in high yield in Escherichia coli.

(61) In one embodiment the nciRNA or precursor polynucleotides within the VLP are at least 80% pure. In other embodiments the RNA is at least 85% pure, at least 90% pure, at least 95% pure or 100% pure. Typically one VLP vessel contains at least one nciRNA or precursor polynucleotide molecule. In some embodiments the molar ratio of RNA to VLP is 3.6. In other embodiments each VLP packs approximately three RNA polynucleotide molecules.

(62) 3. Purification

(63) The purification of VLPs containing nciRNAs produced by the disclosed methods is trivial, and is simpler than the purification of unpackaged RNA.

(64) Because of their distinctive size, properties and high stability, VLPs can be easily purified from Escherichia coli cellular lysates. Hence, the purification of VLPs containing nciRNAs produced by the disclosed methods is trivial, and is simpler than the purification of unpackaged RNA. Exemplary methods for the purification of VLPs include fast-protein liquid chromatography (FPLC), filtration, sedimentation, sucrose-gradient separation, and affinity tag chromatography. In some embodiments purification of the VLPs includes pelleting of the host organism cells. The pelleted cells or isolated VLPs containing nciRNAs can be frozen or dried for storage or distribution purposes.

(65) 4. Delivery

(66) VLPs protect the enclosed nciRNAs or precursor polynucleotides from chemical, photo- and enzymatic degradation. The RNA in a VLP is stabilized against degradation by nucleases, hydroxyl radical, UV light, and Mg.sup.2+-mediated inline attack. VLPs eliminate requirements for chemical modification to stabilize and deliver RNA. The high-stability of VLPs containing nciRNAs enables storage for long periods of time and allows for a broad range of application methods, including distribution as aerosols, solutions, powders, etc. The VLPs are readily taken up by many cell types and efficiently deliver nciRNA to biological targets. Furthermore, production and usage of VLPs containing nciRNA is water-based and environmentally sound.

(67) In one embodiment VLPs containing nciRNAs are introduced into a complex eukaryotic organism by ingestion of doped food. When the VLP-nciRNAs are taken up by target cells, the RNA is released and the biological activity of the RNA is manifest. VLPs containing nciRNAs can be delivered as crude cell extracts. In other embodiments they can be left within the pelleted Escherichia coli and delivered as intact Escherichia coli cells.

(68) B. Methods of Using nciRNAs

(69) 1. Agriculture

(70) In some embodiments nciRNAs are used for the protection of plants from weeds and insects and for increasing crop yields. In certain embodiments, the targeting of gene expression by nciRNAs enables the production of allergy-free peanuts and decaffeinated coffee beans. In one embodiment, VLP-nciRNAs are used to produce and deliver RNA to kill mites that parasitize honeybees.

(71) 2. Therapeutics

(72) nciRNA technology has broad application in Therapeutics. In some embodiments VLP-RNAs are used for the delivery of nciRNA for applications in therapeutics. In certain embodiments, the targeting of gene expression by nciRNAs is an effective therapeutic strategy against infectious disease. In one embodiment, nciRNAs are used as a RNA-based functional cure for infection with protozoans. Exemplary protozoan parasites include Giardia lamblia, Entamoeba histolytica and Toxoplasma gondii.

EXAMPLES

Example 1

Construction of a VLP-RNA

(73) Materials and Methods

(74) RNA Design and Expression

(75) Using known methods, one or more genes are built by recursive PCR or are cloned from a cDNA or genomic library. The genes, along with promoters and terminators, are DNA sequences designed to express the desired RNAs. The genes can be of any desired sequence and can encode either double-stranded or single-stranded RNAs. RNAs of essentially any length and sequence can be produced in high yield in Escherichia coli. The RNA gene(s) are cloned into an inducible expression system.

(76) Assembly and Purification of VLPs Containing RNA.

(77) The RNA is designed to contain a recognition tag that confers high affinity for a bacteriophage or virus coat protein along with a known aptamer for RNA purification, if necessary. The recognition tag facilitates efficient packaging of the RNA into the VLP.

(78) In this process, Escherichia coli are transformed with plasmids that express the RNA gene(s) in addition to genes for the coat protein of a bacteriophage or virus. The expressed coat protein spontaneously assembles in vivo into intact VLP-RNAs (VLPs that encapsulate RNAs). Because of their distinctive size, properties and high stability, VLPs can be easily purified from Escherichia coli cellular lysates.

(79) Delivery.

(80) Purified VLP-RNAs can be introduced into a complex eukaryotic organism by ingestion of doped food. When the VLP-RNAs are taken up by target cells, the RNA is released and the biological activity of the RNA is manifest. VLP-RNAs can be delivered as crude cell extracts. In addition they can be left within the pelleted Escherichia coli and delivered as intact Escherichia coli cells.

(81) Results

(82) A simple, robust, general and adaptable in vivo system in Escherichia coli that produces and packages RNA into VLPs was built. An integrated process for (i) Simultaneous over-production of RNA and a bacteriophage coat protein, (ii) in vivo self-assembly of VLP-RNAs, was designed, constructed and successfully tested.

(83) RNA was packaged into a VLP by co-expression of the capsid protein and the iRNA in vivo. The RNA, which was obtained by disruption of purified VLPs, contains a capsid binding tag along with a secondary affinity tag at a termini for optional purification. The RNA, including the duo tags, is 751 nucleotides in length, corresponding to the brightest band in the lane on the LH side. Integration of the band intensities on the gel indicates that the RNA is 80% pure. Comparison of quantity of VLP capsid protein with encapsulated RNA indicates an RNA/VLP molar ratio of 3.6. This ratio indicates that, on average, one VLP packs about three RNA molecules (see FIG. 1).

(84) These data demonstrate that VLP-RNAs assemble and are efficiently packaged with the tagged-RNA when both coat protein and RNA are over produced in Escherichia coli. VLP-RNAs, the protein and RNA components of VLP-RNAs were purified and characterized (see FIG. 1).

Example 2

nciRNAs Selectively Target and Kill Target Insects

(85) Materials and Methods

(86) nciRNA Design and Expression.

(87) Using known methods, one or more genes are built by recursive PCR or are cloned from a cDNA or genomic library. The genes, along with promoters and terminators, are DNA sequences designed to express the desired nciRNAs. The genes can be of any desired sequence and can encode either double-stranded or single-stranded nciRNAs. nciRNAs of essentially any length and sequence can be produced in high yield in Escherichia coli. The nciRNA gene(s) are cloned into an inducible expression system.

(88) Strategy

(89) nciRNAs can be easily purified from Escherichia coli cellular lysates. Furthermore, purified nciRNAs can be introduced into a complex eukaryotic organism by ingestion of doped food. When the nciRNAs are taken up by target cells, the biological activity of the nciRNA is manifest. nciRNAs can be delivered as crude cell extracts. In addition they can be left within the pelleted Escherichia coli and delivered as intact Escherichia coli cells.

(90) Selection of Genes

(91) Reticulitermes flavipes was chosen as a suitable model system to test the activity of nciRNA to selectively targets and kill an insect. Accordingly, nciRNA.sup.aPTC was designed to act by degrading the core of the large subunit ribosomal RNA (28S rRNA). The nciRNA sequence was based on the most highly conserved 23S/28S rRNA sequences, as described in Hsiao, et al.

(92) The sequence of the RNA used includes 5

(93) TABLE-US-00005 (SEQIDNO:1) rGUCCGAGUAAUUUACGUUUUGAUACGGUUGCGGAACUUGCGGGGUGCC UAUUGAAGCAUGAGCCGGCGACUCAGCCGUAAGGCUGGACCCGAAACC GGGCGAGCUAGCCCUGGCCAGCCGUAAGGCGAACCGGUGGGGGAUGCA AACCCCUCGGAUGAGCUGGGGCUAGGAGUGAAAAGCUAACCGAGCCCG GAGAUAGCUGGUUCUGCCGUAAGGCAGCGUUGCCGUAAGGCAAGUGCG AAUGCCGGCAUGAGUAACGAGCGGGAGAACCCUCGCCAAGGAACUCUG CAAGCCGUAAGGCCUCUGGCGACUGUUUACCAAAAACACAGCGCCGUAA GGCGCGAGCCGUAAGGCUAACGACCGGAGCGCUGUCUCGGCGAGGGACC CGGUGAAAUUGAACUGGCCGUGAAGAUGCGGCCUACCCGUGGCAGGAC GAAAAGACCCCGUGGAGCUUUACUGCCGUAAGGCAGUUUGACUGGGGC GGUCGGCCGUAAGGCUAAAAGUUACCCCGGGGAUAACAGGCUGAUCGC CGUAAGGCGGUUUGGCACCUCGAUGUCGGCUCGUCGCGCCGUAAGGCU UGGGCUGUUCGCCCAUUAAAGCGGCACGCGAGCUGGGUUCAGAACGUC GUGAGACAGUUCGGUCUCUAUCCGCCACGGGCUUCCUCGUGCUUAGUA ACUAAGGAUGAAAUGCAUGUCUAAGACAGCAUCUUCGC3.

(94) Delivery and Assay for Efficacy of nciRNAs

(95) A test for delivery of a nciRNA to a biological was carried out in Reticulitermes flavipes. 505 nucleotides of rRNA containing highly conserved rRNA sequences, linked together to form a single RNA molecule, were readily expressed as nciRNA.sup.aPTC. A solution containing 300 g of nciRNA.sup.aPTC was added each day to filter paper and the survival of Reticulitermes flavipes workers consuming the nciRNA.sup.aPTC doped paper was monitored throughout 14 days. A control group of termites consumed filter paper treated with buffer alone.

(96) Results

(97) Efficacy of nciRNAs

(98) nciRNA.sup.aPTC was successfully introduced into food and taken up by the insect Reticulitermes flavipes. When nciRNA.sup.aPTC was delivered to the insect via doped food, it degraded the insect 28S rRNA and killed Reticulitermes flavipes with great efficiency, leading to complete mortality by day 12 (FIG. 3). Control termites, which consumed filter paper treated with buffer alone, survived indefinitely.

Example 3

nciRNAs within VLPs (VLP-nciRNAs) Selectively Target and Kill Target Insects

(99) Materials and Methods

(100) Assembly of VLPs Containing nciRNA

(101) The nciRNA is designed to contain a recognition tag that confers high affinity for a bacteriophage or virus coat protein along with a known aptamer for RNA purification, if necessary. The recognition tag facilitates efficient packaging of the nciRNA into the VLP. In this process, Escherichia coli are transformed with plasmids that express the nciRNA gene(s) in addition to genes for the coat protein of a bacteriophage or virus. The expressed coat protein spontaneously assembles in vivo into intact VLP-nciRNAs (VLPs that encapsulate nciRNAs).

(102) Strategy

(103) Because of their distinctive size, properties and high stability, VLPs can be easily purified from Escherichia coli cellular lysates. Furthermore, purified VLP-nciRNAs can be introduced into a complex eukaryotic organism by ingestion of doped food. When the VLP-nciRNAs are taken up by target cells, the nciRNA is released and the biological activity of the nciRNA is manifest. VLP-nciRNAs can be delivered as crude cell extracts. In addition they can be left within the pelleted Escherichia coli and delivered as intact Escherichia coli cells.

(104) Selection of Genes

(105) Reticulitermes flavipes was chosen as a suitable model system to test the activity of VLP-nciRNA to selectively target and kill an insect. Accordingly, VLP-nciRNA.sup.aPTC was designed to act by degrading the core of the large subunit ribosomal RNA (28S rRNA). The nciRNA sequence was based on the most highly conserved 23S/28S rRNA sequences, as described in Hsiao et al.

(106) Delivery and Assay for Efficacy of VLPs Containing nciRNAs

(107) A test for delivery of nciRNA to a biological target using VLP-nciRNAs was subsequently carried out in Reticulitermes flavipes. 505 nucleotides of rRNA containing highly conserved rRNA sequences, linked together to form a single RNA molecule, were readily packaged into a VLP to give VLP-nciRNA.sup.aPTC. A solution containing 600 g of VLP-nciRNA.sup.aPTC was added each day to filter paper and the survival of Reticulitermes flavipes workers consuming the VLP-nciRNA.sup.aPTC doped paper was monitored throughout 14 days. A control group of termites consumed filter paper treated with buffer alone.

(108) Results

(109) Assembly of VLPs Containing nciRNA

(110) nciRNAs and a bacteriophage coat protein were simultaneously overproduced using the expression system in Escherichia coli. VLP-nciRNAs were purified from Escherichia coli lysates and the protein and nciRNA components were characterized. The nciRNA was 90% pure within the VLP.

(111) Efficacy of VLPs Containing nciRNA

(112) VLP-nciRNA.sup.aPTC was successfully introduced into food and taken up by the insect Reticulitermes flavipes. When VLP-nciRNA.sup.aPTC was delivered to the insect via doped food, it degraded the insect 28S rRNA and killed Reticulitermes flavipes with great efficiency, leading to complete mortality by day 12 (FIG. 4). Control termites, which consumed filter paper treated with buffer alone, survived indefinitely. The efficacy of the VLP-nciRNA.sup.aPTC in killing Reticulitermes flavipes was equivalent to that of the nciRNA.sup.aPTC administered alone (FIG. 3).

REFERENCES

(113) 1. Zeltins A (2013) Construction and characterization of virus-like particles: A review. Mol Biotechnol 53: 92-107. 2. Smith M T, Hawes A K, Bundy B C (2013) Reengineering viruses and virus-like particles through chemical functionalization strategies. Curr Opin Biotechnol. 3. Rhee J K, Hovlid M, Fiedler J D, Brown S D, Manzenrieder F, Kitagishi H, Nycholat C, Paulson J C, Finn M G (2011) Colorful virus-like particles: Fluorescent protein packaging by the q beta capsid. Biomacromolecules 12: 3977-3981. 4. Pan Y, Zhang Y, Jia T, Zhang K, Li J, Wang L (2012) Development of a microrna delivery system based on bacteriophage ms2 virus-like particles. FEBS J 279:1198-1208. 5. Lau J L, Baksh M M, Fiedler J D, Brown S D, Kussrow A, Bornhop D J, Ordoukhanian P, Finn M G (2011) Evolution and protein packaging of smallmolecule RNA aptamers. ACS Nano 5: 7722-7729. 6. Zhou X, Wheeler M M, Oi F M, Scharf M E (2008) RNA interference in the termite reticulitermes flavipes through ingestion of double-stranded RNA. Insect Biochem Mol Biol 38: 805-815. 7. Bowman J C, Azizi B, Lenz T K, Roy P, Williams L D (2012) Preparation of long templates for RNA in vitro transcription by recursive PCR. In: Conn G L, editor. Recombinant and in vitro RNA synthesis: Methods and protocols, methods in molecular biology: Springer Science, LLC. pp. 19-41. 8. Studier F W (2005) Protein production by auto-induction in high density shaking cultures. Protein Expr Purif 41: 207-234. 9. Witherell G W, Uhlenbeck O C (1989) Specific RNA binding by q beta coat protein. Biochemistry 28: 71-76. 11. Milhavet O, Gary D S, Mattson M P (2003) RNA interference in biology and medicine. Pharmacol Rev 55: 629-648. 12. Whitehead K A, Langer R, Anderson D G (2009) Knocking down barriers: Advances in sirna delivery. Nat Rev Drug Discov 8: 129-138. 13. Oey M, Ross I L, Stephens E, Steinbeck J, Wolf J, Radzun K A, Kugler J, Ringsmuth A K, Kruse O, Hankamer B (2013) Rnai knock-down of Ihcbm1, 2 and 3 increases photosynthetic h2 production efficiency of the green alga chlamydomonas reinhardtii. PLoS One 8: e61375. 14. Huvenne H, Smagghe G (2010) Mechanisms of dsrna uptake in insects and potential of rnai for pest control: A review. J Insect Physiol 56: 227-235. 15. Lant B, Deny W B (2013) Methods for detection and analysis of apoptosis signaling in the C. elegans germline. Methods (San Diego, Calif.) 61: 174-182. 16. Haussecker D Http://maitherapeutics.Blogspot.Com/. 17. Haussecker D (2012) The business of mai therapeutics in 2012. Mol Ther Nucleic Acids 1: e8. 18. Wilson D N (2009) The A-Z of bacterial translation inhibitors. Crit Rev Biochem Mol Bio144: 393-433. 19. Ben-Shem A, Jenner L, Yusupova G, Yusupov M (2010) Crystal structure of the eukaryotic ribosome. Science 330: 1203-1209. 20. Anger A M, Armache J P, Beminghausen O, Habeck M, Subklewe M, Wilson D N, Beckmann R (2013) Structures of the human and drosophila 80s ribosome. Nature 497: 80-85. 21. Aurrecoechea C, Brestelli J, Brunk B P, Fischer S, Gajria B, Gao X, Gingle A, Grant G, Harb O S, Heiges M, Innamorato F, et al. (2009) Eupathdb: A portal to eukaryotic pathogen databases. Nucleic Acids Res. 22. Nicolas F E, Tones-Martinez S, Ruiz-Vazquez R M (2013) Loss and retention of RNA interference in fungi and parasites. PLoS Path 9. 23. Hsiao C, Lenz T K, Peters J K, Fang P Y, Schneider D M, Anderson E J, Preeprem T, Bowman J C, O'Neill E B, Lie L, Athavale S S, et al. (2013) Molecular paleontology: A biochemical model of the ancestral ribosome. Nucleic Acids Res 41: 3373-33.