ANTI-CD137 CONSTRUCTS, MULTISPECIFIC ANTIBODY AND USES THEREOF

20220403040 · 2022-12-22

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are anti-CD137 constructs that bind to CD137, including multispecific anti-CD137 antibodies with binding specificity for CD137 and one or more additional antigens, and methods of using the same. In certain embodiments, the one or more additional antigens comprise human epidermal growth factor receptor 2 (HER2).

Claims

1-3. (canceled)

4. A multispecific antibody that binds to CD137 and HER2, comprising a first antibody moiety that binds to CD137 and a second antibody moiety that binds to HER2, wherein the first antibody moiety comprises a heavy chain variable region (VH) comprising HC-CDR1, HC-CDR2 and HC-CDR3 domains and a light chain variable region (VL) comprising LC-CDR1, LC-CDR2 and LC-CDR3 domains that are selected from the group consisting of: a) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 4, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6; b) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 11, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 12, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 13, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 14, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 16; c) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 21, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 23, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 24, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 26; d) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 31, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 32, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 33, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 34, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 35, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 36; e) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 41, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 42, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 43, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 44, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 45, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 46; f) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 51, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 53, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 54, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 56; g) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 61, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 62, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 63, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 64, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 65, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 66; h) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 71, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 72, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 73, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 74, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 75, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 76; i) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 81, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 83, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 84, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 86; j) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 91, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 93, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 94, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 96; k) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 101, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 102, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 103, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 104, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 105, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106; l) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 111, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 112, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 114, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 115, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 116; m) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 121, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 122, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126; n) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 131, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 134, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136; o) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 231, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 233, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 234, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 236; and p) the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 241, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 242, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 243, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 244, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 245, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 246.

5-17. (canceled)

18. The multispecific antibody of claim 4, wherein the first antibody moiety comprises a heavy chain variable region (VH) that comprises HC-CDR1, HC-CDR2, and HC-CDR3 domains; and a light chain variable region (VL) that comprises LC-CDR1, LC-CDR2, and LC-CDR3 domains, wherein the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 121, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 122, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126.

19-20. (canceled)

21. The multispecific antibody of claim 4, wherein the first antibody moiety comprises a heavy chain variable region (VH) that comprises HC-CDR1, HC-CDR2, and HC-CDR3 domains; and a light chain variable region (VL) that comprises LC-CDR1, LC-CDR2, and LC-CDR3 domains, wherein the VH comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 231, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 233, and the VL comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 234, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 236.

22-23. (canceled)

24. The multispecific antibody of claim 4, wherein the first antibody moiety comprises: (a) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 7; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 8; (b) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 17; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 18; (c) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 27; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 28; (d) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 37; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 38; (e) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 47; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 48; (f) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 57; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 58; (g) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 67; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 68; (h) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 77; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 78; (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 87; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 88; (j) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 97; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 98; (k) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 107; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 108; (l) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 117; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 118; (m) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 127; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 128; (n) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 137; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 138; (o) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 237; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 238; or (p) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 247; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 248.

25-26. (canceled)

27. The multispecific antibody of claim 4, wherein the first antibody moiety comprises an antibody or antigen-binding fragment thereof selected from the group consisting of a full-length antibody, a multispecific antibody (e.g., a bispecific antibody), a single-chain Fv fragment (scFv), a Fab fragment, a Fab′ fragment, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a VHH, a Fv-Fc fusion, a scFv-Fc fusion, a scFv-Fv fusion, a diabody, a tribody, and a tetrabody.

28-29. (canceled)

30. The multispecific antibody of claim 4, wherein the first antibody moiety is a CD137 agonist antibody.

31-48. (canceled)

49. The multispecific antibody of claim 4, wherein the second antibody moiety comprises an Fc region selected from the group consisting of Fc regions from IgG1, IgG2, IgG3, IgG4, and any combinations and hybrids thereof.

50. The multispecific antibody of claim 49, wherein the Fc region comprises an IgG1 Fc region.

51. The multispecific antibody of claim 50, wherein the IgG1 Fc region comprises a L234A mutation and a L235A mutation.

52. The multispecific antibody of claim 49, wherein the Fc region comprises an IgG4 Fc region.

53. The multispecific antibody of claim 52, wherein the IgG4 Fc region comprises a F234A mutation and a L235A mutation.

54. The multispecific antibody of claim 52, wherein the IgG4 Fc region comprises a S228P mutation.

55-56. (canceled)

57. The multispecific antibody of claim 4, wherein the second antibody moiety comprises a full length antibody that binds to HER2 and comprises a second heavy chain variable region (VH-2) and a second light chain variable region (VL-2), wherein: a) the VH-2 comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and b) the VL-2 comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

58. (canceled)

59. The multispecific antibody of claim 57, wherein the VH-2 comprises the amino acid sequence of SEQ ID NO: 202; and the VL-2 comprises the amino acid sequence of SEQ ID NO: 203.

60. The multispecific antibody of claim 4, comprising: a) the first antibody moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 121, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 122, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123, and the VL comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126; and b) the second antibody moiety comprises a second heavy chain variable region (VH-2) and a second light chain variable region (V L-2), wherein the VH-2 comprises a second HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, a second HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and a second HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and the VL-2 comprises a second LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, a second LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and a second LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

61. The multispecific antibody of claim 4, comprising: a) the first antibody moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 231, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 233, and the VL comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 234, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 236; and b) the second antibody moiety comprises a second heavy chain variable region (VH-2) and a second light chain variable region (V L-2), wherein the VH-2 comprises a second HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, a second HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and a second HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and the VL-2 comprises a second LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, a second LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and a second LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

62. (canceled)

63. The multispecific antibody of claim 4, comprising a heavy chain of an anti-HER2 full length antibody fused to a anti-CD137 single chain Fv fragment, which comprises an amino acid sequence having at least about 90% sequence identity to the amino acid sequence of SEQ ID NOs: 183, 184, 204, 205, 251, 252, 253 or 254, and ii) a light chain of an anti-HER2 full length antibody comprising an amino acid sequence having at least about 90% sequence identity to the amino acid sequence of SEQ ID NO: 185.

64. The multispecific antibody of claim 63, comprising a heavy chain of an anti-HER2 full length antibody fused to an anti-CD137 single chain Fv fragment, which comprises an amino acid sequence of any one of SEQ ID NOs: 183, 184, 204, 205, 251, 252, 253 or 254, and ii) a light chain of an anti-HER2 full length antibody comprising the amino acid sequence of SEQ ID NO: 185.

65-75. (canceled)

76. An immunoconjugate comprising the multispecific antibody of claim 4, linked to a therapeutic agent or a label, wherein the label is selected from the group consisting of a radioisotope, a fluorescent dye and an enzyme.

77. A pharmaceutical composition comprising the multispecific antibody of claim 4, and a pharmaceutically acceptable carrier.

78. An isolated nucleic acid encoding the multispecific antibody of claim 4.

79. A vector comprising the isolated nucleic acid of claim 78.

80. An isolated host cell comprising the isolated nucleic acid of claim 78.

81. A method of producing a multispecific antibody, comprising: a) culturing the isolated host cell of claim 80 under conditions effective to express the multispecific antibody; and b) obtaining the expressed multispecific antibody from the host cell.

82. A method of treating or preventing a disease in a subject, comprising administering to the subject an effective amount of the pharmaceutical composition of claim 77.

83-93. (canceled)

94. A kit comprising the multispecific antibody of claim 4.

95. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0107] FIGS. 1A-1F show the binding affinities of exemplary anti-CD137 antibody clone 2-9 variants to human CD137 and cynomolgus monkey CD137. FIG. 1A shows the binding of clone 2-9 IgG2 wt to human CD137. FIG. 1B shows the binding of clone 2-9 IgG2 wt to cynomolgus CD137. FIG. 1C shows the binding of clone 2-9 IgG2 wt to human CD137. FIG. 1D shows the binding of clone 2-9-1 IgG1 SELF to human CD137. FIG. 1E shows the binding of clone 2-9-1 IgG1 SELF to human CD137. FIG. 1F shows the binding of clone 2-9-2 IgG4 wt to human CD137.

[0108] FIGS. 2A and 2B show luciferase activities in NF-κB reporter assay in the absence (2A) or presence (2B) of FcγRIIB-expressing 293F cells. Reference Ab 1 and Reference Ab 2 are the reference anti-CD137 antibodies described in Example 2. αCD137 Ab clones indicates different anti-CD137 monoclonal antibodies.

[0109] FIGS. 3A-3C show luciferase activities in NF-κB reporter assay in the absence (3A) or presence (3B and 3C) of FcγRIIB-expressing 293F cells. Reference Ab 1 and Reference Ab 2 are reference anti-CD137 antibodies described in Example 2. 2-9-1 IgG1 SELF comprises an IgG1 Fc and mutations of S267E/L328F. 2-9-1 IgG2 SELF comprises an IgG2 Fc and mutations of S267E/L328F. 2-9 IgG2 wt comprises a wild type human IgG2 Fc. 2-9-2 IgG4 comprises a wild type human IgG4 Fc.

[0110] FIGS. 4A and 4B show IFN-7 (4A) and IL2 (4B) production of PBMCs obtained from donors in the presence of different anti-CD137 antibodies at various concentrations. Reference Ab 1 and Reference Ab 2 are the reference anti-CD137 antibodies described in Example 2. 2-9-1 IgG1 SELF comprises an IgG1 Fc and mutations of S267E/L328F. 2-9-1 IgG2 SELF comprises an IgG2 Fc and mutations of S267E/L328F. 2-9 IgG2 wt comprises a wild type human IgG2 Fc. 2-9-2 IgG4 comprises a wild type human IgG4 Fc.

[0111] FIGS. 5A and 5B show in vivo study results of 2-9 variants in a MC38 murine colon cancer model. FIG. 5A shows tumor growths curves of vehicle control group and treatment groups. FIG. 5B shows mouse body weight changes during the treatment.

[0112] FIGS. 6A and 6B show in vivo study results of a utomilumab analog in a MC38 murine colon cancer model. FIG. 6A shows tumor growths curves of control IgG group and treatment groups. FIG. 6B shows mouse body weight changes during the treatment.

[0113] FIGS. 7A and 7B shows the design of exemplary bispecific antibodies, in which an anti-CD137 scFv is fused to a full length antibody that binds to a tumor-associated antigen in general (7A) and to HER2 specifically (7B). αTAA stands for antibody against tumor associated antigen. αCD137 stands for anti-CD137 scFv.

[0114] FIGS. 8A-8B show the binding affinities of the exemplary anti-CD137×HER2 bispecific antibody to CD137 (8A) and HER2 (8B) as measured by Octet double binding assay. αHER2 represents a full length anti-HER2 monoclonal antibody derived from the amino acid sequences of trastuzumab. 2-9scFv_αHER2-HC-C represents the bispecific antibody in which an anti-CD137 scFv derived from clone 2-9 was fused to the C-terminus of the heavy chains of the full length anti-HER2 antibody.

[0115] FIGS. 9A-9B show the binding affinities of the exemplary anti-CD137×HER2 bispecific antibodies and anti-CD137 monoclonal antibody to CD137 (9A) and HER2 (9B) as measured by whole cell binding assay. αHER2 represents an anti-HER2 monoclonal antibody derived from the amino acid sequences of trastuzumab. αEGFR represents an anti-EGFR monoclonal antibody. “αCD137scFv-αHER2-IgG1” and “αCD137scFv-αHER2-IgG4-FALA” represent a bispecific antibody that has an anti-CD137 scFv derived from clone 2-9 fused to the full length anti-HER2 antibody with an IgG1 isotype or IgG4 isotype with Fc FALA mutation, respectively.

[0116] FIGS. 10A-10C show crosslinking effect of exemplary bispecific antibodies that bind to both CD137 and HER2. FIG. 10A shows the experimental steps and that the crosslinking effect are triggered when anti-CD137×HER2 bispecific antibodies are present (left panel, bottom) but are not triggered when anti-CD137 monoclonal antibodies are present (left panel, top). FIGS. 10B-10C show CD137 activation levels in 293T cells upon contact with either HER2 high NCI-N87 cells or HER2 low SK-Hep1 cells in the presence of anti-CD137×Her 2 bispecific antibodies with various of formats (HC-C, HC-N, LC-C, LC-C). αCD137-αHER2-HC-C represents the bispecific antibody in which an anti-CD137 scFv derived from clone 2-9 was fused to the C-terminus of the heavy chains of the full length anti-HER2 antibody. αCD137-αHER2-HC-N represents the bispecific antibody in which an anti-CD137 scFv derived from clone 2-9 was fused to the N-terminus of the heavy chains of the full length anti-HER2 antibody. αCD137-αHER2-LC-C represents the bispecific antibody in which an anti-CD137 scFv derived from clone 2-9 was fused to the C-terminus of the light chains of the full length anti-HER2 antibody. αCD137-αHER2-LC-N represents the bispecific antibody in which an anti-CD137 scFv derived from clone 2-9 was fused to the N-terminus of the light chains of the full length anti-HER2 antibody.

[0117] FIGS. 11A-11B show cross-linking effect of exemplary anti-CD137×HER2 bispecific antibodies with or without Fc mutations. FIG. 11A shows CD137 activation levels in 293T cells upon contact with HER2 high SKBR3 cells. FIG. 11B shows CD137 activation levels in 293T cells upon contact with HER2 low SK-Hep1 cells. Anti-CD137×HER2 bispecific antibodies used in this example have the HC-C format. αCD137scFv-αHER2-IgG1” and “αCD137scFv-αHER2-IgG4-FALA” represent bispecific antibodies that has an anti-CD137 scFv derived from clone 2-9 fused to a full length anti-HER2 antibody derived from trastuzumab with an IgG1 isotype or IgG4 isotype with Fc FALA mutation. “αCD137 mAb-IgG2” represents a monoclonal anti-CD137 antibody derived from clone 2-9 with an IgG2 isotype.

[0118] FIG. 12 shows IFNγ and IL-2 production of effector cells upon contact with HER2 high SKBR3 cells or HER2 low MDA-MB-231 cells in the presence of anti-CD137×HER2 bispecific antibodies at various concentrations or CD137 monoclonal antibodies. Anti-CD137×HER2 bispecific antibodies used in this example have the HC-C format. αCD137scFv-αHER2-IgG1” and “αCD137scFv-αHER2-IgG4-FALA” represent bispecific antibodies that has an anti-CD137 scFv derived from clone 2-9 fused to the full length anti-HER2 antibody with an IgG1 isotype or IgG4 isotype with Fc FALA mutation.

[0119] FIG. 13 shows tumor volume changes in LoVo/hPBMC xenograft NOD-SCID mice after the administration of a) an anti-CD137×HER2 bispecific antibody (αCD137scFv-αHER2-IgG4-FALA HCC-L7, 10 mg/kg), and b) a combination of an anti-CD137 monoclonal antibody (2-9 mAb, 7.5 mg/kg) and an anti-HER2 monoclonal antibody (αHER2, 7.5 mg/kg) compared to vehicle control. “αCD137scFv-αHER2-IgG4-FALA” represent a bispecific antibody that has an anti-CD137 scFv derived from clone 2-9 fused to the full length anti-HER2 antibody with an IgG4 isotype with Fc FALA mutation.

[0120] FIGS. 14A and 14B show tumor volume changes in OE19/hPBMC xenograft NOD-SCID mice after the administration of a) an anti-CD137×HER2 bispecific antibody (αCD137scFv-αHER2-IgG4-FALA HCC-L7, 0.4 mg/kg), b) a combination of an anti-CD137 monoclonal antibody (2-9 mAb, 0.3 mg/kg) and an anti-HER2 monoclonal antibody (αHER2, 0.3 mg/kg), and c) an anti-HER2 monoclonal antibody (αHER2, 0.3 mg/kg) compared to vehicle control. “αCD137scFv-αHER2-IgG4-FALA” represent a bispecific antibody that has an anti-CD137 scFv derived from clone 2-9 fused to the full length anti-HER2 antibody with an IgG4 isotype with Fc FALA mutation. FIG. 14A shows tumor growth curve of each group. FIG. 14B shows individual tumor volumes of various treatment groups on day 21.

DETAILED DESCRIPTION OF THE APPLICATION

[0121] The present application provides novel anti-CD137 constructs that specifically bind to CD137 (such as anti-CD137 scFvs, monoclonal antibodies, and multispecific antibodies that bind to a tumor-associated antigen (TAA)), methods of preparing the anti-CD137 constructs, methods of using the constructs (e.g., methods of treating a disease or condition, methods of modulating an immune response, or methods of modulating a cell composition). The invention is based, in part, on the discovery of anti-CD137 monospecific antibodies and multispecific antibodies that exhibit improved safety profile and enhanced anti-tumor efficacy compared to existing anti-CD137 antibodies in clinical trials.

I. Definitions

[0122] The term “antibody” is used in its broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), full-length antibodies and antigen-binding fragments thereof, so long as they exhibit the desired antigen-binding activity. The term “antibody moiety” refers to a full-length antibody or an antigen-binding fragment thereof.

[0123] A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variable domains of the heavy chain and light chain may be referred to as “V.sub.H” and “V.sub.L”, respectively. The variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3). CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991). The three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of α, δ, ε, γ, and μ heavy chains, respectively. Several of the major antibody classes are divided into subclasses such as lgG1 (γ1 heavy chain), lgG2 (γ2 heavy chain), lgG3 (γ3 heavy chain), lgG4 (γ4 heavy chain), lgA1 (al heavy chain), or lgA2 (α2 heavy chain).

[0124] The term “antigen-binding fragment” as used herein refers to an antibody fragment including, for example, a diabody, a Fab, a Fab′, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain Fv (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds. In some embodiments, an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.

[0125] “Fv” is the minimum antibody fragment, which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.

[0126] “Single-chain Fv,” also abbreviated as “sFv” or “scFv,” are antibody fragments that comprise the V.sub.H and V.sub.L antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains, which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Plückthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).

[0127] As used herein, the term “CDR” or “complementarity determining region” is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991); Chothia et al., J. Mol. Biol. 196:901-917 (1987); Al-Lazikani B. et al., J. Mol. Biol., 273: 927-948 (1997); MacCallum et al., J. Mol. Biol. 262:732-745 (1996); Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008); Lefranc M. P. et al., Dev. Comp. Immunol., 27: 55-77 (2003); and Honegger and Plückthun, J. Mol. Biol., 309:657-670 (2001), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison. CDR prediction algorithms and interfaces are known in the art, including, for example, Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008); Ehrenmann F. et al., Nucleic Acids Res., 38: D301-D307 (2010); and Adolf-Bryfogle J. et al., Nucleic Acids Res., 43: D432-D438 (2015). The contents of the references cited in this paragraph are incorporated herein by reference in their entireties for use in the present application and for possible inclusion in one or more claims herein.

TABLE-US-00001 TABLE 1 CDR DEFINITIONS Kabat.sup.1 Chothia.sup.2 MacCallum.sup.3 IMGT.sup.4 AHo.sup.5 V.sub.H CDR1 31-35 26-32 30-35 27-38 25-40 V.sub.H CDR2 50-65 53-55 47-58 56-65 58-77 V.sub.H CDR3 95-102 96-101 93-101 105-117 109-137 V.sub.L CDR1 24-34 26-32 30-36 27-38 25-40 V.sub.L CDR2 50-56 50-52 46-55 56-65 58-77 V.sub.L CDR3 89-97 91-96 89-96 105-117 109-137 .sup.1Residue numbering follows the nomenc ature of Kabat et al., supra .sup.2Residue numbering follows the nomenc ature of Chothia et al., supra .sup.3Residue numbering follows the nomenc ature of MacCallum et al., supra .sup.4Residue numbering follows the nomenc ature of Lefranc et al., supra .sup.5Residue numbering follows the nomenc ature of Honegger and Plckthun, supra

[0128] The expression “variable-domain residue-numbering as in Kabat” or “amino-acid-position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or hypervariable region (HVR) of the variable domain. For example, a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.

[0129] Unless indicated otherwise herein, the amino acid residues which encompass the CDRs of a full-length antibody (e.g., an anti-CD137 antibody disclosed herein) are defined according to the Kabat nomenclature in Kabat et al., supra, and the numbering of the residues in an immunoglobulin heavy chain, e.g., in an Fc region, is that of the EU index as in Kabat et al., supra, except that the amino acid residues which encompass the CDRs of any consensus sequences are defined according to the Kabat nomenclature with modifications based on experimental conditions. The “EU index as in Kabat” refers to the residue numbering of the human IgG1 EU antibody.

[0130] “Framework” or “FR” residues are those variable-domain residues other than the CDR residues as herein defined.

[0131] “Humanized” forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).

[0132] A “human antibody” is an antibody that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147(1):86-95 (1991). See also van Dijk and van de Winkel, Curr. Opin. Pharmacol., 5: 368-74 (2001). Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSE™ technology). See also, for example, Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.

[0133] “Percent (%) amino acid sequence identity” or “homology” with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R. C., Nucleic Acids Research 32(5):1792-1797, 2004; Edgar, R. C., BMC Bioinformatics 5(1):113, 2004).

[0134] “Homologous” refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.

[0135] The term “constant domain” refers to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable domain, which contains the antigen-binding site. The constant domain contains the C.sub.H1, C.sub.H2 and C.sub.H3 domains (collectively, C.sub.H) of the heavy chain and the CHL (or C.sub.L) domain of the light chain.

[0136] The “light chains” of antibodies (immunoglobulins) from any mammalian species can be assigned to one of two clearly distinct types, called kappa (“κ”) and lambda (“λ”), based on the amino acid sequences of their constant domains.

[0137] The “CH1 domain” (also referred to as “C1” of “H1” domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).

[0138] “Hinge region” is generally defined as a region in IgG corresponding to Glu216 to Pro230 of human IgG1 (Burton, Molec. Immunol. 22:161-206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgG1 sequence by placing the first and last cysteine residues forming inter-heavy chain S—S bonds in the same positions.

[0139] The “CH2 domain” of a human IgG Fc region (also referred to as “C2” domain) usually extends from about amino acid 231 to about amino acid 340. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain-domain pairing and help stabilize the CH2 domain. Burton, Molec Immunol. 22:161-206 (1985).

[0140] The “CH3 domain” (also referred to as “C2” domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).

[0141] The term “Fc region” or “fragment crystallizable region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies described herein include human IgG1, IgG2 (IgG2A, IgG2B), IgG3 and IgG4.

[0142] “Fc receptor” or “FcR” describes a receptor that binds the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcγRII receptors include FcγRIIA (an “activating receptor”) and FcγRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcγRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor FcγRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain. (See M. Daeron, Annu. Rev. Immunol. 15:203-234 (1997). FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991); Capel et al., Immunomethods 4: 25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126: 330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term “FcR” herein.

[0143] The term “epitope” as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.

[0144] As used herein, a first antibody or fragment thereof “competes” for binding to a target antigen with a second antibody or fragment thereof when the first antibody or fragment thereof inhibits the target antigen binding of the second antibody of fragment thereof by at least about 50% (such as at least about any one of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody or fragment thereof, or vice versa. A high throughput process for “binning” antibodies based upon their cross-competition is described in PCT Publication No. WO 03/48731.

[0145] As use herein, the terms “specifically binds,” “specifically recognizing,” and “is specific for” refer to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules. For example, an antibody or antibody moiety that specifically recognizes a target (which can be an epitope) is an antibody or antibody moiety that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets. In some embodiments, the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA). In some embodiments, an antibody that specifically binds a target has a dissociation constant (K.sub.D) of ≤10.sup.−5 M, ≤10.sup.−6 M, ≤10.sup.−7 M, ≤10.sup.−1 M, ≤10.sup.−9 M, ≤10.sup.−10 M, ≤10.sup.−11 M, or ≤10.sup.−12 M. In some embodiments, an antibody specifically binds an epitope on a protein that is conserved among the protein from different species. In some embodiments, specific binding can include, but does not require exclusive binding. Binding specificity of the antibody or antigen-binding domain can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORE™-tests and peptide scans.

[0146] An “isolated” antibody (or construct) is one that has been identified, separated and/or recovered from a component of its production environment (e.g., natural or recombinant). Preferably, the isolated polypeptide is free of association with all other components from its production environment.

[0147] An “isolated” nucleic acid molecule encoding a construct, antibody, or antigen-binding fragment thereof described herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment. The isolated nucleic acid molecules encoding the polypeptides and antibodies described herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies described herein existing naturally in cells. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.

[0148] The term “control sequences” refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.

[0149] Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.

[0150] The term “vector,” as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors.”

[0151] The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.

[0152] The terms “host cell,” “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, and may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.

[0153] As used herein, “treatment” or “treating” is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this application, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by “treatment” is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods of the application contemplate any one or more of these aspects of treatment.

[0154] In the context of cancer, the term “treating” includes any or all of: inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden and ameliorating one or more symptoms associated with the disease.

[0155] The terms “inhibition” or “inhibit” refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To “reduce” or “inhibit” is to decrease, reduce or arrest an activity, function, and/or amount as compared to that of a reference. In certain embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 20% or greater. In another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 50% or greater. In yet another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater.

[0156] A “reference” as used herein, refers to any sample, standard, or level that is used for comparison purposes. A reference may be obtained from a healthy and/or non-diseased sample. In some examples, a reference may be obtained from an untreated sample. In some examples, a reference is obtained from a non-diseased or non-treated sample of an individual. In some examples, a reference is obtained from one or more healthy individuals who are not the individual or patient.

[0157] As used herein, “delaying development of a disease” means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.

[0158] “Preventing” as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in an individual that may be predisposed to the disease but has not yet been diagnosed with the disease.

[0159] As used herein, to “suppress” a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition. For example, an antibody which suppresses tumor growth reduces the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the antibody.

[0160] The terms “subject,” “individual,” and “patient” are used interchangeably herein to refer to a mammal, including, but not limited to, human, bovine, horse, feline, canine, rodent, or primate. In some embodiments, the individual is a human.

[0161] An “effective amount” of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.

[0162] A “therapeutically effective amount” of a substance/molecule of the application, agonist or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects. A therapeutically effective amount may be delivered in one or more administrations.

[0163] A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.

[0164] The terms “pharmaceutical formulation” and “pharmaceutical composition” refer to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components which are unacceptably toxic to an individual to which the formulation would be administered. Such formulations may be sterile.

[0165] A “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to an individual. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed.

[0166] A “sterile” formulation is aseptic or essentially free from living microorganisms and their spores.

[0167] Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive or sequential administration in any order.

[0168] The term “concurrently” is used herein to refer to administration of two or more therapeutic agents, where at least part of the administration overlaps in time or where the administration of one therapeutic agent falls within a short period of time relative to administration of the other therapeutic agent. For example, the two or more therapeutic agents are administered with a time separation of no more than about 60 minutes, such as no more than about any of 30, 15, 10, 5, or 1 minutes.

[0169] The term “sequentially” is used herein to refer to administration of two or more therapeutic agents where the administration of one or more agent(s) continues after discontinuing the administration of one or more other agent(s). For example, administration of the two or more therapeutic agents are administered with a time separation of more than about 15 minutes, such as about any of 20, 30, 40, 50, or 60 minutes, 1 day, 2 days, 3 days, 1 week, 2 weeks, or 1 month, or longer.

[0170] As used herein, “in conjunction with” refers to administration of one treatment modality in addition to another treatment modality. As such, “in conjunction with” refers to administration of one treatment modality before, during or after administration of the other treatment modality to the individual.

[0171] The term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.

[0172] An “article of manufacture” is any manufacture (e.g., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or disorder (e.g., cancer), or a probe for specifically detecting a biomarker described herein. In certain embodiments, the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.

[0173] It is understood that embodiments of the application described herein include “consisting” and/or “consisting essentially of” embodiments.

[0174] Reference to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X”.

[0175] As used herein, reference to “not” a value or parameter generally means and describes “other than” a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.

[0176] The term “about X-Y” used herein has the same meaning as “about X to about Y.”

[0177] As used herein and in the appended claims, the singular forms “a,” “or,” and “the” include plural referents unless the context clearly dictates otherwise.

II. CD137 (4-1BB)

[0178] CD137 (4-1BB) is a member of the tumor necrosis receptor (TNF-R) gene family, which includes proteins involved in regulation of cell proliferation, differentiation, and programmed cell death. CD137 is a 30 kDa type I membrane glycoprotein expressed as a 55 kDa homodimer. The receptor was initially described in mice (B. Kwon et al., P.N.A.S. USA, 86:1963-7 (1989)), and later identified in humans (M. Alderson et al., Eur. J. Immunol., 24: 2219-27 (1994); Z. Zhou et al., Immunol. Lett., 45:67 (1995)) (See, also, Published PCT Applications WO95/07984 and WO96/29348, and U.S. Pat. No. 6,569,997, hereby incorporated by reference (See, SEQ ID NO:2.)). The human and murine forms of CD137 are 60% identical at the amino acid level. Conserved sequences occur in the cytoplasmic domain, as well as 5 other regions of the molecule, indicating that these residues might be important for function of the CD137 molecule (Z. Zhou et al., Immunol. Lett., 45:67 (1995)). Expression of CD137 has been shown to be predominantly on cells of lymphoid lineage such as activated T-cells, activated Natural Killer (NK) cells, NKT-cells, CD4+CD25+ regulatory T-cells, and also on activated thymocytes, and intraepithelial lymphocytes. In addition, CD137 has also been shown to be expressed on cells of myeloid origin like dendritic cells, monocytes, neutrophils, and eosinophils. Even though CD137 expression is mainly restricted to immune/inflammatory cells, there have been reports describing its expression on endothelial cells associated with a small number of tissues from inflammatory sites and tumors.

[0179] Functional activities of CD137 on T-cells have been amply characterized. Signaling through CD137 in the presence of suboptimal doses of anti-CD3 has been demonstrated to induce T-cell proliferation and cytokine synthesis (mainly IFN-7), and to inhibit activated cell death. These effects have been observed with both murine and human T-cells (W. Shuford et al., J. Exp. Med., 186(1):47-55 (1997); D. Vinay et al., Semin. Immunol, 10(6):481-9 (1998); D. Laderach et al., Int. Immunol., 14(10): 1155-67 (2002)). In both humans and mice, co-stimulation enhances effector functions, such as IFN-7 production and cytotoxicity, by augmenting the numbers of antigen-specific and effector CD8+ T-cells. In the absence of anti-CD3 signaling, stimulation through CD137 does not alter T-cell function, indicating that CD137 is a co-stimulatory molecule.

[0180] A role for CD137 targeted therapy in the treatment of cancer was suggested by in vivo efficacy studies in mice utilizing agonistic anti-murine CD137 monoclonal antibodies. In a paper by Melero et al, agonistic anti-mouse CD137 antibody produced cures in P815 mastocytoma tumors, and in the low immunogenic tumor model Ag104 (I. Melero et al, Nat. Med., 3(6):682-5 (1997)). The anti-tumor effect required both CD4+ and CD 8+ T-cells and NK cells, since selective in vivo depletion of each subpopulation resulted in the reduction or complete loss of the anti-tumor effect. It was also demonstrated that a minimal induction of an immune response was necessary for anti-CD137 therapy to be effective. Several investigators have used anti-CD137 antibodies to demonstrate the viability of this approach for cancer therapy (J. Kim et al, Cancer Res., 61(5):2031-7 (2001); O. Martinet et al, Gene Ther., 9(12):786-92 (2002); R. Miller et al, J. Immunol, 169(4): 1792-800 (2002); R. Wilcox et al, Cancer Res., 62(15):4413-8 (2002)).

[0181] In addition to its role in the development of immunity to cancer, experimental data supports the use of CD137 agonistic antibodies for the treatment of autoimmune and viral diseases (B. Kwon et al, Exp. Mol. Med., 35(1):8-16 (2003); H. Salih et al, J. Immunol, 167(7):4059-66 (2001); E. Kwon et al, P.N.A.S. USA, 96:15074-79 (1999); J. Foell et al, N.Y. Acad. Sci., 987:230-5 (2003); Y. Sun et al, Nat. Med., 8(12): 1405-13 (2002) S. K. Seo et al, Nat. Med. 10; 1099-94 (2004)).

III. Anti-CD137 Constructs

[0182] In one aspect, the present invention provides novel CD137-specific constructs (such as isolated anti-CD137 constructs) that comprise an antibody moiety that specifically binds to CD137. The specificity of the anti-CD137 construct derives from an anti-CD137 antibody moiety, such as a full-length antibody or antigen-binding fragment thereof, which specifically binds to CD137. In some embodiments, reference to a moiety (such as an antibody moiety) that specifically binds to CD137 means that the moiety binds to the CD137 with an affinity that is at least about 10 times (including for example at least about any of 10, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, or 10.sup.7 times) its binding affinity for non-target. In some embodiments, the non-target is an antigen that is not CD137. Binding affinity can be determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation assay (RIA). K.sub.d can be determined by methods known in the art, such as surface plasmon resonance (SPR) assay utilizing, for example, Biacore instruments, or kinetic exclusion assay (KinExA) utilizing, for example, Sapidyne instruments.

[0183] Contemplated anti-CD137 constructs include, but are not limited to, anti-CD137 scFvs, fusion proteins comprising an anti-CD137 antibody moiety and a half-life extending domain (such as an Fc region, albumin-binding domain), anti-CD137 monoclonal antibodies, multi-specific anti-CD137 molecules (such as bispecific antibodies). The exemplary anti-CD137 constructs above are not mutually exclusive and are further discussed in various sections below in more details.

[0184] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety specifically recognizing CD137 (e.g., human CD137), wherein the anti-CD137 antibody moiety can be any one of the anti-CD137 antibody moieties described herein.

[0185] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety that binds to CD137, comprising a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) an HC-CDR1 comprising an amino acid sequence of GFX.sub.1X.sub.2X.sub.3DTYIX.sub.4 (SEQ ID NO: 177), wherein X.sub.1=N or C; X.sub.2=I, P, L or M; X.sub.3=K, N, R, C or Q; X.sub.4=H or Q, ii) an HC-CDR2 comprising an amino acid sequence of X.sub.1IDPANGX.sub.2X.sub.3X.sub.4 (SEQ ID NO: 178), wherein X.sub.1=K or R; X.sub.2=N, G, F, Y, A, D, L, M or Q; X.sub.3=S or T; X.sub.4=E or M, and iii) an HC-CDR3 comprising an amino acid sequence of GNLHYX.sub.1LMD (SEQ ID NO: 179), wherein X.sub.1=Y, A or G; and b) the V.sub.L comprises: i) an LC-CDR1 comprising an amino acid sequence of KASQX.sub.1X.sub.2X.sub.3TYX.sub.4S (SEQ ID NO: 180), wherein X.sub.1=A, P or T; X.sub.2=I, T or P; X.sub.3=N or A; X.sub.4=L, G or H, ii) an LC-CDR2 comprising an amino acid sequence of RX.sub.1NRX.sub.2X.sub.3X.sub.4 (SEQ ID NO: 181), wherein X.sub.1=A, Y, V or D; X.sub.2=M, K, V or A; X.sub.3=V, P, Y or G; X.sub.4=D or G, and iii) an LC-CDR3 comprising an amino acid sequence of LQX.sub.1X.sub.2DFPYX.sub.3 (SEQ ID NO: 182), wherein X.sub.1=Y, S or F; X.sub.2=D, V, L, R, E or Q; X.sub.3=T or K.

[0186] In some embodiments, the anti-CD137 antibody moiety that binds to CD137 comprises a) the HC-CDR1 comprises an amino acid sequence of any one of SEQ ID NOs: 1, 11, 21, 31, 41, 51, 61, 71, 81, 91, 101, 111, 121, 131, 141, 231 and 241, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; b) the HC-CDR2 comprises an amino acid sequence of any one of SEQ ID NOs: 2, 12, 22, 32, 42, 52, 62, 72, 82, 92, 102, 112, 122, 132, 142, 232 and 242, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; c) the HC-CDR3 comprises an amino acid sequence of any one of SEQ ID NOs: 3, 13, 23, 33, 43, 53, 63, 73, 83, 93, 103, 113, 123, 133, 143, 233 and 243, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; d) the LC-CDR1 comprises an amino acid sequence of any one of SEQ ID NOs: 4, 14, 24, 34, 44, 54, 64, 74, 84, 94, 104, 114, 124, 134, 144, 234 and 244, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; e) the LC-CDR2 comprises an amino acid sequence of any one of SEQ ID NOs: 5, 15, 25, 35, 45, 55, 65, 75, 85, 95, 105, 115, 125, 135, 145, 235 and 245, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; f) the LC-CDR3 comprises an amino acid sequence of any one of SEQ ID NOs: 6, 16, 26, 36, 46, 56, 66, 76, 86, 96, 106, 116, 126, 136, 146, 236 and 246, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions. In some embodiments, the amino acid substitutions are limited to “exemplary substitutions” shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to “preferred substitutions” shown in Table 2 of this application.

[0187] In some embodiments, there is provided an anti-CD137 construct comprising an anti-CD137 antibody moiety that cross-competes for binding to CD137 with a reference anti-CD137 construct comprising a heavy chain variable region (V.sub.H) comprising HC-CDR1, HC-CDR2 and HC-CDR3 domains and a light chain variable region (V.sub.L) comprising LC-CDR1, LC-CDR2 and LC-CDR3 domains that are selected from the group consisting of: a) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; b) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 11, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 12, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 13, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 14, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; c) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 23, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 24, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 25, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 26, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; d) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 31, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 32, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 33, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 34, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 35, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 36, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; e) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 41, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 42, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 43, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 44, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 45, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 46, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; f) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 51, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 53, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 54, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 56, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; g) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 61, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 62, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 63, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 64, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 65, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 66, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; h) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 71, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 72, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 73, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 74, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 75, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 76, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; i) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 81, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 82, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 83, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 84, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 85, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 86, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; j) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 91, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 92, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 93, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 94, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 95, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 96, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; k) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 101, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 102, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 103, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 104, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 105, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO:106, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; 1) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 111, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 112, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 114, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 115, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 116, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; m) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 121, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 122, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; n) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 131, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 134, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; o) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 231, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 233, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 234, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 236, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; and p) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 241, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 242, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 243, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 244, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 245, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 246, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions.

[0188] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety that binds to CD137, comprising a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) an HC-CDR1 comprising an amino acid sequence of DTYIH or GFNIQDT, ii) an HC-CDR2 comprising an amino acid sequence of DPANGN, and iii) an HC-CDR3 comprising an amino acid sequence of GNLHYALMD; and b) the V.sub.L comprises: i) an LC-CDR1 comprising an amino acid sequence of NTYLS, ii) an LC-CDR2 comprising an amino acid sequence of RVNRKV, and iii) an LC-CDR3 comprising an amino acid sequence of LQYLDFPY.

[0189] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety that binds to CD137, comprising: a) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID No: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 237 or 247; and b) a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID No: 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 238 or 248.

[0190] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety that binds to CD137, comprising a) a V.sub.H chain region having the sequence set forth in SEQ ID No: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 237 or 247, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 237 or 247, and b) a V.sub.L chain region having the sequence set forth in SEQ ID No: 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 238 or 248, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 238 or 248. In some embodiments, the V.sub.H chain region and the V.sub.L chain region are linked via a linker (e.g., peptide linker).

[0191] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety that binds to CD137, comprising a V.sub.H region having the sequence set forth in SEQ ID No: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 237 or 247; and a V.sub.L region having the sequence set forth in SEQ ID No: 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 238 or248.

[0192] In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises (a) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 7; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 8; (b) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 17; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 18; (c) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 27; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 28; (d) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 37; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 38; (e) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 47; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 48; (f) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 57; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 58; (g) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 67; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 68; (h) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 77; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 78; (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 87; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 88; (j) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 97; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 98; (k) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 107; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 108; (1) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 117; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 118; (m) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 127; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 128; (n) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 137; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 138; (o) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 237; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 238; or (p) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 247; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 248.

[0193] In some embodiments, there is provided an anti-CD137 construct (e.g., an anti-CD137 scFv) comprising an anti-CD137 antibody moiety that binds to CD137, comprising a heavy chain (HC) having the sequence set forth in SEQ ID No: 9, 19, 29, 39, 49, 59, 69, 79, 89, 99, 109, 119, 129, 139, 149, 239 or 249; and a light chain (LC) having the sequence set forth in SEQ ID No: 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 240 or 250.

[0194] In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 9; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 10. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 19; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 20. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 29; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 30. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 39; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 40. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 49; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 50. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 59; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 60. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 69; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 70. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 79; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 80. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 89; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 90. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 99; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 100. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 109; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 110. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 119; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 120. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 129; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 130. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 139; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 140. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 149; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 150. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 239; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 240. In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises a heavy chain comprising amino acids having the sequence set forth in SEQ ID NO: 249; and a light chain comprising amino acids having the sequence set forth in SEQ ID NO: 250.

[0195] Another aspect of the present application provides isolated anti-CD137 constructs comprising an antibody moiety that binds to CD137, comprising a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) an HC-CDR1 comprising an amino acid sequence of any one of SEQ ID NOs: 151-153, or a variant thereof comprising up to about 3 amino acid substitutions; ii) an HC-CDR2 comprising an amino acid sequence of any one of SEQ ID NOs: 154-156, or a variant thereof comprising up to about 3 amino acid substitutions; iii) an HC-CDR3 comprising an amino acid sequence of any one of SEQ ID NOs: 157-159, or a variant thereof comprising up to about 3 amino acid substitutions; and b) the V.sub.L comprises: i) an LC-CDR1 comprising an amino acid sequence of any one of SEQ ID NOs: 160-163, or a variant thereof comprising up to about 3 amino acid substitutions; ii) an HC-CDR2 comprising an amino acid sequence of any one of SEQ ID NOs: 164-166, or a variant thereof comprising up to about 3 amino acid substitutions; iii) an HC-CDR3 comprising an amino acid sequence of any one of SEQ ID NOs: 167-169, or a variant thereof comprising up to about 3 amino acid substitutions.

[0196] In some embodiments, the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 151, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 157, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 160, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 164, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167.

[0197] In some embodiments, the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 151, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 154, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 157, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 162, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 166, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169.

[0198] In some embodiments, the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 155, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 158, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 163, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 166, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 169.

[0199] In some embodiments, the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 153, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 159, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 160, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 164, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 167.

[0200] In some embodiments, the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 153, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 156, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 159, and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 165, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 168.

[0201] In some embodiments according to any one of the anti-CD137 constructs described herein, the anti-CD137 antibody moiety comprises (a) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 170; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 173; (b) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 170; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 176; (c) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 171; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 173; (d) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 171; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 174; or (e) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 172; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 175.

[0202] In some embodiments, the anti-CD137 construct comprises or is an antibody or antigen-binding fragment thereof selected from the group consisting of a full-length antibody, a bispecific antibody, a single-chain Fv (scFv), a Fab fragment, a Fab′ fragment, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a V.sub.HH, a Fv-Fc fusion, a scFv-Fc fusion, a scFv-Fv fusion, a diabody, a tribody, and a tetrabody. In some embodiments, the antibody or antigen-binding fragment is chimeric, human, partially humanized, fully humanized, or semi-synthetic. In some embodiments, the antibody or antigen-binding fragment thereof comprises an immunoglobulin isotype selected from the group consisting of an IgG, an IgM, an IgA, an IgD, and an IgE. In some embodiments, the antibody or antigen-binding fragment thereof has an isotype selected from the group consisting of an IgG1, an IgG2, an IgG3, or IgG4.

[0203] In some embodiments, the construct comprises a humanized anti-CD137 full-length antibody.

[0204] In some embodiments, the construct comprises a humanized anti-CD137 single chain Fv fragment.

[0205] In some embodiments, the construct binds to a human CD137. In some embodiments, the construct binds to a mammal CD137 (such as a monkey CD137). In some embodiments, the construct binds to both a human CD137 and a monkey CD137. In some embodiments, the construct does not bind to a mouse CD137.

[0206] As disclosed above, an anti-CD137 construct disclosed herein comprises an anti-CD137 antibody moiety that binds to CD137. In some embodiments, anti-CD137 antibody moiety binds to human and simian CD137.

[0207] In some embodiments, anti-CD137 antibody moiety comprised in an anti-CD137 construct disclosed herein is a CD137 agonist, wherein the binding of the antibody moiety to CD137 can enhance an immune signaling pathway mediated by CD137. In some embodiments, the binding of the antibody moiety to CD137 cannot enhance an immune signaling pathway mediated by CD137 without cross-linking and/or clustering of the antibody moiety/CD137 complex. In some embodiments, the binding of the antibody moiety to CD137 can activate an immune cell, e.g., a T cell and/or a NK cell. In some embodiments, the binding of the antibody moiety to CD137 cannot activate an immune cell, e.g., a T cell and/or a NK cell without cross-linking and/or clustering of the antibody moiety/CD137 complex. In some embodiments, the cross-linking and/or clustering of the antibody moiety/CD137 complex can be mediated by a second moiety of the anti-CD137 construct disclosed herein. In some embodiments, the cross-linking and/or clustering of the antibody moiety/CD137 complex can be mediated by the binding of a Fc receptor to a Fc region of the anti-CD137 construct. In some embodiments, the cross-linking and/or clustering of the antibody moiety/CD137 complex can be mediated by the binding of a second antibody moiety of the anti-CD137 construct to a tumor associated antigen (TAA).

[0208] In some embodiments, the antibody moiety comprises an Fc region selected from the group consisting of Fc regions from IgG, IgA, IgD, IgE, IgM, and any combinations and hybrids thereof. In some embodiments, the Fc region is derived from a human IgG. In some embodiments, the Fc region comprises the Fc region of human IgG1, IgG2, IgG3, IgG4, or a combination or hybrid IgG. In some embodiments, the Fc region is an IgG1 Fc region. In some embodiments, the Fc region comprises the CH2 and CH3 domains of IgG1. In some embodiments, the Fc region is an IgG2 Fc region. In some embodiments, the Fc region comprises the CH2 and CH3 domains of IgG2. In some embodiments, the Fc region is an IgG4 Fc region. In some embodiments, the Fc region comprises the CH2 and CH3 domains of IgG4. IgG4 Fe is known to exhibit less effector activity than IgG1 or IgG2 Fe, and thus may be desirable for some applications. In some embodiments, the Fc region is derived from of a mouse immunoglobulin.

[0209] In some embodiments, the antibody moiety comprises an Fc region. In some embodiments, the antibody moiety is an scFv fused to an Fc region. In some embodiments, the antibody moiety comprises a scFv fused to an Fc region via a peptide linker. In some embodiments, the Fc region is a human IgG1 Fc region. In some embodiments, the Fc region comprises one or more mutations to increase clearance or decrease half-life.

[0210] In some embodiments, the Fc region comprises an immunoglobulin IgG heavy chain constant region comprising a hinge region (starting at Cys226), an IgG CH2 domain and CH3 domain. The term “hinge region” or “hinge sequence” as used herein refers to the amino acid sequence located between the linker and the CH2 domain. In some embodiments, the fusion protein comprises an Fc region comprising a hinge region. In some embodiments, the Fc region of the fusion protein starts at the hinge region and extends to the C-terminus of the IgG heavy chain. In some embodiments, the fusion protein comprises an Fc region that does not comprise the hinge region.

[0211] In some embodiments, the IgG CH2 domain starts at Ala231. In some embodiments, the CH3 domain starts at Gly341. It is understood that the C-terminus Lys residue of human IgG can be optionally absent. It is also understood that conservative amino acid substitutions of the Fc region without affecting the desired structure and/or stability of Fc is contemplated within the scope of the invention.

[0212] In some embodiments, each chain of the Fc region is fused to the same antibody moiety. In some embodiments, the scFv-Fc comprises two identical scFvs described herein, each fused with one chain of the Fc region. In some embodiments, the scFv-Fc is a homodimer.

[0213] In some embodiments, the scFv-Fc comprises two different scFvs, each fused with one chain of the Fc region. In some embodiments, the scFv-Fc is a heterodimer.

[0214] Heterodimerization of non-identical polypeptides in the scFv-Fc can be facilitated by methods known in the art, including without limitation, heterodimerization by the knob-into-hole technology. The structure and assembly method of the knob-into-hole technology can be found in, e.g., U.S. Pat. Nos. 5,821,333, 7,642,228, US 2011/0287009 and PCT/US2012/059810, hereby incorporated by reference in their entireties. This technology was developed by introducing a “knob” (or a protuberance) by replacing a small amino acid residue with a large one in the CH3 domain of one Fc and introducing a “hole” (or a cavity) in the CH3 domain of the other Fc by replacing one or more large amino acid residues with smaller ones. In some embodiments, one chain of the Fc region in the fusion protein comprises a knob, and the second chain of the Fc region comprises a hole.

[0215] The preferred residues for the formation of a knob are generally naturally occurring amino acid residues and are preferably selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W). Most preferred are tryptophan and tyrosine. In one embodiment, the original residue for the formation of the knob has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine. Exemplary amino acid substitutions in the CH3 domain for forming the knob include without limitation the T366W, T366Y or F405W substitution.

[0216] The preferred residues for the formation of a hole are usually naturally occurring amino acid residues and are preferably selected from alanine (A), serine (S), threonine (T) and valine (V). In one embodiment, the original residue for the formation of the hole has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan. Exemplary amino acid substitutions in the CH3 domain for generating the hole include without limitation the T366S, L368A, F405A, Y407A, Y407T and Y407V substitutions. In certain embodiments, the knob comprises T366W substitution, and the hole comprises the T366S/L368A/Y407V substitutions. It is understood that other modifications to the Fc region known in the art that facilitate heterodimerization are also contemplated and encompassed by the instant application.

[0217] Other scFv-Fc variants (including variants of isolated anti-CD137 scFv-Fc, e.g., a full-length anti-CD137 antibody variants) comprising any of the variants described herein (e.g., Fc variants, effector function variants, glycosylation variants, cysteine engineered variants), or combinations thereof, are contemplated.

[0218] a) Antibody Affinity

[0219] Binding specificity of the antibody moieties can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORE™-tests and peptide scans.

[0220] In some embodiments, the K.sub.D of the binding between the antibody moiety and CD137 is about 10.sup.−7 M to about 10.sup.−12 M, about 10.sup.−7 M to about 10.sup.−8 M, about 10.sup.−8 M to about 10.sup.−9 M, about 10.sup.−9 M to about 10.sup.−10 M, about 10.sup.−10 M to about 10.sup.−11 M, about 10.sup.−11 M to about 10.sup.−12 M, about 10.sup.−7 M to about 10.sup.−12 M, about 10.sup.−8 M to about 10.sup.−12 M, about 10.sup.−9 M to about 10.sup.−12 M, about 10.sup.−10 M to about 10.sup.−12 M, about 10.sup.−7 M to about 10.sup.−11 M, about 10.sup.−8 M to about 10.sup.−11 M, about 10.sup.−9 M to about 10.sup.−11 M, about 10.sup.−7 M to about 10.sup.−10 M, about 10.sup.−8 M to about 10.sup.−10 M, or about 10.sup.−7 M to about 10.sup.−9 M. In some embodiments, the K.sub.D of the binding between the antibody moiety and CD137 is stronger than about any one of 10.sup.−7 M, 10.sup.−1 M, 10.sup.−9 M, 10.sup.−10 M, 10.sup.−11 M, or 10-12 M. In some embodiments, CD137 is human CD137.

[0221] In some embodiments, the K.sub.on of the binding between the antibody moiety and CD137 is about 10.sup.3 M.sup.−1s.sup.−1 to about 10.sup.8 M.sup.−1s.sup.−1, about 10.sup.3 M.sup.−1s.sup.−1 to about 10.sup.4 M.sup.−1s.sup.−1, about 10.sup.4 M.sup.−1s.sup.−1 to about 10.sup.5 M.sup.−1s.sup.−1, about 10.sup.5 M.sup.−1s.sup.−1 to about 106 M.sup.−1s.sup.−1, about 106 M.sup.−1s.sup.−1 to about 10.sup.7 M.sup.−1s.sup.−1, or about 10.sup.7 M.sup.−1s.sup.−1 to about 10.sup.8 M.sup.−1s.sup.−1. In some embodiments, the K.sub.on of the binding between the antibody moiety and CD137 is about 10.sup.3 M.sup.−1s.sup.−1 to about 10.sup.5 M.sup.−1s.sup.−1, about 10.sup.4 M.sup.−1s.sup.−1 to about 106 M.sup.−1s.sup.−1, about 10.sup.5 M.sup.−1s.sup.−1 to about 10.sup.7 M.sup.−1s.sup.−1, about 106 M.sup.−1s.sup.−1 to about 108 M-s.sup.−1, about 10.sup.4 M.sup.−1s.sup.−1 to about 10.sup.7 M.sup.−1s.sup.−1, or about 10.sup.5 M.sup.−1s.sup.−1 to about 108 M.sup.−1s.sup.−1. In some embodiments, the K.sub.on of the binding between the antibody moiety and CD137 is no more than about any one of 10.sup.3 M.sup.−1s.sup.−1, 10.sup.4 M.sup.−1s.sup.−1, 10.sup.5 M.sup.−1s.sup.−1, 10.sup.6 M.sup.−1s.sup.−1, 10.sup.7 M.sup.−1s.sup.−1 or 10′ M.sup.−1s.sup.−1. In some embodiments, CD137 is human CD137.

[0222] In some embodiments, the K.sub.off of the binding between the antibody moiety and CD137 is about 1 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 1 s.sup.−1 to about 10.sup.−2 s.sup.−1, about 10.sup.−2 s.sup.−1 to about 10.sup.−3 s.sup.−1, about 10.sup.−3 s.sup.−1 to about 10.sup.−4 s.sup.−1, about 10.sup.−4 s.sup.−1 to about 10.sup.−5 s.sup.−1, about 10.sup.−5 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 1 s.sup.−1 to about 10.sup.−5 s.sup.−1, about 10.sup.−2 s.sup.−1 to about 10.sup.−6 s.sup.−1 about 10.sup.−3 s.sup.−1 to about 10.sup.−6 s.sup.−1 about 10.sup.−4 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 10.sup.−2 s.sup.−1 to about 10.sup.−5 s.sup.−1, or about 10.sup.−3 s.sup.−1 to about 10.sup.−5 s.sup.−1. In some embodiments, the K.sub.off of the binding between the antibody moiety and CD137 is at least about any one of 1 s.sup.−1, 10.sup.−2 s.sup.−1, 10.sup.−3 s.sup.−1, 10.sup.−4 s.sup.−1, 10.sup.−5 s.sup.−1 or 10.sup.−6 s.sup.−1. In some embodiments, CD137 is human CD137.

[0223] In some embodiments, the binding affinity of the anti-CD137 antibody moieties or anti-CD137 constructs are higher (for example, has a smaller Kd value) than an existing anti-CD137 antibody (e.g., anti-human CD137 antibody such as BMS-663513 (urelumab) or PF-05082566 (utomilumab)).

[0224] b) Chimeric or Humanized Antibodies

[0225] In some embodiments, the antibody moiety is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). In some embodiments, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from mouse) and a human constant region. In some embodiments, a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.

[0226] In some embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.

[0227] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad Sci. USA 86:10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing “resurfacing”); Dall'Acqua et al., Methods 36:43-60 (2005) (describing “FR shuffling”); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the “guided selection” approach to FR shuffling).

[0228] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); Framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J Biol. Chem. 272:10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).

[0229] c) Human Antibodies

[0230] In some embodiments, the antibody moiety is a human antibody (known as human domain antibody, or human DAb). Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001), Lonberg, Curr. Opin. Immunol. 20:450-459 (2008), and Chen, Mol. Immunol. 47(4):912-21 (2010). Transgenic mice or rats capable of producing fully human single-domain antibodies (or DAb) are known in the art. See, e.g., US20090307787A1, U.S. Pat. No. 8,754,287, US20150289489A1, US20100122358A1, and WO2004049794.

[0231] Human antibodies (e.g., human DAbs) may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23:1117-1125 (2005). See also, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE™ technology; U.S. Pat. No. 5,770,429 describing HuMab© technology; U.S. Pat. No. 7,041,870 describing K-M MOUSE© technology, and U.S. Patent Application Publication No. US 2007/0061900, describing VelociMouse© technology). Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.

[0232] Human antibodies (e.g., human DAbs) can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described (See, e.g., Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991)). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).

[0233] Human antibodies (e.g., human DAbs) may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.

[0234] d) Library-Derived Antibodies

[0235] The antibody moieties may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N.J., 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004). Methods for constructing single-domain antibody libraries have been described, for example, see U.S. Pat. No. 7,371,849.

[0236] In certain phage display methods, repertoires of V.sub.H and V.sub.L genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically displays antibody fragments, either as scFv fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J Mol. Biol., 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.

[0237] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.

[0238] e) Substitution, Insertion, Deletion and Variants

[0239] In some embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs (or CDRs) and FRs. Conservative substitutions are shown in Table 2 under the heading of “Preferred substitutions.” More substantial changes are provided in Table 2 under the heading of “exemplary substitutions,” and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.

TABLE-US-00002 TABLE 2 Amino acid substitutions Original Exemplary Substitutions Preferred Ala (A) Val; Leu; He Val Arg (R) Lys; Gin; Asn Lys Asn (N) Gin; His; Asp, Lys; Arg Gin Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gin (Q) Asn; Glu Asn Glu (E) Asp; Gin Asp Gly (G) Ala Ala His (H) Asn; Gin; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Leu Norleucine Leu (L) Norleucine; He; Val; Met; He Ala; Phe Lys (K) Arg; Gin; Asn Arg Met (M) Leu; Phe; He Leu Phe (F) Trp; Leu; Val; He; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) He; Leu; Met; Phe; Ala; Leu Norleucine Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, lie; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.

[0240] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.

[0241] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR (or CDRs) residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).

[0242] Alterations (e.g., substitutions) may be made in HVRs (or CDRs), e.g., to improve antibody affinity. Such alterations may be made in HVR (or CDRs) “hotspots,” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., (2001)). In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR (or CDRs) residues (e.g., 4-6 residues at a time) are randomized. HVR (or CDRs) residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.

[0243] In some embodiments, substitutions, insertions, or deletions may occur within one or more HVRs (or CDRs) so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs (or CDRs). Such alterations may be outside of HVR “hotspots” or CDRs. In some embodiments of the variant V.sub.HH sequences provided above, each HVR (or CDRs) either is unaltered, or contains no more than one, two or three amino acid substitutions.

[0244] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.

[0245] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.

[0246] f) Glycosylation Variants

[0247] In some embodiments, the antibody moiety is altered to increase or decrease the extent to which the construct is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.

[0248] Where the antibody moiety comprises an Fc region (e.g., scFv-Fc), the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the C.sub.H2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in the antibody moiety may be made in order to create antibody variants with certain improved properties.

[0249] In some embodiments, the antibody moiety has a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g., complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues); however, Asn297 may also be located about +3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to “defucosylated” or “fucose-deficient” antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Patent Application No. US 2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Adams et al., especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).

[0250] In some embodiments, the antibody moiety has bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al.); U.S. Pat. No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al.). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).

[0251] g) Fc Region Variants

[0252] In some embodiments, one or more amino acid modifications may be introduced into the Fc region of the antibody moiety (e.g., scFv-Fc), thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.

[0253] In some embodiments, the Fc region possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody moiety in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcγR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII. FcR expression on hematopoietic cells is summarized in Table 2 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat'l Acad. Sci. USA 82:1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, Wis.). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat'l Acad Sci. USA 95:652-656 (1998). C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg, M. S. et al., Blood 101:1045-1052 (2003); and Cragg, M. S. and M. J. Glennie, Blood 103:2738-2743 (2004)). FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int'l. Immunol. 18(12):1759-1769 (2006)).

[0254] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).

[0255] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312, and Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001).)

[0256] In some embodiments, the Fc region is an IgG1 Fc region. In some embodiments, the IgG1 Fc region comprises a L234A mutation and/or a L235A mutation. In some embodiments, the Fc region is an IgG2 or IgG4 Fc region. In some embodiments, the Fc region is an IgG4 Fc region comprising a S228P, F234A, and/or a L235A mutation.

[0257] In some embodiments, the antibody moiety comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).

[0258] In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

[0259] In some embodiments, the antibody moiety (e.g., scFv-Fc) variant comprising a variant Fc region comprising one or more amino acid substitutions which alters half-life and/or changes binding to the neonatal Fc receptor (FcRn). Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which alters binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).

[0260] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Pat. Nos. 5,648,260; 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.

[0261] h) Cysteine Engineered Antibody Variants

[0262] In some embodiments, it may be desirable to create cysteine engineered antibody moieties, e.g., “thioMAbs,” in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In some embodiments, any one or more of the following residues may be substituted with cysteine: A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibody moieties may be generated as described, e.g., in U.S. Pat. No. 7,521,541.

[0263] i) Antibody Derivatives

[0264] In some embodiments, the antibody moiety described herein may be further modified to comprise additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide copolymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in diagnosis under defined conditions, etc.

[0265] In some embodiments, the antibody moiety may be further modified to comprise one or more biologically active protein, polypeptides or fragments thereof. “Bioactive” or “biologically active”, as used herein interchangeably, means showing biological activity in the body to carry out a specific function. For example, it may mean the combination with a particular biomolecule such as protein, DNA, etc., and then promotion or inhibition of the activity of such biomolecule. In some embodiments, the bioactive protein or fragments thereof include proteins and polypeptides that are administered to patients as the active drug substance for prevention of or treatment of a disease or condition, as well as proteins and polypeptides that are used for diagnostic purposes, such as enzymes used in diagnostic tests or in vitro assays, as well as proteins and polypeptides that are administered to a patient to prevent a disease such as a vaccine.

[0266] j) Anti-CD137 scFv

[0267] The anti-CD137 constructs in some embodiments are scFvs (hereinafter referred to as “anti-CD137 scFv”) comprising an anti-CD137 antibody moiety described herein. The anti-CD137-scFv can comprise any one of the anti-CD137 antibody moieties described herein (see “anti-CD137 antibody moiety” section). In some embodiments, the anti-CD137 scFv has the configuration of (from N-terminus to C-terminus): V.sub.L(CD137)-L-V.sub.H(CD137). In some embodiments, the anti-CD137 scFv has the configuration of (from N-terminus to C-terminus): V.sub.H(CD137)-L-V.sub.L(CD137), L is a linker (such as peptide linker).

[0268] In some embodiments, the anti-CD137 scFv is chimeric, human, partially humanized, fully humanized, or semi-synthetic.

[0269] In some embodiments, the anti-CD137 VL and anti-CD137 VH in the scFv is linked via a linker (e.g., a peptide linker). In some embodiments, the linker comprises from about four to about fifteen amino acids. In some embodiments, the linker is a GS linker. In some embodiments, the linker comprises a sequence of any one of SEQ ID Nos: 206-230.

[0270] k) Anti-CD137 Fusion Proteins

[0271] The anti-CD137 constructs in some embodiments comprise an anti-CD137 antibody moiety and a half-life extending moiety. In some embodiments, the half-life extending moiety is an Fc region. In some embodiments, the half-life extending moiety is an albumin binding moiety (e.g., an albumin binding antibody moiety).

[0272] In some embodiments, the half-life extending moiety is an Fc region (such as any of the Fc regions or variants thereof described herein). The term “Fc region,” “Fc domain” or “Fc” refers to a C-terminal non-antigen binding region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native Fc regions and variant Fc regions. In some embodiments, a human IgG heavy chain Fc region extends from Cys226 to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present, without affecting the structure or stability of the Fc region. Unless otherwise specified herein, numbering of amino acid residues in the IgG or Fc region is according to the EU numbering system for antibodies, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.

[0273] In some embodiments, the Fc region is selected from the group consisting of Fc regions from IgG, IgA, IgD, IgE, IgM, and any combinations and hybrids thereof. In some embodiments, the Fc region is selected from the group consisting of Fc regions from IgG1, IgG2, IgG3, IgG4, and any combinations and hybrids thereof.

[0274] In some embodiments, the Fc region has a reduced effector function as compared to corresponding wildtype Fc region (such as at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% reduced effector function as measured by the level of antibody-dependent cellular cytotoxicity (ADCC)).

[0275] In some embodiments, the Fc region is an IgG1 Fc region. In some embodiments, the IgG1 Fc region comprises a L234A mutation and/or a L235A mutation. In some embodiments, the Fc region is an IgG2 or IgG4 Fc region. In some embodiments, the Fc region is an IgG4 Fc region comprising a S228P, F234A, and/or a L235A mutation.

[0276] In some embodiments, the anti-CD137 antibody moiety and the half-life extending moiety is linked via a linker (such as any of the linkers described in the “Linkers” section).

[0277] In some embodiments, the anti-CD137 fusion protein further comprises a second antibody. In some embodiments, the second antibody binds to a tumor antigen (such as any one of the tumor antigens described herein).

[0278] l) Multispecific Antibodies

[0279] Also provided herein are multispecific antibodies (e.g., bispecific antibodies) that bind to both CD137 and a second antigen. In some embodiments, the second antigen is also CD137 but comprises an epitope that is different from the anti-CD137 antibody moieties described herein. In some embodiments, the second antigen is not CD137. In some embodiments, the second antigen is a tumor associated antigen.

[0280] In some embodiments, the multispecific antibody comprises: a) a first antibody moiety comprising any anti-CD137 construct described herein; and b) a second antibody moiety that binds to a second antigen that is not CD137. In some embodiments, the second antigen comprises a tumor associated antigen.

[0281] In some embodiments, the first antibody moiety comprises a single chain Fv fragment that binds to CD137. In some embodiments, the second antibody moiety comprises a full length antibody that binds to a tumor associated antigen and comprising two antibody heavy chains and two antibody light chains, and wherein the heavy chains each comprises a second heavy chain variable region (V.sub.H-2) and the light chains each comprises a second light chain variable region (V.sub.L-2), and wherein the anti-CD137 single chain Fv fragment is fused to at least one of the heavy chains or the light chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the C-terminus of the light chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the N-terminus of the light chains of the full length antibody.

[0282] In some embodiments, the multispecific antibody comprises: a) a first antibody moiety comprising a single chain Fv fragment that binds to CD137, wherein the single chain Fv fragment comprises a first heavy chain variable region (V.sub.H-1) and a first light chain variable region (V.sub.L-1), and b) a second antibody moiety comprising a full length antibody that binds to a second antigen (e.g., a tumor associated antigen) and comprising two antibody heavy chains and two antibody light chains, and wherein the heavy chains each comprises a second heavy chain variable region (V.sub.H-2) and the light chains each comprises a second light chain variable region (V.sub.L-2). In some embodiments, the anti-CD137 single chain Fv fragment is fused to the C-terminus of the heavy chains of one or both of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the N-terminus of one or both of the heavy chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the C-terminus of the light chains of one or both of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the N-terminus of the light chains of one or both of the full length antibody. In some embodiments, the V.sub.H-1 and the V.sub.L-1 of the anti-CD137 single chain Fv fragment are fused to the full length antibody via a first linker (e.g., a first peptide linker). In some embodiments, the first linker comprises from about one to about thirty (such as about four to twenty, about three to twenty, about six to eighteen, or about ten to fifteen) amino acids. In some embodiments, the first linker is a GS linker. In some embodiments, the linker has an amino acid sequence of any one of SEQ ID Nos: 206-230. In some embodiments, the full length antibody comprises an Fc region selected from the group consisting of Fc regions from IgG, IgA, IgD, IgE, IgM, and any combinations and hybrids thereof. In some embodiments, the Fc region is selected from the group consisting of Fc regions from IgG1, IgG2, IgG3, IgG4, and any combinations and hybrids thereof. In some embodiments, the Fc region is an IgG1 Fc region. In some embodiments, the IgG1 Fc region comprises a L234A mutation and/or a L235A mutation. In some embodiments, the Fc region is an IgG4 Fc region. In some embodiments, the Fc region is an IgG2 Fc region. In some embodiments, the IgG4 Fc region comprises a F234A mutation and a L235A mutation. In some embodiments, the IgG4 Fc region further comprises a S228P mutation.

[0283] In some embodiments, the multispecific antibody comprises a) a first antibody moiety comprising a full length antibody comprising any anti-CD137 constructs described herein and b) a second antibody moiety comprising a single chain Fv fragment that recognize a second antigen (e.g., a tumor associated antigen). In some embodiments, the single chain Fv fragment is fused to one or both of the heavy chains of the anti-CD137 full length antibody. In some embodiments, the single chain Fv fragment is fused to the C-terminus of one or both of the heavy chains of the anti-CD137 full length antibody. In some embodiments, the single chain Fv fragment is fused to one or both of the N-terminus of the heavy chains of the anti-CD137 full length antibody. In some embodiments, the single chain Fv fragment is fused to one or both of the light chains of the anti-CD137 full length antibody. In some embodiments, the single chain Fv fragment is fused to the C-terminus of one or both of the light chains of the anti-CD137 full length antibody. In some embodiments, the single chain Fv fragment is fused to the N-terminus of one or both of the anti-CD137 light chains of the full length antibody.

[0284] “Tumor associated antigen” as described herein refers to, for example, any antigen that is expressed significantly higher (such as at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, or 70% higher) by tumor cells (e.g., cancer cells) than by non-tumor cells (e.g., non-cancer cells).

[0285] Exemplary tumor associated antigens that can be recognized by the second antibody moiety described herein include, but are not limited to, alpha fetoprotein (AFP), CA15-3, CA27-29, CA19-9, CA-125, calretinin, carcinoembryonic antigen, CD34, CD99, CD117, chromogranin, cytokeratin, desmin, epithelial membrane protein (EMA), Factor VIII, CD31 FL1, glial fibrillary acidic protein (GFAP), gross cystic disease fluid protein (GCDFP-15), HMB-45, human chorionic gonadotropin (hCG), inhibin, keratin, CD45, a lymphocyte marker, MART-1 (Melan-A), Myo Dl, muscle-specific actin (MSA), neurofilament, neuron-specific enolase (NSE), placental alkaline phosphatase (PLAP), prostate-specific antigen, S100 protein, smooth muscle actin (SMA), synaptophysin, thyroglobulin, thyroid transcription factor-1, tumor M2-PK, and vimentin.

[0286] In some embodiments, the tumor associated antigen is selected from the group consisting of HER2, EGFR, PD-L1, c-Met, B Cell Maturation Antigen (BCMA), carbonic anhydrase IX (CA1X), carcinoembryonic antigen (CEA), CD5, CD7, CD10, CD19, CD20, CD22, CD30, CD33, CD34, CD38, CD41, CD44, CD49f, CD56, CD74, CD123, CD133, CD138, CD276 (B7H3), epithelial glycoprotein (EGP2), trophoblast cell-surface antigen 2 (TROP-2), epithelial glycoprotein-40 (EGP-40), epithelial cell adhesion molecule (EpCAM), receptor tyrosine-protein kinases erb-B2,3,4, folate-binding protein (FBP), fetal acetylcholine receptor (AChR), folate receptor-a, Ganglioside G2 (GD2), Ganglioside G3 (GD3), human telomerase reverse transcriptase (hTERT), kinase insert domain receptor (KDR), Lewis A (CA 1.9.9), Lewis Y (LeY), Glypican-3 (GPC3), L1 cell adhesion molecule (LiCAM), Mucin 16 (Muc-16), Mucin 1 (Muc-1), NG2D ligands, oncofetal antigen (h5T4), prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), tumor-associated glycoprotein 72 (TAG-72), Claudin18.2 (CLDN18.2), vascular endothelial growth factor R2 (VEGF-R2), Wilms tumor protein (WT-1), type 1 tyrosine-protein kinase transmembrane receptor (ROR1) and any combination thereof. In some embodiments, the tumor associated antigen is HER2, EGFR, B7H3, c-Met, or PD-L1. In some embodiments, the tumor associated antigen is selected from the group consisting of HER2, EGFR, B7H3, c-Met, or PD-L1.

[0287] m) Anti-CD137×HER2 Multispecific Antibody

[0288] In some embodiments, the multispecific antibody disclosed herein comprises: a) a first antibody moiety comprising any anti-CD137 constructs disclosed herein which is a single chain Fv fragment and b) a second antibody moiety comprising a full length antibody that binds to HER2 and comprises two antibody heavy chains and two antibody light chains, and wherein the heavy chains each comprises a second heavy chain variable region (V.sub.H-2) and the light chains each comprises a second light chain variable region (V.sub.L-2), and wherein the anti-CD137 single chain Fv fragment is fused to the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the C-terminus of the heavy chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the N-terminus of the heavy chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the C-terminus of the light chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the N-terminus of the light chains of the full length antibody. In some embodiments, the HER2 is a human HER2. In some embodiments, the full length antibody that binds to HER2 or the anti-HER2 antibody moiety competes for a binding epitope of HER2 with an antibody or antibody fragment comprising a third heavy chain variable region (V.sub.H-3) and a third light chain variable region (V L-3), wherein: a) the V.sub.H-3 comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and b) the V.sub.L-3 comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200. In some embodiments, the V.sub.H-2 comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and the V.sub.L-2 comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

[0289] In some embodiments, the multispecific antibody comprises: a) the first antibody moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 121, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 122, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 123, and the VL comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126; and b) the second antibody moiety comprises a second heavy chain variable region (VH-2) and a second light chain variable region (V L-2), wherein the VH-2 comprises a second HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, a second HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and a second HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and the VL-2 comprises a second LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, a second LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and a second LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

[0290] In some embodiments, the multispecific antibody comprises: a) the first antibody moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the V.sub.H comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 231, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 232, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 233, and the VL comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 234, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 235, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 236; and b) the second antibody moiety comprises a second heavy chain variable region (VH-2) and a second light chain variable region (V L-2), wherein the VH-2 comprises a second HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, a second HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and a second HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and the VL-2 comprises a second LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, a second LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and a second LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

[0291] In some embodiments, the multispecific antibody comprises: a) the first antibody moiety comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 241, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 242, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 243, and the VL comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 244, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 245, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 246; and b) the second antibody moiety comprises a second heavy chain variable region (VH-2) and a second light chain variable region (V L-2), wherein the VH-2 comprises a second HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, a second HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and a second HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and the VL-2 comprises a second LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, a second LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and a second LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200.

[0292] In some embodiments, the V.sub.H-2 comprises the amino acid sequence of SEQ ID NO: 202, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identify to SEQ ID NO: 202; and/or the VL-2 comprises the amino acid sequence of SEQ ID NO: 203, or a variant thereof having at least about 80% sequence identify to SEQ ID NO: 203. In some embodiments, the V.sub.H-2 comprises the amino acid sequence of SEQ ID NO: 202; and the V.sub.L-3 comprises the amino acid sequence of SEQ ID NO: 203.

[0293] In some embodiments, the anti-CD137 single chain Fv fragment is fused to the heavy chains of an anti-HER2 full length antibody, and wherein the heavy chains of the anti-HER2 full length antibody fused with the anti-CD137 single chain Fv fragment comprises an amino acid sequence of any one of SEQ ID NOs: 183, 184, 204, 205, 251, 252, 253 or 254, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the amino acid sequence of any one of SEQ ID NOs: 183, 184, 204, 205, 251, 252, 253 or 254. In some embodiments, the full length antibody comprised in the second antibody moiety comprises a light chain comprising the amino acid sequence of SEQ ID NO: 185, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the amino acid sequence of SEQ ID NO: 185.

[0294] In some embodiments, there is provided a multispecific antibody comprising: a) an anti-CD137 single chain Fv fragment disclosed herein that binds to CD137, wherein the single chain Fv fragment comprises a first heavy chain variable region (V.sub.H-1) and a first light chain variable region (V.sub.L-1), wherein the V.sub.H-1 comprises: i) an HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 141, ii) an HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 142, and iii) an HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 143, and the V.sub.L comprises: i) an LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 144, ii) an LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 145, and iii) an LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 146; and b) a full length antibody that binds to HER2 and comprising two antibody heavy chains and two antibody light chains, wherein the anti-CD137 single chain Fv fragment is fused to the heavy chains of the full length antibody, and wherein the full length antibody that binds to HER2 comprises a second heavy chain variable region (V.sub.H-2) and a second light chain variable region (V.sub.L-2), wherein: a) the V.sub.H-2 comprises an HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 186, an HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 190, and an HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 194; and b) the V.sub.L-2 comprises an LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 196, an LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 198, and an LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 200. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the C-terminus of the heavy chains of the full length antibody. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the N-terminus of the heavy chains of the full length antibody.

[0295] In some embodiments, the V.sub.H-1 comprises the amino acid sequence of SEQ ID NO: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 237 or 247, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 7, 17, 27, 37, 47, 57, 67, 77, 87, 97, 107, 117, 127, 137, 237 or 247; and/or the V.sub.L-1 comprises the amino acid sequence of SEQ ID NO: 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 238 or 248, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 8, 18, 28, 38, 48, 58, 68, 78, 88, 98, 108, 118, 128, 138, 238 or 248.

[0296] In some embodiments, the V.sub.H-2 comprises the amino acid sequence of SEQ ID NO: 202, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 202; and/or the VL-2 comprises the amino acid sequence of SEQ ID NO: 203, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 203.

[0297] In some embodiments, the V.sub.H-3 comprises the amino acid sequence of SEQ ID NO: 202, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 202; and/or the VL-3 comprises the amino acid sequence of SEQ ID NO: 203, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 203.

[0298] In some embodiments, the anti-CD137 single chain Fv fragment is fused to the heavy chains of an anti-HER2 full length antibody, and wherein heavy chains of the anti-HER2 full length antibody fused with the anti-CD137 single chain Fv fragment comprises an amino acid sequence of any one of SEQ ID NOs: 183, 184, 204, 205, 251, 252, 253 and 254, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the amino acid sequence of any one of SEQ ID NOs: 183, 184, 204, 205, 251, 252, 253 and 254. In some embodiments, the full length antibody comprised in the second antibody moiety comprises a light chain comprising the amino acid sequence of SEQ ID NO: 185, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the amino acid sequence of SEQ ID NO: 185.

[0299] In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 183, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 184, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 204, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 205, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 251, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 252, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 253, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185. In some embodiments, the multispecific antibody comprises an anti-HER2 heavy chain fused to an anti-CD137 scFv comprising the amino acid sequence set forth in SEQ ID NO: 254, and an anti-HER2 light chain comprising the amino acid sequence set forth in SEQ ID NO: 185.

[0300] In some embodiments, the V.sub.H-1 and the V.sub.L-1 of the anti-CD137 single chain Fv fragment are fused via a first linker (e.g., a first peptide linker). In some embodiments, the first linker comprises from about one to about thirty (such as about four to twenty, about three to twenty, about six to eighteen, or about ten to fifteen) amino acids. In some embodiments, the first linker is a GS linker. In some embodiments, the linker has an amino acid sequence of any one of SEQ ID Nos: 260-230. In some embodiments, the anti-CD137 single chain Fv fragment is fused to the heavy chains of the full length antibody via a second linker (e.g., a second peptide linker). In some embodiments, the second peptide linker comprises from about one to about thirty (such as about four to twenty, about three to twenty, about six to eighteen, or about ten to fifteen) amino acids. In some embodiments, the second peptide linker is a linker comprising the sequence of any one of SEQ ID NOs: 206-230.

[0301] In some embodiments, the full length antibody has an Fc region is selected from the group consisting of Fc regions from IgG, IgA, IgD, IgE, IgM, and any combinations and hybrids thereof. In some embodiments, the Fc region is selected from the group consisting of Fc regions from IgG1, IgG2, IgG3, IgG4, and any combinations and hybrids thereof. In some embodiments, the Fc region is an IgG1 Fc region. In some embodiments, the IgG1 Fc region comprises a L234A mutation and/or a L235A mutation. In some embodiments, the Fc region is an IgG4 Fc region. In some embodiments, the Fc region is an IgG2 Fc region. In some embodiments, the IgG4 Fc region comprises a S228P, F234A, and a L235A mutation.

[0302] o) Multispecific Antibody Properties

[0303] In some embodiments, the multispecific antibody described herein has improved clinical properties relative to a reference multispecific antibody binding to both CD137 and the second antigen (such as HER2, EGFR, PD-L1). In some embodiments, the multispecific antibody exhibits improved ADCC activity (such as at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, or 70% higher in ADCC-dependent cytotoxicity), compared to that of the reference multispecific antibody. In some embodiments, the multispecific antibody exhibits higher anti-tumor effects (such as reducing tumor burden or improving survival by at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, or 70% more), compared to that of the reference multispecific antibody. In some embodiments, the multispecific antibody exhibits less toxicity, compared to that of reference multispecific antibody.

[0304] In some embodiments, the multispecific antibody binds to both CD137 and a tumor associated antigen and exhibits improved ADCC activity against a tumor cell that positive or express high level of the tumor associated antigen (such as at least about 25%, 50%, 75%, 100%, 150%, 200%, 250%, 300%, 400%, 500%, 600%, 700%, 800%, 900%, 10-fold, 15-fold, 20-fold higher than the expression of the TAA on a non-tumor cell), as compared to that of the reference multispecific antibody. In some embodiments, the EC50 of the multispecific antibody specific for the cell is no more than about 50%, 40%, 30%, 20%, 10% of the reference multispecific antibody.

[0305] In some embodiments, the multispecific antibody does not induce a significant cytokine (such as IL-2, IFN-gamma, TNF-alpha) release in an individual that does not have the cancer or tumor. In some embodiments, the multispecific antibody does not induce a significant cytokine (such as IL-2, IFN-gamma, TNF-alpha) release in a non-cancerous tissues in the individual that has the cancer or tumor. In some embodiments, a significant cytokine release is a release of the cytokine with a level of at least about 70%, 60%, 50%, 40%, 30% or 20% of that induced by a reference multispecific antibody that binds to CD137 and the same second antigen. In some embodiments, the multispecific antibody induces less cytokine (such as IL-2, IFN-gamma, TNF-alpha) release (such as at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% less cytokine release) in an individual that does not have the cancer or tumor. In some embodiments, the multispecific antibody induces less cytokine (such as IL-2, IFN-gamma, TNF-alpha) release (such as at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% less cytokine release) in a non-cancerous tissues in the individual that has the cancer or tumor.

[0306] n) Tandem scFv

[0307] The multi-specific anti-CD137 molecule in some embodiments is a tandem scFv comprising a first scFv comprising an anti-CD137 antibody moiety specifically recognizing CD137 (referred to herein as “anti-CD137 scFv”) and a second scFv specifically recognizing a second antigen (also referred to herein as a “tandem scFv multi-specific anti-CD137 antibody”). In some embodiments, the tandem scFv multi-specific anti-CD137 antibody further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional scFv.

[0308] In some embodiments, there is provided a tandem scFv multi-specific (e.g., bispecific) anti-CD137 antibody comprising a) a first scFv specifically recognizing CD137, and b) a second scFv specifically recognizing a second antigen (e.g., a tumor associated antigen), wherein the tandem scFv multi-specific anti-CD137 antibody is a tandem di-scFv or a tandem tri-scFv. In some embodiments, the tandem scFv multi-specific anti-CD137 antibody is a tandem di-scFv. In some embodiments, the tandem scFv multi-specific anti-CD137 antibody is a bispecific T-cell engager. In some embodiments, the second scFv binds to a different CD137 epitope. In some embodiments, the second scFv specifically recognizes a second antigen that is not CD137. In some embodiments, the second scFv specifically recognizes a second antigen such as a tumor associated antigen. In some embodiments, the first anti-CD137 scFv is chimeric, human, partially humanized, fully humanized, or semi-synthetic. In some embodiments, the second scFv is chimeric, human, partially humanized, fully humanized, or semi-synthetic. In some embodiments, both the first and second scFvs are chimeric, human, partially humanized, fully humanized, or semi-synthetic. In some embodiments, the tandem scFv multi-specific anti-CD137 antibody further comprises at least one (such as at least about any of 2, 3, 4, 5, or more) additional scFv. In some embodiments, the first anti-CD137 scFv and the second scFv are connected by a linker (e.g., peptide linker). In some embodiments, the linker comprises the amino acid sequence of (GGGGS).sub.n, wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In some embodiments, the linker comprises the amino acid sequence of TSGGGGS. In some embodiments, the first anti-CD137 scFv is N-terminal to the second scFv. In some embodiments, the first anti-CD137 scFv is C-terminal to the second scFv. In some embodiments, the tandem scFv multi-specific (e.g., bispecific) anti-CD137 antibody further comprises a tag (e.g., a peptide tag for purification purpose). In some embodiments, the tag is N-terminal to the tandem scFv multi-specific (e.g., bispecific) anti-CD137 antibody. In some embodiments, the tag is C-terminal to the tandem scFv multi-specific (e.g., bispecific) anti-CD137 antibody. In some embodiments, the tag comprises the amino acid sequence of HHHHHH.

[0309] In some embodiments, the tandem scFv multi-specific anti-CD137 antibody is a tandem di-scFv comprising two scFvs (referred to herein as “tandem di-scFv bispecific anti-CD137 antibody”). The tandem di-scFv bispecific anti-CD137 antibody can have V.sub.H and V.sub.L assembled in any configurations, such as the configurations listed below (from N-terminus to C-terminus), wherein X is the second antigen specifically bound by the second scFv, L1, L2, and L3 are optional linkers (such as peptide linkers). See “Linkers” section for all applicable linkers. In some embodiments, the linker (L1, L2, or L3) comprises the amino acid sequence of SRGGGGSGGGGSGGGGSLEMA. In some embodiments, the linker (L1, L2, or L3) is or comprises a (GGGGS).sub.n sequence, wherein n is equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In some embodiments, the linker (L1, L2, or L3) comprises the amino acid sequence of TSGGGGS. In some embodiments, the linker (L1, L2, or L3) comprises the amino acid sequence of GEGTSTGSGGSGGSGGAD.

[0310] V.sub.L(CD137)-L1-V.sub.H(CD137)-L2-V.sub.L(X)-L3-V.sub.H(X);

[0311] V.sub.L(CD137)-L1-V.sub.H(CD137)-L2-V.sub.H(X)-L3-V.sub.L(X);

[0312] V.sub.H(CD137)-L1-V.sub.L(CD137)-L2-V.sub.L(X)-L3-V.sub.H(X);

[0313] V.sub.H(CD137)-L1-V.sub.L(CD137)-L2-V.sub.H(X)-L3-V.sub.L(X);

[0314] V.sub.L(X)-L1-V.sub.H(X)-L2-V.sub.L(CD137)-L3-V.sub.H(CD137);

[0315] V.sub.L(X)-L1-V.sub.H(X)-L2-V.sub.H(CD137)-L3-V.sub.L(CD137);

[0316] V.sub.H(X)-L1-V.sub.L(X)-L2-V.sub.L(CD137)-L3-V.sub.H(CD137);

[0317] V.sub.H(X)-L1-V.sub.L(X)-L2-V.sub.H(CD137)-L3-V.sub.L(CD137);

[0318] V.sub.L(CD137)-L1-V.sub.H(X)-L2-V.sub.L(X)-L3-V.sub.H(CD137);

[0319] V.sub.L(CD137)-L1-V.sub.L(X)-L2-V.sub.H(X)-L3-V.sub.H(CD137);

[0320] V.sub.H(CD137)-L1-V.sub.H(X)-L2-V.sub.L(X)-L3-V.sub.L(CD137);

[0321] V.sub.H(CD137)-L1-V.sub.L(X)-L2-V.sub.H(X)-L3-V.sub.L(CD137);

[0322] V.sub.L(X)-L1-V.sub.H(CD137)-L2-V.sub.L(CD137)-L3-V.sub.H(X);

[0323] V.sub.L(X)-L1-V.sub.L(CD137)-L2-V.sub.H(CD137)-L3-V.sub.H(X);

[0324] V.sub.H(X)-L1-V.sub.H(CD137)-L2-V.sub.L(CD137)-L3-V.sub.L(X); or

[0325] V.sub.H(X)-L1-V.sub.L(CD137)-L2-V.sub.H(CD137)-L3-V.sub.L(X).

[0326] o) Linkers

[0327] In some embodiments, the anti-CD137 constructs described herein comprise one or more linkers between two moieties (e.g., the anti-CD137 antibody moiety and the half-life extending moiety, the anti-CD137 scFv and the full length antibody in the bispecific antibodies described herein). The length, the degree of flexibility and/or other properties of the linker(s) used in the bispecific antibodies may have some influence on properties, including but not limited to the affinity, specificity or avidity for one or more particular antigens or epitopes. For example, longer linkers may be selected to ensure that two adjacent domains do not sterically interfere with one another. In some embodiment, a linker (such as peptide linker) comprises flexible residues (such as glycine and serine) so that the adjacent domains are free to move relative to each other. For example, a glycine-serine doublet can be a suitable peptide linker. In some embodiments, the linker is a non-peptide linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker is a cleavable linker.

[0328] Other linker considerations include the effect on physical or pharmacokinetic properties of the resulting compound, such as solubility, lipophilicity, hydrophilicity, hydrophobicity, stability (more or less stable as well as planned degradation), rigidity, flexibility, immunogenicity, modulation of antibody binding, the ability to be incorporated into a micelle or liposome, and the like.

[0329] Coupling of two moieties may be accomplished by any chemical reaction that will bind the two molecules so long as both components retain their respective activities, e.g., binding to CD137 and a second antigen in a bispecific antibody, respectively. This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation. In some embodiments, the binding is covalent binding. Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents may be useful in coupling protein molecules in this context. For example, representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines. This listing is not intended to be exhaustive of the various classes of coupling agents known in the art but, rather, is exemplary of the more common coupling agents (see Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984); Jansen et al., Immunological Reviews 62:185-216 (1982); and Vitetta et al., Science 238:1098 (1987)).

[0330] Linkers the can be applied in the present application are described in the literature (see, for example, Ramakrishnan, S. et al., Cancer Res. 44:201-208 (1984) describing use of MBS (M-maleimidobenzoyl-N-hydroxysuccinimide ester). In some embodiments, non-peptide linkers used herein include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2-pyridyldithio) propionamido] hexanoate (Pierce Chem. Co., Cat #21651G); (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6 [3-(2-pyridyldithio)-propianamide] hexanoate (Pierce Chem. Co. Cat. #2165-G); and (v) sulfo-NHS (N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510) conjugated to EDC.

[0331] The linkers described herein contain components that have different attributes, thus may lead to bispecific antibodies with differing physio-chemical properties. For example, sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NHS-ester containing linkers are less soluble than sulfo-NHS esters. Further, the linker SMPT contains a sterically hindered disulfide bond, and can form antibody fusion protein with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less antibody fusion protein available. Sulfo-NHS, in particular, can enhance the stability of carbodimide couplings. Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.

[0332] The peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence. For example, a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker. See, for example, WO1996/34103.

[0333] The peptide linker can be of any suitable length. In some embodiments, the peptide linker is at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 75, 100 or more amino acids long. In some embodiments, the peptide linker is no more than about any of 100, 75, 50, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5 or fewer amino acids long. In some embodiments, the length of the peptide linker is any of about 1 amino acid to about 10 amino acids, about 1 amino acid to about 20 amino acids, about 1 amino acid to about 30 amino acids, about 5 amino acids to about 15 amino acids, about 10 amino acids to about 25 amino acids, about 5 amino acids to about 30 amino acids, about 10 amino acids to about 30 amino acids long, about 30 amino acids to about 50 amino acids, about 50 amino acids to about 100 amino acids, or about 1 amino acid to about 100 amino acids.

[0334] An essential technical feature of such peptide linker is that said peptide linker does not comprise any polymerization activity. The characteristics of a peptide linker, which comprise the absence of the promotion of secondary structures, are known in the art and described, e.g., in Dall'Acqua et al. (Biochem. (1998) 37, 9266-9273), Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9(1), 73-80). A particularly preferred amino acid in context of the “peptide linker” is Gly. Furthermore, peptide linkers that also do not promote any secondary structures are preferred. The linkage of the domains to each other can be provided by, e.g., genetic engineering. Methods for preparing fused and operatively linked bispecific single chain constructs and expressing them in mammalian cells or bacteria are well-known in the art (e.g. WO 99/54440, Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y. 1989 and 1994 or Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001).

[0335] The peptide linker can be a stable linker, which is not cleavable by proteases, especially by Matrix metalloproteinases (MMPs).

[0336] The linker can also be a flexible linker. Exemplary flexible linkers include glycine polymers (G).sub.n, glycine-serine polymers (including, for example, (GS).sub.n, (GSGGS).sub.n, (GGGGS).sub.n, and (GGGS).sub.n, where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11 173-142 (1992)). The ordinarily skilled artisan will recognize that design of an antibody fusion protein can include linkers that are all or partially flexible, such that the linker can include a flexible linker portion as well as one or more portions that confer less flexible structure to provide a desired antibody fusion protein structure.

[0337] p) Immunoconjugate

[0338] Provided herein also include immunoconjugates comprising any of the anti-CD137 construct (such as a multispecific antibody) described herein, linked to a therapeutic agent or a label. In some embodiments, the label is selected from the group consisting of a radioisotope, a fluorescent dye and an enzyme.

[0339] q) Nucleic Acids

[0340] Nucleic acid molecules encoding the anti-CD137 constructs or anti-CD137 antibody moieties described herein are also contemplated. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding a full-length anti-CD137 antibody. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding an anti-CD137 scFv. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding an anti-CD137 Fc fusion protein. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding a multi-specific anti-CD137 molecule (e.g., a multi-specific anti-CD137 antibody or a bispecific anti-CD137 antibody), or polypeptide portion thereof. In some embodiments, the nucleic acid (or a set of nucleic acids) encoding the anti-CD137 construct described herein may further comprises a nucleic acid sequence encoding a peptide tag (such as protein purification tag, e.g., His-tag, HA tag).

[0341] Also contemplated here are isolated host cell comprising an anti-CD137 construct, an isolated nucleic acid encoding the polypeptide components of the anti-CD137 construct, or a vector comprising a nucleic acid encoding the polypeptide components of the anti-CD137 construct described herein.

[0342] The present application also includes variants to these nucleic acid sequences. For example, the variants include nucleotide sequences that hybridize to the nucleic acid sequences encoding the anti-CD137 constructs or anti-CD137 antibody moieties of the present application under at least moderately stringent hybridization conditions.

[0343] The present invention also provides vectors in which a nucleic acid of the present invention is inserted.

[0344] The nucleic acids of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties. In some embodiments, the invention provides a gene therapy vector.

[0345] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

[0346] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).

III. Methods of Preparation

[0347] In some embodiments, there is provided a method of preparing an anti-CD137 construct or antibody moiety that binds to CD137 and a composition such as polynucleotide, nucleic acid construct, vector, host cell, or culture medium that is produced during the preparation of the anti-CD137 construct or antibody moiety. The anti-CD137 construct or antibody moiety or composition described herein may be prepared by a number of processes as generally described below and more specifically in the Examples.

[0348] Antibody Expression and Production

[0349] The antibodies (including anti-CD137 monoclonal antibodies, anti-CD137 bispecific antibodies, and anti-CD137 antibody moieties) described herein can be prepared using any known methods in the art, including those described below and in the Examples.

[0350] Monoclonal Antibodies

[0351] Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translational modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Thus, the modifier “monoclonal” indicates the character of the antibody as not being a mixture of discrete antibodies. For example, the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), or may be made by recombinant DNA methods (U.S. Pat. No. 4,816,567). In the hybridoma method, a mouse or other appropriate host animal, such as a hamster or a llama, is immunized as hereinabove described to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986). Also see Example 1 for immunization in Camels.

[0352] The immunizing agent will typically include the antigenic protein or a fusion variant thereof. Generally, either peripheral blood lymphocytes (“PBLs”) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. Goding, Monoclonal Antibodies: Principles and Practice, Academic Press (1986), pp. 59-103.

[0353] Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which are substances that prevent the growth of HGPRT-deficient cells.

[0354] Preferred immortalized myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, preferred are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 cells (and derivatives thereof, e.g., X63-Ag8-653) available from the American Type Culture Collection, Manassas, Va. USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).

[0355] Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).

[0356] The culture medium in which the hybridoma cells are cultured can be assayed for the presence of monoclonal antibodies directed against the desired antigen. Preferably, the binding affinity and specificity of the monoclonal antibody can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked assay (ELISA). Such techniques and assays are known in the in art. For example, binding affinity may be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).

[0357] After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, supra). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as tumors in a mammal.

[0358] The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.

[0359] Monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567, and as described herein. DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, in order to synthesize monoclonal antibodies in such recombinant host cells. Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr. Opinion in Immunol., 5:256-262 (1993) and Pluckthun, Immunol. Revs. 130:151-188 (1992).

[0360] In a further embodiment, antibodies can be isolated from antibody phage libraries generated using the techniques described in McCafferty et al., Nature, 348:552-554 (1990). Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio Technology, 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nucl. Acids Res., 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.

[0361] The DNA also may be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison, et al., Proc. Natl Acad Sci. USA, 81:6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Typically, such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.

[0362] The monoclonal antibodies described herein may by monovalent, the preparation of which is well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and a modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues may be substituted with another amino acid residue or are deleted so as to prevent crosslinking. In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly Fab fragments, can be accomplished using routine techniques known in the art.

[0363] Chimeric or hybrid antibodies also may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins may be constructed using a disulfide-exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.

[0364] Also, see the Examples for monoclonal antibody production.

[0365] Multispecific Antibodies

[0366] Also provided here are methods of preparing the multispecific antibodies (e.g., bispecific antibody) described herein. The multispecific antibodies can be prepared using any methods known in the art or as described herein (such as in Examples 1 and 3).

[0367] Methods of preparing multispecific antibodies of the present application include those described in WO 2008119353 (Genmab), WO 2011131746 (Genmab) and reported by van der Neut-Kolfschoten et al. (Science. 2007 Sep. 14; 317(5844): 1554-7). Examples of other platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics), Fcab and Mab2 (F-star), Fc-engineered IgG1 (Xencor) or DuoBody.

[0368] Traditional methods such as the hybrid hybridoma and chemical conjugation methods (Marvin and Zhu (2005) Acta Pharmacol Sin 26: 649) can also be used. Co-expression in a host cell of two components (such as a heavy chain of anti-tumor associated antigen full length antibody and a light chain of anti-tumor associated antigen antibody fused to an anti-CD137 scFv) leads to a mixture of possible antibody products in addition to the desired bispecific antibody, which can then be isolated by, e.g., affinity chromatography or similar methods.

[0369] Nucleic Acid Molecules Encoding Antibody Moieties

[0370] In some embodiments, there is provided a polynucleotide encoding any one of the anti-CD137 constructs or antibody moieties described herein. In some embodiments, there is provided a polynucleotide prepared using any one of the methods as described herein. In some embodiments, a nucleic acid molecule comprises a polynucleotide that encodes a heavy chain or a light chain of an antibody moiety (e.g., anti-CD137 antibody moiety). In some embodiments, a nucleic acid molecule comprises both a polynucleotide that encodes a heavy chain and a polynucleotide that encodes a light chain, of an antibody moiety (e.g., anti-CD137 antibody moiety). In some embodiments, a first nucleic acid molecule comprises a first polynucleotide that encodes a heavy chain and a second nucleic acid molecule comprises a second polynucleotide that encodes a light chain. In some embodiments, a nucleic acid molecule encoding an scFv (e.g., anti-CD137 scFv) is provided.

[0371] In some such embodiments, the heavy chain and the light chain are expressed from one nucleic acid molecule, or from two separate nucleic acid molecules, as two separate polypeptides. In some embodiments, such as when an antibody is an scFv, a single polynucleotide encodes a single polypeptide comprising both a heavy chain and a light chain linked together.

[0372] In some embodiments, a polynucleotide encoding a heavy chain or light chain of an antibody moiety (e.g., anti-CD137 antibody moiety) comprises a nucleotide sequence that encodes a leader sequence, which, when translated, is located at the N terminus of the heavy chain or light chain. As discussed above, the leader sequence may be the native heavy or light chain leader sequence, or may be another heterologous leader sequence.

[0373] In some embodiments, the polynucleotide is a DNA. In some embodiments, the polynucleotide is an RNA. In some embodiments, the RNA is a mRNA.

[0374] Nucleic acid molecules may be constructed using recombinant DNA techniques conventional in the art. In some embodiments, a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell.

[0375] Nucleic Acid Construct

[0376] In some embodiments, there is provided a nucleic acid construct comprising any one of the polynucleotides described herein. In some embodiments, there is provided a nucleic acid construct prepared using any method described herein.

[0377] In some embodiments, the nucleic acid construct further comprises a promoter operably linked to the polynucleotide. In some embodiments, the polynucleotide corresponds to a gene, wherein the promoter is a wild-type promoter for the gene.

[0378] Vectors

[0379] In some embodiments, there is provided a vector comprising any polynucleotides that encode the heavy chains and/or light chains of any one of the antibody moieties described herein (e.g., anti-CD137 antibody moieties) or nucleic acid construct described herein. In some embodiments, there is provided a vector prepared using any method described herein. Vectors comprising polynucleotides that encode any of anti-CD137 constructs such as antibodies, scFvs, fusion proteins or other forms of constructs described herein (e.g., anti-CD137 scFv) are also provided. Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc. In some embodiments, a vector comprises a first polynucleotide sequence encoding a heavy chain and a second polynucleotide sequence encoding a light chain. In some embodiments, the heavy chain and light chain are expressed from the vector as two separate polypeptides. In some embodiments, the heavy chain and light chain are expressed as part of a single polypeptide, such as, for example, when the antibody is an scFv.

[0380] In some embodiments, a first vector comprises a polynucleotide that encodes a heavy chain and a second vector comprises a polynucleotide that encodes a light chain. In some embodiments, the first vector and second vector are transfected into host cells in similar amounts (such as similar molar amounts or similar mass amounts). In some embodiments, a mole- or mass-ratio of between 5:1 and 1:5 of the first vector and the second vector is transfected into host cells. In some embodiments, a mass ratio of between 1:1 and 1:5 for the vector encoding the heavy chain and the vector encoding the light chain is used. In some embodiments, a mass ratio of 1:2 for the vector encoding the heavy chain and the vector encoding the light chain is used.

[0381] In some embodiments, a vector is selected that is optimized for expression of polypeptides in CHO or CHO-derived cells, or in NSO cells. Exemplary such vectors are described, e.g., in Running Deer et al., Biotechnol. Prog. 20:880-889 (2004).

[0382] Host Cells

[0383] In some embodiments, there is provided a host cell comprising any poplypeptide, nucleic acid construct and/or vector described herein. In some embodiments, there is provided a host cell prepared using any method described herein. In some embodiments, the host cell is capable of producing any of antibody moieties described herein under a fermentation condition.

[0384] In some embodiments, the antibody moieties described herein (e.g., anti-CD137 antibody moieties) may be expressed in prokaryotic cells, such as bacterial cells; or in eukaryotic cells, such as fungal cells (such as yeast), plant cells, insect cells, and mammalian cells. Such expression may be carried out, for example, according to procedures known in the art. Exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293-6E cells; CHO cells, including CHO-S, DG44. Lec13 CHO cells, and FUT8 CHO cells; PER.C6® cells (Crucell); and NSO cells. In some embodiments, the antibody moieties described herein (e.g., anti-CD137 antibody moieties) may be expressed in yeast. See, e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments, a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the heavy chains and/or light chains of the antibody moiety. For example, in some embodiments, CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293 cells.

[0385] Introduction of one or more nucleic acids into a desired host cell may be accomplished by any method, including but not limited to, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc. Non-limiting exemplary methods are described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3.sup.rd ed. Cold Spring Harbor Laboratory Press (2001). Nucleic acids may be transiently or stably transfected in the desired host cells, according to any suitable method.

[0386] The invention also provides host cells comprising any of the polynucleotides or vectors described herein. In some embodiments, the invention provides a host cell comprising an anti-CD137 antibody. Any host cells capable of over-expressing heterologous DNAs can be used for the purpose of isolating the genes encoding the antibody, polypeptide or protein of interest. Non-limiting examples of mammalian host cells include but not limited to COS, HeLa, and CHO cells. See also PCT Publication No. WO 87/04462. Suitable non-mammalian host cells include prokaryotes (such as E. coli or B. subtillis) and yeast (such as S. cerevisae, S. pombe; or K. lactis).

[0387] In some embodiments, the antibody moiety is produced in a cell-free system. Non-limiting exemplary cell-free systems are described, e.g., in Sitaraman et al., Methods Mol. Biol. 498: 229-44 (2009); Spirin, Trends Biotechnol. 22: 538-45 (2004); Endo et al., Biotechnol. Adv. 21: 695-713 (2003).

[0388] Culture Medium

[0389] In some embodiments, there is provided a culture medium comprising any antibody moiety, polynucleotide, nucleic acid construct, vector, and/or host cell described herein. In some embodiments, there is provided a culture medium prepared using any method described herein.

[0390] In some embodiments, the medium comprises hypoxanthine, aminopterin, and/or thymidine (e.g., HAT medium). In some embodiments, the medium does not comprise serum. In some embodiments, the medium comprises serum. In some embodiments, the medium is a D-MEM or RPMI-1640 medium.

[0391] Purification of Antibody Moieties

[0392] The anti-CD137 constructs (e.g., anti-CD137 monoclonal antibodies or bispecific antibodies) may be purified by any suitable method. Such methods include, but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography. Suitable affinity ligands include the ROR1 ECD and ligands that bind antibody constant regions. For example, a Protein A, Protein G, Protein A/G, or an antibody affinity column may be used to bind the constant region and to purify an anti-CD137 construct comprising an Fc region. Hydrophobic interactive chromatography, for example, a butyl or phenyl column, may also suitable for purifying some polypeptides such as antibodies. Ion exchange chromatography (e.g. anion exchange chromatography and/or cation exchange chromatography) may also suitable for purifying some polypeptides such as antibodies. Mixed-mode chromatography (e.g. reversed phase/anion exchange, reversed phase/cation exchange, hydrophilic interaction/anion exchange, hydrophilic interaction/cation exchange, etc.) may also suitable for purifying some polypeptides such as antibodies. Many methods of purifying polypeptides are known in the art.

IV. Methods of Modulating a Cell Composition

[0393] Any anti-CD137 constructs as described herein (including any multispecific antibody) can be used in methods of modulating a cell composition (e.g., T cell composition). The methods comprise contacting the cell composition with the anti-CD137 construct. In some embodiments, contacting or at least portion of the contacting is carried out ex vivo. In some embodiments, contacting or at least portion of the contacting is carried out in vivo.

[0394] Contacting

[0395] In some embodiments, the contacting is carried out in the presence of an agent. In some embodiments, the agent binds to CD3 (e.g., an anti-CD3 antibody). In some embodiments, the agent that binds to CD28 (e.g., an anti-CD28 antibody). In some embodiments, the agent comprises both an agent that binds to CD3 and an agent that binds to CD28. In some embodiments, the agent is a cytokine (e.g., IL-2, IFNγ). In some embodiments, the agent comprises one or more agents (such as one, two three, four or five agents) selected from an agent that binds to CD3, an agent that binds to CD28, IL-2, TNF-alpha, and IFNγ. In some embodiments, the agent comprises an agent that binds to CD3 (e.g., an anti-CD3 antibody), IL-2 and IFNγ.

[0396] In some embodiments, the concentration of the agent (e.g., an anti-CD3 antibody) is at least about 0.01 μg/ml, 0.02 μg/ml, 0.03 μg/ml, 0.05 μg/ml, 0.075 μg/ml, 0.1 μg/ml, 0.125 μg/ml, 0.25 μg/ml, 0.5 μg/ml, or 1 μg/ml.

[0397] In some embodiments, the contacting is carried out for at least about 1 hours, 2 hours, 4 hours, 8 hours, or overnight. In some embodiments, the contacting is carried out for at least about 1 day, 2 days or 3 days. In some embodiments, the contacting is carried out for less than about 24 hours, 12 hours, or 8 hours. In some embodiments, the contacting is carried out for less than about 14 days, 10 days, 7 days, 5 days, or 3 days. In some embodiments, the contacting is carried out for about 0-48 hours, 1-24 hours, 2-20 hours, 4-16 hours, or 8-12 hours.

[0398] In some embodiments, the contacting is carried out at a temperature of about 0-20° C. In some embodiments, the contacting is carried out at a temperature of about 2-8° C.

[0399] Cell Composition

[0400] In some embodiments, the cell composition comprises immune cells (e.g., human immune cells). In some embodiments, the immune cells comprise T cells (e.g., enriched T cells, e.g., the cells in the composition have at least 50%, 60%, 70%, 80%, 90% or 95% T cells). In some embodiments, the T cells are enriched CD4+ T cells (e.g., the T cells in the composition have at least 50%, 60%, 70%, 80%, 90% or 95% CD4+ T cells). In some embodiments, the T cells are enriched CD8+ T cells (e.g., the T cells in the composition have at least 50%, 60%, 70%, 80%, 90% or 95% CD8+ T cells). In some embodiments, the T cells comprise regulatory T cells (Treg cells). For example the T cells comprise at least 2.5%, 5%, 7.5%, 10%, 15%, or 20% regulatory T cells. In some embodiments, the T cells are engineered T cells comprising a recombinant receptor (such as a chimeric antigen receptor). In some embodiments, the immune cells comprise NK cells (e.g., enriched NK cells, e.g., the cells in the composition have at least 50%, 60%, 70%, 80%, 90% or 95% NK cells). In some embodiments, the cells in the composition comprise cytokine-induced killer (CIK) cells. In some embodiments, the cells comprise any one or more types of immune cells such as B cells, dendritic cells or macrophages.

[0401] In some embodiments, the cells were pretreated or simultaneously treated with an agent. In some embodiments, the agent binds to CD3 (e.g., an anti-CD3 antibody). In some embodiments, the agent that binds to CD28 (e.g., an anti-CD28 antibody). In some embodiments, the agent comprises both an agent that binds to CD3 and an agent that binds to CD28. In some embodiments, the agent is a cytokine (e.g., IL-2, IFNγ). In some embodiments, the agent comprises one or more agents (such as one, two three, four or five agents) selected from an agent that binds to CD3, an agent that binds to CD28, IL-2, TNF-alpha, and IFNγ.

[0402] In some embodiments, the concentration of the agent (e.g., an anti-CD3 antibody) is at least about 0.01 μg/ml, 0.02 μg/ml, 0.03 μg/ml, 0.05 μg/ml, 0.075 μg/ml, 0.1 μg/ml, 0.125 μg/ml, 0.25 μg/ml, 0.5 μg/ml, or 1 μg/ml.

[0403] In some embodiments, the cells in the composition are to be administered to an individual following the contacting.

V. Methods of Treatments or Modulating an Immune Response in an Individual

[0404] Also provided here are methods of treating a disease or condition in an individual or modulating an immune response in an individual. The methods comprise administering any anti-CD137 construct described herein into individuals (e.g., mammals such as humans).

[0405] In some embodiments, there is provided a method of treating a disease or condition or modulating an immune response in an individual, comprising administering to the individual an effective amount of an anti-CD137 construct disclosed herein. In some embodiments, the construct is any of the multispecific antibodies as described herein.

[0406] In some embodiments, the disease or condition is a cancer. In some embodiments, the cancer is selected from the group consisting of melanoma, glioblastoma, ovarian cancer, lung cancer (e.g., NSCLC), oropharyngeal cancer, colorectal cancer, breast cancer, head and neck cancer, or leukemia (e.g., AML). In some embodiments, the individual is a human. In some embodiments, the antibody moiety is chimeric or humanized. In some embodiments, the antibody moiety is a full-length antibody. In some embodiments, the antibody moiety has an isotype selected from the group consisting of an IgG (e.g., IgG1, IgG2, IgG3, or IgG4), an IgM, an IgA, an IgD, and an IgE. In some embodiments, the effective amount of the anti-CD137 construct is about 0.005 μg/kg to about 5 g/kg of total body weight of the individual. In some embodiments, the antibody agent is administered intravenously, intraperitoneally, intramuscularly, subcutaneously, or orally.

[0407] In some embodiments, the individual is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In some embodiments, the individual is younger than about 60 years old (including for example younger than about any of 50, 40, 30, 25, 20, 15, or 10 years old). In some embodiments, the individual is older than about 60 years old (including for example older than about any of 70, 80, 90, or 100 years old). In some embodiments, the individual is diagnosed with or genetically prone to one or more of the diseases or disorders described herein (such as a cancer, an autoimmune disease or transplantation). In some embodiments, the individual has one or more risk factors associated with one or more diseases or disorders described herein.

[0408] Modulating Immune Response

[0409] In some embodiments, the modulating of immune response comprises modulating a cell population in the individual. In some embodiments, the cell population is a T cell population. In some embodiments, the cell population is dendritic cells. In some embodiments, the cell population is macrophages. In some embodiments, the cell population is B cells. In some embodiments, the cell population is NK cells. In some population, the cell population is effector T cells and/or memory T cells. In some embodiments, the cell population is effector/memory T cells defined by a phenotype of CD44high CD62L low.

[0410] In some embodiments, the modulating comprises promoting proliferation of a cell population. In some embodiments, the proliferation of the cell population after the administration of the anti-CD137 construct is increased by at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% as compared to the proliferation of the reference cells after the administration of a control construct (e.g., an antibody that does not bind to anti-CD137). In some embodiments, the proliferation of the cell population after the administration of the anti-CD137 construct is increased by at least about 1-fold, 1.2-fold, 1.5 fold, 1.7-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, or 6-fold as compared to the proliferation of the reference cells after the administration of a control construct (e.g., an antibody that does not bind to CD137).

[0411] Use of Anti-CD137 Multispecific Antibody

[0412] In some embodiments, there is provided a method of treating a disease or condition (e.g., cancer) in an individual, comprising administering to the individual an effective amount of a multispecific antibody disclosed herein.

[0413] In some embodiments, there is provided a method of treating a tumor or cancer, comprising administering to the individual an effective amount of a multispecific antibody disclosed herein.

[0414] Use of CD137×HER2 Multispecific Antibodies

[0415] In some embodiments, there is provided a method of treating a HER2+ cancer in an individual, comprising administering a CD137×HER2 multispecific antibody (such as any of the CD137×HER2 bispecific antibody described herein) into the individual.

[0416] In some embodiments, the cancer is HER2 positive. In some embodiments, the cancer is HER2.sup.high. In some embodiments, the HER2 positive cancer or HER2high cancer is selected from the group consisting of a breast cancer, gastric cancer, ovarian cancer, melanoma, head and neck cancer, ewing's sarcoma, osteosarcoma, rhabdomyosarcoma, and cervical cancer.

[0417] In some embodiments, the HER2 positive cancer or HER2high cancer is a breast cancer or a gastric cancer. In some embodiments, the HER2high cancer has an average HER2 expression comparable or higher than an NCI-N87 cell or SKBR3 cell.

[0418] In some embodiments, the HER2.sup.high cancer has an average HER2 expression of at least 50%, 75%, 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 12-fold, 15-fold, 20-fold, 25-fold, or 30-fold higher than that of an SK-Hep1 cell or MDA-MB-231 cell. In some embodiments, the cancer has an average HER2 expression (MFI) of at least about 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500. In some embodiments, the HER2.sup.high cell has an HER2 expression level comparable to (such as within about 50% to about 200%, about 67% to about 150%, about 75% to about 125% expression level of) an NCI-N87 cell or SKBR3 cell.

[0419] Disease or Condition

[0420] The anti-CD137 constructs described herein can be used for treating any disease or condition. In some embodiments, the disease or condition is an infection (such as a bacterial infection or viral infection). In some embodiments, the disease or condition is an autoimmune disorder. In some embodiments, the disease or condition is a cancer. In some embodiments, the disease or condition is transplantation.

[0421] In some embodiments, the anti-CD137 construct is used in a method for treating a cancer. Cancers that may be treated using any of the methods described herein include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. Types of cancers to be treated with the anti-CD137 constructs as described in this application include, but are not limited to, carcinoma, blastoma, sarcoma, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included. In some embodiments, the cancer is a solid tumor.

[0422] In various embodiments, the cancer is early stage cancer, non-metastatic cancer, primary cancer, advanced cancer, locally advanced cancer, metastatic cancer, cancer in remission, recurrent cancer, cancer in an adjuvant setting, cancer in a neoadjuvant setting, or cancer substantially refractory to a therapy.

[0423] Examples of cancers that may be treated by the methods of this application include, but are not limited to, anal cancer, astrocytoma (e.g., cerebellar and cerebral), basal cell carcinoma, bladder cancer, bone cancer, (osteosarcoma and malignant fibrous histiocytoma), brain tumor (e.g., glioma, brain stem glioma, cerebellar or cerebral astrocytoma (e.g., astrocytoma, malignant glioma, medulloblastoma, and glioblastoma), breast cancer, central nervous system lymphoma, cervical cancer, colon cancer, colorectal cancer, endometrial cancer (e.g., uterine cancer), esophageal cancer, eye cancer (e.g., intraocular melanoma and retinoblastoma), gastric (stomach) cancer, gastrointestinal stromal tumor (GIST), head and neck cancer, hepatocellular (liver) cancer (e.g., hepatic carcinoma and heptoma), leukemia, liver cancer, lung cancer (e.g., small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), lymphoid neoplasm (e.g., lymphoma), medulloblastoma, melanoma, mesothelioma, myelodysplastic syndromes, nasopharyngeal cancer, neuroblastoma, ovarian cancer, pancreatic cancer, parathyroid cancer, cancer of the peritoneal, pituitary tumor, lymphoma, rectal cancer, renal cancer, renal pelvis and ureter cancer (transitional cell cancer), rhabdomyosarcoma, skin cancer (e.g., non-melanoma (e.g., squamous cell carcinoma), melanoma, and Merkel cell carcinoma), small intestine cancer, squamous cell cancer, testicular cancer, thyroid cancer, tuberous sclerosis, and post-transplant lymphoproliferative disorder (PTLD).

[0424] In some embodiments, the cancer is selected from the group consisting of melanoma, glioblastoma, ovarian cancer, lung cancer (e.g., NSCLC), oropharyngeal cancer, colorectal cancer, breast cancer, head and neck cancer, or leukemia (e.g., AML).

[0425] Method of Administering the Anti-CD137 Construct

[0426] The dose of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) used for treating a disease or disorder as described herein administered into the individual may vary with the particular anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies), the mode of administration, and the type of disease or condition being treated. In some embodiments, the type of disease or condition is a cancer. In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is effective to result in an objective response (such as a partial response or a complete response). In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is sufficient to result in a complete response in the individual. In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is sufficient to result in a partial response in the individual. In some embodiments, the effective amount of anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is sufficient to produce an overall response rate of more than about any of 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 64%, 65%, 70%, 75%, 80%, 85%, or 90% among a population of individuals treated with the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies). Responses of an individual to the treatment of the methods described herein can be determined, for example, based on RECIST levels.

[0427] In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is sufficient to prolong progress-free survival of the individual. In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is sufficient to prolong overall survival of the individual. In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is sufficient to produce clinical benefit of more than about any of 50%, 60%, 70%, or 77% among a population of individuals treated with the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies).

[0428] In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) alone or in combination with a second, third, and/or fourth agent, is an amount sufficient to decrease the size of a tumor, decrease the number of cancer cells, or decrease the growth rate of a tumor by at least about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 100% compared to the corresponding tumor size, number of cancer cells, or tumor growth rate in the same subject prior to treatment or compared to the corresponding activity in other subjects not receiving the treatment (e.g., receiving a placebo treatment). Standard methods can be used to measure the magnitude of this effect, such as in vitro assays with purified enzyme, cell-based assays, animal models, or human testing.

[0429] In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is below the level that induces a toxicological effect (i.e., an effect above a clinically acceptable level of toxicity) or is at a level where a potential side effect can be controlled or tolerated when the composition is administered to the individual.

[0430] In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that is close to a maximum tolerated dose (MTD) of the composition following the same dosing regimen. In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is more than about any of 80%, 90%, 95%, or 98% of the MTD.

[0431] In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that slows or inhibits the progression of the disease or condition (for example, by at least about 5%, 10%, 15%, 20%, 30%, 40%, 50%) as compared to that of the individual not receiving the treatment. In some embodiments, the disease or condition is an autoimmune disease. In some embodiments, the disease or condition is an infection.

[0432] In some embodiments, the effective amount of the anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is an amount that reduces the side effects (autoimmune response) of a condition (e.g., transplantation) (for example, by at least about 5%, 10%, 15%, 20%, 30%, 40%, or 50%) as compared to that of the individual not receiving the treatment.

[0433] In some embodiments of any of the above aspects, the effective amount of an anti-CD137 construct (such as anti-CD137 monoclonal or bispecific antibodies) is in the range of about 0.001 μg/kg to about 100 mg/kg of total body weight, for example, about 0.005 μg/kg to about 50 mg/kg, about 0.01 μg/kg to about 10 mg/kg, or about 0.01 μg/kg to about 1 mg/kg.

[0434] In some embodiments, the treatment comprises more than one administration of the anti-CD137 constructs (such as about two, three, four, five, six, seven, eight, night, or ten administrations of anti-CD137 constructs). In some embodiments, two administrations are carried out within about a week. In some embodiments, a second administration is carried out at least about 1, 2, 3, 4, 5, 6, or 7 days after the completion of the first administration. In some embodiments, a second administration is carried out about 1-14 days, 1-10 days, 1-7 days, 2-6 days, or 3-5 days after the completion of the first administration. In some embodiments, the anti-CD137 construct is administered about 1-3 times a week (such as about once a week, about twice a week, or about three times a week).

[0435] The anti-CD137 construct can be administered to an individual (such as human) via various routes, including, for example, intravenous, intra-arterial, intraperitoneal, intrapulmonary, oral, inhalation, intravesicular, intramuscular, intra-tracheal, subcutaneous, intraocular, intrathecal, transmucosal, and transdermal. In some embodiments, the anti-CD137 construct is included in a pharmaceutical composition while administered into the individual. In some embodiments, sustained continuous release formulation of the composition may be used. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intraperitoneally. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intraperitoneally. In some embodiments, the composition is administered intramuscularly. In some embodiments, the composition is administered subcutaneously. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered orally.

[0436] Combination Therapy

[0437] This application also provides methods of administering an anti-CD137 construct into an individual for treating a disease or condition (such as cancer), wherein the method further comprises administering a second agent or therapy. In some embodiments, the second agent or therapy is a standard or commonly used agent or therapy for treating the disease or condition. In some embodiments, the second agent or therapy comprises a chemotherapeutic agent. In some embodiments, the second agent or therapy comprises a surgery. In some embodiments, the second agent or therapy comprises a radiation therapy. In some embodiments, the second agent or therapy comprises an immunotherapy. In some embodiments, the second agent or therapy comprises a hormonal therapy. In some embodiments, the second agent or therapy comprises an angiogenesis inhibitor. In some embodiments, the second agent or therapy comprises a tyrosine kinase inhibitor. In some embodiments, the second agent or therapy comprises an infectious agent.

[0438] In some embodiments, the anti-CD137 construct is administered simultaneously with the second agent or therapy. In some embodiments, the anti-CD137 construct is administered concurrently with the second agent or therapy. In some embodiments, the anti-CD137 construct is administered sequentially with the second agent or therapy. In some embodiments, the anti-CD137 construct is administered in the same unit dosage form as the second agent or therapy. In some embodiment, the anti-CD137 construct is administered in a different unit dosage form from the second agent or therapy.

[0439] In some embodiments, the second agent or therapy is an agent that binds to HER2 (e.g., trastuzumab or trastuzumab emtansine). In some embodiments, the second agent or therapy is an agent that binds to EGFR. In some embodiments, the second agent or therapy targets PD-L1 or PD-1 (e.g., an anti-PD-1 antibody). In some embodiments, the second agent is an agent that targets CTLA-4 (e.g., an anti-CTLA-4 antibody). In some embodiments, the second agent comprises T cells (e.g., CAR T cells). In some embodiments, the second agent comprises a cytokine. In some embodiments, the second agent or therapy comprises carboplatin, paclitaxel, and/or radiotherapy. In some embodiments, the second agent or therapy comprises a vaccine, such as a HPV vaccine. In some embodiments, the second agent or therapy comprises an EGFR inhibitor (e.g., cetuximab). In some embodiments, the second agent or therapy comprises an antineoplastic enzyme inhibitor (e.g., irinotecan). See Table 3 below for exemplary combination therapies.

TABLE-US-00003 TABLE 3 Exemplary combination therapies Second agent/therapy Indication Agent targeting PD-L1 orPD-1 (e.g., NSCLC, glioblastoma (e.g, anti-PD-Ll orPD-1 antibody) recurrent glioblastoma), AML Agent targeting HER2 (e.g., anti- Breast cancer (e.g, HER2 HER2 antibody) breast cancer) Agent targeting CTLA-4 (e.g, anti- Melanoma CTLA-4 antibody) Immunotherapy (e.g, T cells or Ovarian cancer cytokines) Radiotherapy NSCLC Carboplatin + paclitaxel + NSCLC radiotherapy HPV vaccine HPV-positive oropharyngeal cancer EGFR inhibitor (e.g., anti-EGFR Colorectal cancer antibody) + antineoplastic (e.g, advanced enzyme inhibitor colorectal cancer) (e.g, irinotecan)

VI. Compositions, Kits and Articles of Manufacture

[0440] Also provided herein are compositions (such as formulations) comprising any one of the anti-CD137 construct or anti-CD137 antibody moiety described herein, nucleic acid encoding the antibody moieties, vector comprising the nucleic acid encoding the antibody moieties, or host cells comprising the nucleic acid or vector.

[0441] Suitable formulations of the anti-CD137 construct described herein can be obtained by mixing the anti-CD137 construct or anti-CD137 antibody moiety having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as olyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™ PLURONICS™ or polyethylene glycol (PEG). Lyophilized formulations adapted for subcutaneous administration are described in WO97/04801. Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the individual to be imaged, diagnosed, or treated herein.

[0442] The formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.

[0443] Also provided are kits comprising any one of the anti-CD137 construct or anti-CD137 antibody moiety described herein. The kits may be useful for any of the methods of modulating cell composition or treatment described herein.

[0444] In some embodiments, there is provided a kit comprising an anti-CD137 construct binding to CD137.

[0445] In some embodiments, the kit further comprises a device capable of delivering the anti-CD137 construct into an individual. One type of device, for applications such as parenteral delivery, is a syringe that is used to inject the composition into the body of a subject. Inhalation devices may also be used for certain applications.

[0446] In some embodiments, the kit further comprises a therapeutic agent for treating a disease or condition, e.g., cancer, infectious disease, autoimmune disease, or transplantation.

[0447] The kits of the present application are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretative information.

[0448] The present application thus also provides articles of manufacture. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include vials (such as sealed vials), bottles, jars, flexible packaging, and the like. Generally, the container holds a composition, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The label or package insert indicates that the composition is used for imaging, diagnosing, or treating a particular condition in an individual. The label or package insert will further comprise instructions for administering the composition to the individual and for imaging the individual. The label may indicate directions for reconstitution and/or use. The container holding the composition may be a multi-use vial, which allows for repeat administrations (e.g. from 2-6 administrations) of the reconstituted formulation. Package insert refers to instructions customarily included in commercial packages of diagnostic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such diagnostic products. Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.

[0449] The kits or article of manufacture may include multiple unit doses of the compositions and instructions for use, packaged in quantities sufficient for storage and use in pharmacies, for example, hospital pharmacies and compounding pharmacies.

[0450] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.

TABLE-US-00004 SEQ GENE ID NO NAME AMINO ACID SEQUENCE 1. Clone 3 DTYIH VH CDR1 2. Clone 3 RIDPANGFTEYAQKFQG VH CDR2 3. Clone 3 GNLHYALMDY VH CDR3 4. Clone 3 VL KASQAINTYLS CDR1 5. Clone 3 VL RANRMVD CDR2 6. Clone 3 VL LQSDDFPYT CDR3 7. Clone 3 QVQLVQSGAEVKKPGASVKVSCKASGFNPKDTYIHWVRQA VH PGQGLEWMGRIDPANGFTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 8. Clone 3 VL DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG KAPKLLIYRANRMVDGVPSRFSGSGSGTDFTLTISSLQHEDF ATYYCLQSDDFPYTFGGGTKLEIKRTV 9. Clone 3 QVQLVQSGAEVKKPGASVKVSCKASGFNPKDTYIHWVRQA HC PGQGLEWMGRIDPANGFTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 10. Clone 3 LC DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG KAPKLLIYRANRMVDGVPSRFSGSGSGTDFTLTISSLQHEDF ATYYCLQSDDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 11. Clone 9 DTYIH VH CDR1 12. Clone 9 KIDPANGNTEYAQKFQG VH CDR2 13. Clone 9 GNLHYALMDY VH CDR3 14. Clone 9 VL KASQAIATYLS CDR1 15. Clone 9 VL RANRMYD CDR2 16. Clone 9 VL LQFDDFPYT CDR3 17. Clone 9 QVQLVQSGAEVKKPGASVKVSCKASGFNLKDTYIHWVRQA VH PGQGLEWMGKIDPANGNTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 18. Clone 9 VL DIQMTQSPSSVSASVGDRVTITCKASQAIATYLSWYQQKPG KAPKLLIYRANRMYDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQFDDFPYTFGGGTKLEIKRTV 19. Clone 9 QVQLVQSGAEVKKPGASVKVSCKASGFNLKDTYIHWVRQA HC PGQGLEWMGKIDPANGNTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 20. Clone 9 LC DIQMTQSPSSVSASVGDRVTITCKASQAIATYLSWYQQKPG KAPKLLIYRANRMYDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQFDDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT ESLNRGEC 21. Clone 23 DTYIH VH CDR1 22. Clone 23 KIDPANGQTEYAQKFQG VH CDR2 23. Clone 23 GNLHYALMDY VH CDR3 24. Clone 23 KASQAINTYLS VL CDR1 25. Clone 23 RANRMVG VL CDR2 26. Clone 23 LQYRDFPYT VL CDR3 27. Clone 23 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQA VH PGQGLEWMGKIDPANGQTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 28. Clone 23 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG VL KAPKLLIYRANRMVGGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYRDFPYTFGGGTKLEIKRTV 29. Clone 23 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQA HC PGQGLEWMGKIDPANGQTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 30. Clone 23 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG LC KAPKLLIYRANRMVGGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYRDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 31. Clone 25 DTYIH VH CDR1 32. Clone 25 RIDPANGNSEYAQKFQG VH CDR2 33. Clone 25 GNLHYGLMDY VH CDR3 34. Clone 25 KASQAINTYLS VL CDR1 35. Clone 25 RDNRKVD VL CDR2 36. Clone 25 LQYQDFPYK VL CDR3 37. Clone 25 QVQLVQSGAEVKKPGASVKVSCKASGFNIQDTYIHWVRQA VH PGQGLEWMGRIDPANGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYGLMDYWGQGTSVTVSS 38. Clone 25 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG VL KAPKLLIYRDNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYQDFPYKFGGGTKLEIKRTV 39. Clone 25 QVQLVQSGAEVKKPGASVKVSCKASGFNIQDTYIHWVRQA HC PGQGLEWMGRIDPANGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYGLMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 40. Clone 25 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG LC KAPKLLIYRDNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYQDFPYKFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 41. Clone 33 DTYIQ VH CDR1 42. Clone 33 KIDPANGNTMYAQKFQG VH CDR2 43. Clone 33 GNLHYALMDY VH CDR3 44. Clone 33 KASQTINTYLS VL CDR1 45. Clone 33 RANRMPD VL CDR2 46. Clone 33 LQYDDFPYT VL CDR3 47. Clone 33 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIQWVRQA VH PGQGLEWMGKIDPANGNTMYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 48. Clone 33 DIQMTQSPSSVSASVGDRVTITCKASQTINTYLSWYQQKPG VL KAPKLLIYRANRMPDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYDDFPYTFGGGTKLEIKRTV 49. Clone 33 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIQWVRQA HC PGQGLEWMGKIDPANGNTMYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCN VDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKG LPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 50. Clone 33 DIQMTQSPSSVSASVGDRVTITCKASQTINTYLSWYQQKPG LC KAPKLLIYRANRMPDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYDDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 51. Clone 35 DTYIH VH CDR1 52. Clone 35 RIDPANGYTEYAQKFQG VH CDR2 53. Clone 35 GNLHYALMDY VH CDR3 54. Clone 35 KASQAIATYLS VL CDR1 55. Clone 35 RANRMVD VL CDR2 56. Clone 35 LQFQDFPYT VL CDR3 57. Clone 35 QVQLVQSGAEVKKPGASVKVSCKASGFNINDTYIHWVRQA VH PGQGLEWMGRIDPANGYTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 58. Clone 35 DIQMTQSPSSVSASVGDRVTITCKASQAIATYLSWYQQKPG VL KAPKLLIYRANRMVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQFQDFPYTFGGGTKLEIKRTV 59. Clone 35 QVQLVQSGAEVKKPGASVKVSCKASGFNINDTYIHWVRQA HC PGQGLEWMGRIDPANGYTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 60. Clone 35 DIQMTQSPSSVSASVGDRVTITCKASQAIATYLSWYQQKPG LC KAPKLLIYRANRMVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQFQDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 61. Clone 5 DTYIH VH CDR1 62. Clone 5 KIDPANGNTEYAQKFQG VH CDR2 63. Clone 5 GNLHYGLMDY VH CDR3 64. Clone 5 VL KASQAINTYHS CDR1 65. Clone 5 VL RVNRMVD CDR2 66. Clone 5 VL LQYLDFPYT CDR3 67. Clone 5 QVQLVQSGAEVKKPGASVKVSCKASGFNIRDTYIHWVRQA VH PGQGLEWMGKIDPANGNTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYGLMDYWGQGTSVTVSS 68. Clone 5 VL DIQMTQSPSSVSASVGDRVTITCKASQAINTYHSWYQQKPG KAPKLLIYRVNRMVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTV 69. Clone 5 QVQLVQSGAEVKKPGASVKVSCKASGFNIRDTYIHWVRQA HC PGQGLEWMGKIDPANGNTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYGLMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 70. Clone 5 LC DIQMTQSPSSVSASVGDRVTITCKASQAINTYHSWYQQKPG KAPKLLIYRVNRMVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 71. Clone 6 DTYIH VH CDR1 72. Clone 6 KIDPANGLTEYAQKFQG VH CDR2 73. Clone 6 GNLHYALMDY VH CDR3 74. Clone 6 VL KASQAIATYLS CDR1 75. Clone 6 VL RANRMGD CDR2 76. Clone 6 VL LQYLDFPYT CDR3 77. Clone 6 QVQLVQSGAEVKKPGASVKVSCKASGFNICDTYIHWVRQA VH PGQGLEWMGKIDPANGLTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 78. Clone 6 VL DIQMTQSPSSVSASVGDRVTITCKASQAIATYLSWYQQKPG KAPKLLIYRANRMGDGVPSRFSGSGSGTDFTLTISSLLPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTV 79. Clone 6 QVQLVQSGAEVKKPGASVKVSCKASGFNICDTYIHWVRQA HC PGQGLEWMGKIDPANGLTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 80. Clone 6 LC DIQMTQSPSSVSASVGDRVTITCKASQAIATYLSWYQQKPG KAPKLLIYRANRMGDGVPSRFSGSGSGTDFTLTISSLLPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 81. Clone 17 DTYIH VH CDR1 82. Clone 17 KIDPANGQTEYAQKFQG VH CDR2 83. Clone 17 GNLHYALMDY VH CDR3 84. Clone 17 KASQATNTYLS VL CDR1 85. Clone 17 RVNRVVD VL CDR2 86. Clone 17 LQYRDFPYT VL CDR3 87. Clone 17 QVQLVQSGAEVKKPGASVKVSCKASGFCIKDTYIHWVRQA VH PGQGLEWMGKIDPANGQTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 88. Clone 17 DIQMTQSPSSVSASVGDRVTITCKASQATNTYLSWYQQKPG VL KAPKLLIYRVNRVVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYRDFPYTFGGGTKLEIKRTV 89. Clone 17 QVQLVQSGAEVKKPGASVKVSCKASGFCIKDTYIHWVRQA HC PGQGLEWMGKIDPANGQTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 90. Clone 17 DIQMTQSPSSVSASVGDRVTITCKASQATNTYLSWYQQKPG LC KAPKLLIYRVNRVVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYRDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 91. Clone 18 DTYIH VH CDR1 92. Clone 18 KIDPANGMTEYAQKFQG VH CDR2 93. Clone 18 GNLHYALMDY VH CDR3 94. Clone 18 KASQAPNTYLS VL CDR1 95. Clone 18 RANRMVD VL CDR2 96. Clone 18 LQYEDFPYT VL CDR3 97. Clone 18 QVQLVQSGAEVKKPGASVKVSCQASGFNIKDTYIHWVRQA VH PGQGLGWMGKIDPANGMTEYAQKFQGRVTVTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 98. Clone 18 DIQMTQSPSSVSASVGDRVTITCKASQAPNTYLSWYQQKPG VL KAPKLLIYRANRMVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYEDFPYTFGGGTKLEIKRTV 99. Clone 18 QVQLVQSGAEVKKPGASVKVSCQASGFNIKDTYIHWVRQA HC PGQGLGWMGKIDPANGMTEYAQKFQGRVTVTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 100. Clone 18 DIQMTQSPSSVSASVGDRVTITCKASQAPNTYLSWYQQKPG LC KAPKLLIYRANRMVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYEDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 101. Clone 19 DTYIH VH CDR1 102. Clone 19 KIDPANGATEYAQKFQG VH CDR2 103. Clone 19 GNLHYGLMDY VH CDR3 104. Clone 19 KASQAINTYLS VL CDR1 105. Clone 19 RANRMGD VL CDR2 106. Clone 19 LQSDDFPYT VL CDR3 107. Clone 19 QVQLVQSGAEVKKPGASVKVSCKASGFNMKDTYIHWVRQ VH APGQGLEWMGKIDPANGATEYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYGLMDYWGQGTSVTVSS 108. Clone 19 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG VL KAPKLLIYRANRMGDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQSDDFPYTFGGGTKLEIKRTV 109. Clone 19 QVQLVQSGAEVKKPGASVKVSCKASGFNMKDTYIHWVRQ HC APGQGLEWMGKIDPANGATEYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYGLMDYWGQGTSVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCN VDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKG LPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 110. Clone 19 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG LC KAPKLLIYRANRMGDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQSDDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 111. Clone 20 DTYIH VH CDR1 112. Clone 20 KIDPANGDTEYAQKFQG VH CDR2 113. Clone 20 GNLHYALMDY VH CDR3 114. Clone 20 KASQAINTYLS VL CDR1 115. Clone 20 RANRAVD VL CDR2 116. Clone 20 LQYLDFPYT VL CDR3 117. Clone 20 QVQLVQSGAEVKKPGASVKVSCKASGFNMKDTYIHWVRQ VH APGQGLEWMGKIDPANGDTEYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 118. Clone 20 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG VL KAPKLLIYRANRAVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTV 119. Clone 20 QVQLVQSGAEVKKPGASVKVSCKASGFNMKDTYIHWVRQ HC APGQGLEWMGKIDPANGDTEYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCN VDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKG LPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 120. Clone 20 DIQMTQSPSSVSASVGDRVTITCKASQAINTYLSWYQQKPG LC KAPKLLIYRANRAVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 121. Clone 2-9 DTYIH VH CDR1 122. Clone 2-9 RIDPANGNSEYAQKFQG VH CDR2 123. Clone 2-9 GNLHYALMDY VH CDR3 124. Clone 2-9 KASQPINTYLS VL CDR1 125. Clone 2-9 RVNRKVD VL CDR2 126. Clone 2-9 LQYLDFPYT VL CDR3 127. Clone 2-9 QVQLVQSGAEVKKPGASVKASCKASGFNIQDTYIHWVRQA VH PGQGLEWMGRIDPANGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 128. Clone 2-9 DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG VL KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTV 129. Clone 2-9 QVQLVQSGAEVKKPGASVKASCKASGFNIQDTYIHWVRQA HC PGQGLEWMGRIDPANGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 130. Clone 2-9 DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG LC KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 131. Clone 2-11 DTYIH VH CDR1 132. Clone 2-11 KIDPANGGTEYAQKFQG VH CDR2 133. Clone 2-11 GNLHYALMDY VH CDR3 134. Clone 2-11 KASQPINTYLS VL CDR1 135. Clone 2-11 RVNRKVD VL CDR2 136. Clone 2-11 LQYVDFPYT VL CDR3 137. Clone 2-11 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQA VH PGQGLEWMGKIDPANGGTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 138. Clone 2-11 DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG VL KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYVDFPYTFGGGTKLEIKRTV 139. Clone 2-11 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQA HC PGQGLEWMGKIDPANGGTEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 140. Clone 2-11 DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG LC KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYVDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 141. Consensus DTYIH VH CDR1 142. Consensus XIDPANGXTEYAQKFQG VH CDR2 143. Consensus GNLHYXLMDY VH CDR3 144. Consensus KASQXXXTYXS VL CDR1 145. Consensus RXNRXXD VL CDR2 146. Consensus LQYXDFPYT VL CDR3 147. Consensus QVQLVQSGAEVKKPGASVKVSCKASGFXXXDTYIHWVRQ VH APGQGLEWMGXIDPANGXTEYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYXLMDYWGQGTSVTVSS 148. Consensus DIQMTQSPSSVSASVGDRVTITCKASQXXXTYXSWYQQKPG VL KAPKLLIYRXNRXXDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYXDFPYTFGGGTKLEIKRTV 149. Consensus QVQLVQSGAEVKKPGASVKVSCKASGFXXXDTYIHWVRQ HC APGQGLEWMGKIDPANGXTEYAQKFQGRVTMTRDTSTSTV YMELSSLRSEDTAVYYCTTGNLHYXLMDYWGQGTSVTVSS ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCN VDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKG LPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 150. Consensus DIQMTQSPSSVSASVGDRVTITCKASQXXXTYXSWYQQKPG LC KAPKLLIYRXNRXXDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYXDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 151. 29.39/44.21 DTYIH VH CDR1 152. 3.10 VH TYDVS CDR1 153. 30.19/6.62 DYSIH VH CDR1 154. 29.39/44.21 KIDPANGNTEYDLNFQG VH CDR2 155. 3.10 VH VIWTGGGTNYNSTFMS CDR2 156. 30.19/6.62 WMNTETGEPAYADDFKG VH CDR2 157. 29.39/ GNLHYYLMDY 44.21 VH CDR3 158. 3.10 VH VDY CDR3 159. 30.19/6.62 SSYGYFDY VH CDR3 160. 29.39/ KASQAINTYLS 30.19 VL CDR1 161. 6.62 VL RS SQTLEHINGNTYLE CDR1 162. 44.21 VL RSSQSLVHSNGNTYLH CDR1 163. 3.10 VL RSSQSLVHNNGNTYLH CDR1 164. 29.39/ RANRMVD 30.19 VL CDR2 165. 6.62 VL KVSDRFS CDR2 166. 44.21/3.10 KVSNRFS VL CDR2 167. 29.39/ LQYDDFPYT 30.19 VL CDR3 168. 6.62 VL FQGSHFPLT CDR3 169. 44.21/3.10 SQNAHVPWT VL CDR3 170. 29.39/ EVKLMESGAELVKPGASVKLSCTASGFNIKDTYIHWVKQRP 44.21 VH EQGLEWIGKIDPANGNTEYDLNFQGRATITADTSSNTAYLQ LSSLTSEDTAVYYCTTGNLHYYLMDYWGQGTSVTSLE 171. 30.19/6.62 QIQLVQSGPELKKPGETVKISCKASGYSFTDYSIHWVKQAPG VH KGLKWMGWMNTETGEPAYADDFKGRFAFSLETAASTAYL QINHLRDEDTATYFCTRSSYGYFDYWGQGTTLTVSS 172. 3.10 VH EVQLVESGPGLVAPSQSLSITCTVSGFSLTTYDVSWIRQPPG KGLEWLGVIWTGGGTNYNSTFMSRLTISKDNSKNQVFLKM NSLQTDDTATYYCVRVDYWGQGTTLTVSR 173. 29.39/ DIVMTQSPSSMYASLGERVTITCKASQAINTYLSWFQQKPG 30.19 VL KSPKTLIYRANRMVDGVPSRFSGSGSGQDYSLTISSLDYED MGIYYCLQYDDFPYTFGGGTKLEIKR 174. 6.62 VL DVVMTQTPLSLPVSLGDQAAISCRSSQTLEHINGNTYLEWY LQKPGQSPKLLIYKVSDRFSGVPDRFSGSGSGTGFTLKISRVE AEDLGVYYCFQGSHFPLTFGGGTKLELK 175. 3.10 VL DVVMTQTPLSLPVSLGGHASISCRSSQSLVHNNGNTYLHWF LQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYFCSQNAHVPWTFGGGTKLEIKR 176. 44.21 VL DIVMTQTPLSLPVSLGDHASISCRSSQSLVHSNGNTYLHWFL QKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYFCSQNAHVPWTFGGGTKRKSNE 177. Consensus GFX.sub.1X.sub.2X.sub.3DTYI X.sub.4 humanized wherein X.sub.1 = N or C; X.sub.2 = I, P, L or M;  29.39 VH X.sub.3 = K, N, R, C or Q; X.sub.4 = H or Q CDR1 178. Consensus X.sub.1IDPANGX.sub.2x.sub.3x.sub.4 humanized wherein X.sub.1 = K or R; X.sub.2 = N, G, F, Y, A, D,  29.39 VH L, M or Q; X = S or T; X.sub.4 = E or M. CDR2 179. Consensus GNLHYX.sub.1LMD humanized wherein X.sub.1 = Y, A or G. 29.39 VH CDR3 180. Consensus KASQX.sub.1X.sub.2X.sub.3TYX.sub.4S humanized wherein X.sub.1 = A, P, or T; X.sub.2 = I, T, or P;  29.39 VL X.sub.3 = N or A; X.sub.4 = L, G or H. CDR1 181. Consensus RX.sub.1NRX.sub.2X.sub.3X.sub.4 humanized wherein X.sub.1 = A, Y, V, or D; X.sub.2 = M, K, V, or A;  29.39 VL X.sub.3 = V, P, Y or G; X.sub.4 = D or G. CDR2 182. Consensus LQX.sub.1X.sub.2DFPYX.sub.3 humanized wherein X.sub.1 = Y, S, or F; X.sub.2 = D, V, L, R, E or  29.39 VL Q; X.sub.3 = T or K. CDR3 183. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC-anti- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ CD137 MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS scFv-IgG4- ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN PAA SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN (HCC) VDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS RLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKG SGGSGGSGGSGDIQMTQSPSSVSASVGDRVTITCKASQPINT YLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIKRGGGGSG GGGSGGGGSGGGQEQLVQSGAEVKKPGASVKASCKASGFN IQDTYIHWVRQAPGQGLEWMGRIDPANGNSEYAQKFQGRV TMTRDTSTSTVYMELSSLRSEDTAVYYCTTGNLHYALMDY WGQGTSVTVSS 184. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC-anti- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ CD137 MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS scFv-IgG1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW (HCC) NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GKGSGGSGGSGGSGDIQMTQSPSSVSASVGDRVTITCKASQ PINTYLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSGSGSG TDFTLTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIKRGG GGSGGGGSGGGGSGGGQEQLVQSGAEVKKPGASVKASCK ASGFNIQDTYIHWVRQAPGQGLEWMGRIDPANGNSEYAQK FQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCTTGNLHY ALMDYWGQGTSVTVSS 185. Anti-HER2 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPG LC KAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFAT YYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKS GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS FNRGEC 186. Anti-HER2 DTYIH CDR-H1 (Kabat) 187. Anti-HER2 GFNIKDT CDR-H1 (Chothia) 188. Anti-HER2 GFNIKDTYIH CDR-H1 (AbM) 189. Anti-HER2 KDTYIH CDR-H1 (Contact) 190. Anti-HER2 RIYPTNGYTRYADSVKG CDR-H2 (Kabat) 191. Anti-HER2 PTNGY CDR-H2 (Chothia) 192. Anti-HER2 RIYPTNGYTR CDR-H2 (AbM) 193. Anti-HER2 WVARIYPTNGYTR CDR-H2 (Contact) 194. Anti-HER2 WGGDGFYAMDY CDR-H3 (Kabat/Abm/ Chothia) 195. Anti-HER2 SRWGGDGFYAMD CDR-H3 (Contact) 196. Anti-HER2 RASQDVNTAVA CDR-L1 (Kabat/Abm/ Chothia) 197. Anti-HER2 NTAVAWY CDR-L1 (Contact) 198. Anti-HER2 SASFLYS CDR-L2 (Kabat/Abm/ Chothia) 199. Anti-HER2 LLIYSASFLY CDR-L2 (Contact) 200. Anti-HER2 QQHYTTPPT CDR-L3 (Kabat/Abm/ Chothia) 201. Anti-HER2 QQHYTTPP CDR-L3 (Contact) 202. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP VH GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS 203. Anti-HER2 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPG VL KAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFAT YYCQQHYTTPPTFGQGTKVEIKR 204. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ (GRPGS)4- MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS anti-CD137 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN scFv-IgG4 SGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTKTYTCN (HCC) VDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHN AKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSR LTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKGR PGSGRPGSGRPGSGRPGSDIQMTQSPSSVSASVGDRVTITCK ASQPINTYLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIKR GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGA EVKKPGASVKASCKASGFNIQDTYIHWVRQAPGQGLEWMG RIDPANGNSEYAQKFQGRVTMTRDTSTSTVYMELSSLRSED TAVYYCTTGNLHYALMDYWGQGTSVTVSS 205. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ (GRPGS)4- MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS anti-CD137 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN scFv-IgG4- SGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTKTYTCN PAA VDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPSVFLFPP (HCC) KPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS RLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKG RPGSGRPGSGRPGSGRPGSDIQMTQSPSSVSASVGDRVTITC KASQPINTYLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSG SGSGTDFTLTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIK RGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSG AEVKKPGASVKASCKASGFNIQDTYIHWVRQAPGQGLEWM GRIDPANGNSEYAQKFQGRVTMTRDTSTSTVYMELSSLRSE DTAVYYCTTGNLHYALMDYWGQGTSVTVSS 206. Exemplary GGGGSGGGGSGGGGS linker (Linker 7) 207. Exemplary GGGSG linker 208. Exemplary GSGGSGGSGGSG linker 209. Exemplary GGSGGGSG linker 210. Exemplary GGSGGGSGGGSG linker 211. Exemplary GSGGSG linker 212. Exemplary GSGGSGGSG linker 213. Exemplary GSGSGSG linker 214. Exemplary GGGGSGGGGSGGGGSGGG linker 215. Exemplary GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS linker 216. Exemplary PAPAP linker (Linker 10) 217. Exemplary IKRTVAA linker 218. Exemplary VSSASTK linker 219. Exemplary AEAAAKA linker 220. Exemplary AEAAAKEAAAKA linker 221. Exemplary GRPGS GRPGS linker 222. Exemplary GRPGS GRPGS GRPGS GRPGS linker 223. Exemplary GRGGS GRGGS linker 224. Exemplary GRGGS GRGGS GRGGS GRGGS linker 225. Exemplary GKPGS GKPGS linker 226. Exemplary GKPGS GKPGS GKPGS GKPGS linker 227. Exemplary GEPGS GEPGS linker 228. Exemplary GEGGS GEGGS GEGGS GEGGS linker 229. Exemplary GDPGS GDPGS linker 230. Exemplary GDPGS GDPGS GDPGS GDPGS linker 231. Clone  DTYIH 2-9-1 VH CDR1 232. Clone  RIDPASGNSEYAQKFQG 2-9-1 VH CDR2 233. Clone  GNLHYALMDY 2-9-1 VH CDR3 234. Clone  KASQPINTYLS 2-9-1 VL CDR1 235. Clone  RVNRKVD 2-9-1 VL CDR2 236. Clone  LQYLDFPYT 2-9-1 VL CDR3 237. Clone  QVQLVQSGAEVKKPGASVKASCKASGFNIQDTYIHWVRQA 2-9-1 VH PGQGLEWMGRIDPASGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 238. Clone 2-9- DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG 1 VL KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTV 239. Clone 2-9- QVQLVQSGAEVKKPGASVKASCKASGFNIQDTYIHWVRQA 1 HC PGQGLEWMGRIDPASGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVEHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 240. Clone 2-9- DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG 1 LC KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 241. Clone 2-9- DTYIH 2 VH CDR1 242. Clone 2-9- RIDPASGNSEYAQKFQG 2 VH CDR2 243. Clone 2-9- GNLHYALMDY 2 VH CDR3 244. Clone 2-9- KASQPINTYLS 2 VL CDR1 245. Clone 2-9- RVNRKVD 2 VL CDR2 246. Clone 2-9- LQYLDFPYT 2 VL CDR3 247. Clone 2-9- QVQLVQSGAEVKKPGASVKVSCKASGFNIQDTYIHWVRQA 2 VH PGQGLEWMGRIDPASGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSS 248. Clone 2-9- DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG 2 VL KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTV 249. Clone 2-9- QVQLVQSGAEVKKPGASVKVSCKASGFNIQDTYIHWVRQA 2 HC PGQGLEWMGRIDPASGNSEYAQKFQGRVTMTRDTSTSTVY MELSSLRSEDTAVYYCTTGNLHYALMDYWGQGTSVTVSSA STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNV DHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNA KTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 250. Clone 2-9- DIQMTQSPSSVSASVGDRVTITCKASQPINTYLSWYQQKPG 2 LC KAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTLTISSLQPEDF ATYYCLQYLDFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC 251. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC-anti- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ CD137-1 MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS scFv-IgG4 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN (HCC) SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN VDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHN AKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSR LTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKGS GGSGGSGGSGDIQMTQSPSSVSASVGDRVTITCKASQPINTY LSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSGSGSGTDFTL TISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIKRGGGGSGG GGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGA SVKASCKASGFNIQDTYIHWVRQAPGQGLEWMGRIDPASG NSEYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCT TGNLHYALMDYWGQGTSVTVSS 252. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC-anti- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ CD137-1 MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS scFv-IgG4- ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN PAA SGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTKTYTCN (HCC) VDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS RLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKG SGGSGGSGGSGDIQMTQSPSSVSASVGDRVTITCKASQPINT YLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSGSGSGTDFT LTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIKRGGGGSG GGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPG ASVKASCKASGFNIQDTYIHWVRQAPGQGLEWMGRIDPAS GNSEYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYY CTTGNLHYALMDYWGQGTSVTVSS 253. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ (GRPGS)4- MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS anti- ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN CD137-2 SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN scFv-IgG4 VDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPK (HCC) PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHN AKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSR LTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKGR PGSGRPGSGRPGSGRPGSDIQMTQSPSSVSASVGDRVTITCK ASQPINTYLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIKR GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGA EVKKPGASVKVSCKASGFNIQDTYIHWVRQAPGQGLEWMG RIDPASGNSEYAQKFQGRVTMTRDTSTSTVYMELSSLRSED TAVYYCTTGNLHYALMDYWGQGTSVTVSS 254. Anti-HER2 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP HC- GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQ (GRPGS)4- MNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS anti- ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN CD137-2 SGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTKTYTCN scFv-IgG4- VDHKPSNTKVDKRVESKYGPPCPPCPAPEAAGGPSVFLFPP PAA KPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH (HCC) NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS RLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKG RPGSGRPGSGRPGSGRPGSDIQMTQSPSSVSASVGDRVTITC KASQPINTYLSWYQQKPGKAPKLLIYRVNRKVDGVPSRFSG SGSGTDFTLTISSLQPEDFATYYCLQYLDFPYTFGGGTKLEIK RGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSG AEVKKPGASVKVSCKASGFNIQDTYIHWVRQAPGQGLEWM GRIDPASGNSEYAQKFQGRVTMTRDTSTSTVYMELSSLRSE DTAVYYCTTGNLHYALMDYWGQGTSVTVSS

EXAMPLES

[0451] The examples below are intended to be purely exemplary of the application and should therefore not be considered to limit the application in any way. The following examples and detailed description are offered by way of illustration and not by way of limitation.

Example 1: Generation of Anti-CD137 Antibodies

[0452] A. Generating anti-CD137 antibodies from mouse hybridomas Fully human monoclonal antibodies to the human CD137 (4-1BB) receptor were generated in the BALB/c mice. BALB/c mice were immunized with the extracellular domain of human CD137 in RIBI adjuvant (Ribi Immunochemical). Prior to fusion, mice were boosted intravenously (i.v.) with the same amount of antigen. Lymph nodes from immunized mice with adequate titers of antibodies to huCD137 were fused to mouse myeloma cells following standard procedures.

[0453] Hybridoma screening. Detection of binding to huCD137 by ELISA: To identify hybridomas secreting anti-human CD137 antibodies, ELISA plates (Corning) were coated with human CD137-Fc fusion protein at 1 μg/ml in PBS overnight at 4° C. The plates were then washed 3 times with PBS with 0.5% Tween-20 (PBS-T), and subsequently blocked with PBS-T plus 5% milk, for 60 min at room temperature. Thirty microliters of supernatants diluted 1:3 in PBS were added to the plates and incubated for 1-2 hour at ambient temperature. Afterwards, the plates were washed as before, and binding of antibodies was detected through Horseradish peroxidase (HRP)-conjugated goat F(ab′).sub.2 anti-human IgG. The plates were developed with TMB and read at 450 nm. The amino acid sequences of top anti-CD137 hybridoma antibodies (clone #29.39, 44.21, 3.10, 30.19 and 6.62) identified from the screening are shown in the SEQUENCE TABLE (SEQ ID NOS: 151-176) and Table 4.

TABLE-US-00005 TABLE 4 Hybridoma anti-CD137 antibody sequence table HC- HC- HC- LC- LC- LC- CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 Clone (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID Name NO) NO) NO) NO) NO) NO) 29.39 151 154 157 160 164 167 44.21 151 154 157 162 166 169 3.10 152 155 158 163 166 169 30.19 153 156 159 160 164 167 6.62 153 156 159 161 165 168

[0454] B. Humanization of Anti-CD137 Antibodies

[0455] One representative clone 29.39 was selected for humanization of the framework. Briefly, Igblast was performed using the sequences of the clone to search database of human germline genes. Ideal germline sequences were selected, and mutations of framework sequences were made to change the framework sequences from mouse sequences to human sequences. For heavy chain, human germline IGHV1-46*01 was used, and the following mutations were made on framework: E1Q, K3Q, MSV, E6Q, L11V, 20V, T23K, K38R, R40A, E42G, I48M, D60A, L61Q, N62K, A67V, I69M, A71R, S75T, N76S, A78V, L80M, Q81E, T83R, S111V, L112S, and E113S. For light chain, human germline IGKV1-12*01 was used, and the following mutations were made on framework: V3Q, M11V, Y12S, L15V, E17D, F36Y, S43A, T46L, Q69T, Y71F, S72T, D79Q, Y80P, M83F, G84A, and 185T. The constructs were cloned into expression vectors, and antibody proteins were produced by SS320 cells.

[0456] C. Affinity Maturation, Selection & Modification

[0457] Affinity maturation was performed for the humanized 29.39 clone. Primers for making single mutation of amino acid for each CDR region were designed. A library of mutations was prepared using assembly PCR and cloned into phagemid vectors. Library quality was measured by transformation of TG1 cells and DNA sequencing of clones. Phage production was carried out using helper phages, and phage panning was performed using streptavidin-coupled Dynabeads coated with biotinylated human-CD137 ECD or cynomolgus-CD137 ECD. After three round of panning, elution of panning products was used to infect SS320 cells, and colonies were picked and cultured in 2YT medium with IPTG. Binding affinities of Fab in supernatants were examined by ELISA assays. Positive clones against human- & cynomolgus-CD137 were selected. The top 14 binders (Clone #3, 9, 23, 25, 33, 35, 5, 6, 17, 18, 19, 20, 2-9 and 2-11) and their CDRs (Kabat), VHs, VLs, heavy chains (HCs) and light chains (LCs) are shown in the SEQUENCE TABLE (SEQ ID NOS: 1-140). Consensus sequences of these CDRs (Kabat with modification), VHs, VLs, heavy chains (HCs) and light chains (LCs) are shown in the SEQUENCE TABLE (SEQ ID NOS: 141-150). Furthermore, subclones of 2-9 were generated, which comprises different IgG isotypes. Their CDRs (Kabat), VHs, VLs, heavy chains (HCs) and light chains (LCs) are shown in the SEQUENCE TABLE (SEQ ID NOS: 231-250).

Example 2: Characterization of Exemplary Anti-CD137 Antibodies

[0458] A. Affinity Assessment

[0459] Biolayer interferometry was used to measure the association and dissociation constants for the binding kinetics of the anti-CD137 antibodies. The binding kinetics was measured on a FortieBio Octet Red 96 at 30° C. and analyzed with the FortieBio Data Analysis 9.0 software. Anti-human-IgG Fc (AHC) sensor was used to capture the anti-CD137 antibodies or control antibodies. A kinetic buffer only well was set as a reference well for subtraction during data processing. Data were fitted with a 1:1 Langmuir model for association and dissociation using Rmax linked global fitting for each antibody-antigen binding. Human CD137-his is a recombinant CD137 antigen with a poly histidine tag fused to C-terminus of human CD137 antigen (Sino Biological, 10041-H08H). Cyno CD137-his is a recombinant CD137 antigen with a poly histidine tag fused to C-terminus of cynomolgus CD137 antigen (Sino Biological, 90847-K02H-100).

[0460] As shown in FIGS. 1A-1B and Table 5 below, anti-CD137 clone 2-9 IgG2 effectively binds to human CD137 and cynomolgus monkey CD137 with a KD of 0.933 nM and 2.76 nM respectively. Assays using mouse CD137 did not show effective binding (data not shown).

TABLE-US-00006 TABLE 5 Binding affinities of exemplary anti-CD137 monoclonal antibody Samples Antigen Kd (M) Kon (1/Ms) Koff (1/s) Anti-CD137 Human CD137-his 9.33E−10 9.31E+04 8.69E−04 2-9 IgG2 Anti-CD137 Cyno CD137-his 2.76E−09 2.58E+05 7.12E−04 2-9 IgG2

[0461] FIGS. 1C-1D and Table 6 below show the binding results of another round of Octect binding assay for anti-CD137 clones, where 2-9 IgG2 and 2-9-1 IgG1 SELF effectively bind to human CD137 with a KD of 5.50 nM and 6.55 nM, respectively. The results demonstrated that clones 2-9 IgG2 and 2-9-1 IgG1 SELF had similar binding affinity to human CD137.

TABLE-US-00007 TABLE 6 Binding affinities of exemplary anti-CD137 monoclonal antibody Samples Antigen Kd(M) Kon (1/Ms) Koff(1/s) 2-9 IgG2 Human CD137-his 5.50E−09 5.71E+04 3.14E−04 2-9-1 IgG1 SELF Human CD137-his 6.55E−09 5.20E+04 3.40E−04

[0462] The Octet binding assay was also performed to compare the binding affinity of clones 2-9-1 IgG1 SELF and 2-9-2 IgG4. As shown in FIGS. 1E-1F and Table 7 below, anti-CD137 clones 2-9-1 IgG1 SELF and 2-9-2 IgG4 effectively binds to human CD137 with a KD of 11.1 nM and 12.9 nM, respectively. The results demonstrated that clones 2-9-1 IgG1 SELF and 2-9-2 IgG4 had similar binding affinity to human CD137.

TABLE-US-00008 TABLE 7 Binding affinities of exemplary anti-CD137 monoclonal antibody Samples Antigen Kd(M) Kon (1/Ms) Koff(1/s) 2-9-1 IgG1 SELF Human CD137-his 1.11E−08 5.41E+04 6.00E−04 2-9-2 IgG4 Human CD137-his 1.29E−08 6.22E+04 8.01E−04

[0463] B. CD137 Reporter Assay

[0464] Currently, there are several existing anti-CD137 antibodies in clinical ongoing. However, these antibodies are either associated with safety concerns or lack of efficacy. For example, urelumab, a strong agonist antibody to CD137 in Phase II clinical trial, is very effective in activating CD137, but causes severe liver toxicity at a low dose (≥1 mg/kg) due to its ability to activate CD137 signaling without crosslinking or clustering of the antibody/antigen complex. (Segal N H, et al. Clin Cancer Res. 2017 Apr. 15; 23(8):1929-1936). Another existing anti-CD137 antibody, Utomilumab (PF-05082566), a weak agonist antibody to CD137 also in Phase II clinical trial, was shown to be safe at up to 10 mg/kg but demonstrated limited efficacy in clinical trial. (Tolcher A W et al. Clin Cancer Res. 2017 Sep. 15; 23(18):5349-5357). Based on these findings, the next-generation of anti-CD137 monoclonal antibody should achieve high CD137 activation only specifically at tumor site. To select anti-CD137 antibodies that exhibit low toxicity and high efficacy, two reference antibodies were used for comparison. Reference Ab 1 was synthesized in-house based on the Urelumab sequences disclosed in U.S. Pat. No. 7,288,638. Reference Ab 2 was synthesized in-house based on the Utomilumab sequences disclosed in International Publication No. WO 2012/032433.

[0465] The CD137 agonist activity of the anti-CD137 monospecific antibodies described in Example 1 was first evaluated in reporter assays. The NF-κB reporter cell line was established by stably transfected with CD137 in 293T cells and NF-κB Luciferase reporter gene. The FcγRIIB 293F cells was established by stably transfected with FcγRIIB in 293F cells. In this assay, FcγRIIB transfected 293F cells were used to mimic the monocytes and macrophage, which express high level of FcγRIIB, an inhibitory Fcγ receptor, and which are concentrated in tumor microenvironment but not peripheral tissues. The NF-κB reporter and CD137 double transfected reporter cell line 293T was used to mimic the T cells, which express CD137 on its surface and express NF-κB for downstream signaling. Therefore, co-culture of the CD137/NF-κB reporter cells with the FcγRIIB 293F cells mimics T cells in tumor microenvironment, whereas CD137/NF-κB reporter cells cultured alone mimics T cells in peripheral tissues.

[0466] The two reference antibodies used in this reporter system, reference antibody 1 represents Urelumab, which showed strong activity but also liver toxicity. Reference antibody 2 represents Utomilumab, which showed weak activity but no liver toxicity. The two references were used here to evaluate the activities as well as the potential safety profiles of the anti-CD137 clones.

[0467] Culture condition followed ATCC recommended medium and condition. FcγRIIB 293F cells was seeded into a 96-well plate for overnight. 60,000 cells per well per 100 ul medium were used for seeding. In certain experiments, mock 293F cells were seeded in 96 well plate in order to see the antibody effect without FcγRIIB cross-linking. On the second day, antibodies were added at a series of concentrations for 20 min at 37° C. 120,000 293T reporter cells were then added into to the FcγRIIB 293T cells in DMEM medium (HyClone, Cat No. 16777-200). Negative controls were provided in the form of samples without antibody treatment and/or without cross-linking or effector cells. Five hours later, luciferase activity was measured using Bright-Glo™ Luciferase Assay System (Promega, Cat No. E2610) following manufacturer protocol.

[0468] The results showed a dose-dependent luciferase activity in the presence of anti-CD137 monoclonal antibodies. FIG. 2A shows CD137/NF-κB reporter cells alone treated with the antibodies, mimicking the CD137 activation in peripheral tissues, where inhibitory receptor FcγRIIB is not highly expressed and cannot bind to the Fc regions of the antibodies to facilitate cross-linking/CD137 clustering.

[0469] FIG. 2B shows CD137/NF-κB reporter cells cultured with FcγRIIB 293F cells and treated with the antibodies, mimicking the CD137 activation in tumor site where inhibitory receptor FcγRIIB is highly expressed.

[0470] Reference Ab 1, a strong CD137 agonist, showed NF-κB activation with or without FcγRIIB mediated cross-linking/CD137 clustering, indicating that this reference antibody can activate CD137 signaling in peripheral tissues and cause peripheral toxicity. Reference antibody 2, a weak CD137 agonist, showed NF-κB activation only with FcγRIIB mediated cross-linking/CD137 clustering, consistent with this reference antibody's better safety profile in clinical trial. In FIG. 2A, the anti-CD137 mAbs disclosed here behaved similarly to Reference antibody 2, indicating relatively safe clinical profile compared to Reference Ab 1. In FIG. 2B, the anti-CD137 mAbs showed stronger immune activation compared to Reference Ab 2, indicating better therapeutic efficacy compared to Reference Ab 2. In particular, clone 2-9 showed almost no activity without FCγRIIB mediated cross-linking/CD137 clustering while exhibited a superior activity with FcγRIIB mediated cross-linking/CD137 clustering.

[0471] C. CD137 Reporter Assay with Anti-CD137 Antibodies with Fc Modifications

[0472] Recent publications showed that human IgG hinge and Fc can impact therapeutic antibody functions, especially for agonistic antibodies. For example, enhanced FcγIIB binding through Fc mutations can potentiate agonistic antibody function. It appeared that in vivo FcγRIIB binding through Fc region can mediate CD137 clustering, thus induce strong downstream signaling in target cells. (White A L et al. Cancer Immunol Immunother. 2013 May; 62(5):941-8). Publications also highlighted that the conformation and flexibility of IgG2 Fc hinge region may affect agonistic activity for immune-costimulatory antibodies, such as anti-CD40 antibodies and anti-CD137 antibodies (White A L et al. Curr Top Microbiol Immunol. 2014; 382:355-72). Based on those findings, it was hypothesized that anti-CD137 mAb IgG1 and IgG2 with Fc mutations to enhance FcγRIIB binding may improve efficacy compared to other isotypes, such as IgG2 wildtype. In addition, with higher expression of FcγRIIB in tumor site, this Fc engineered CD137 monoclonal antibody may keep low peripheral toxicity while induce higher efficacy at the tumor site.

[0473] Accordingly, the CD137 agonist activity of the anti-CD137 monoclonal antibodies with Fc mutations to enhance FcγRIIB binding (S267E/L328F) (Chu S Y et al. Mol Immunol. 2008 September; 45(15):3926-33) were evaluated in the reporter assay and compared to parental IgG2 wildtype antibody.

[0474] Additionally, IgG4 isoform is known to have reduced effector binding, which may reduce peripheral toxicity while induce antitumor efficacy at the tumor site. Accordingly, the anti-CD137 monoclonal antibodies were also tested in IgG4 isoform.

[0475] The results showed a dose-dependent luciferase activity in the presence of anti-CD137 monoclonal antibodies. As shown in FIG. 3A, all 2-9 clones (with or without Fc mutation) showed no activity without FCγRIIB mediated cross-linking/CD137 clustering, indicating safe clinical profile. FIG. 3B shows NF-κB reporter signal with FcγRIIB mediated cross-linking/CD137 clustering, mimicking the CD137 activation in tumor site where inhibitory receptor FcγRIIB is highly expressed. Clone 2-9 IgG1 SELF and IgG2 SELF showed higher CD137 activation compared to IgG2 wildtype parental antibody, indicating enhanced CD137 activation through enhanced FCγRIIB binding. FIG. 3C shows NF-κB reporter signal comparing 2-9-1 IgG1 SELF and 2-9-2 IgG4 with FcγRIIB mediated cross-linking/CD137 clustering. Both clones showed high CD137 activation, and 2-9-1 IgG1 SELF showed higher activity compared to 2-9-2 IgG4.

[0476] D. Cytokine Release Assay

[0477] Human peripheral blood mononuclear cells (PBMCs) were then used to test the cytokine release effects of the anti-CD137 mAbs. PBMCs contain CD137 positive T cells and NK cells, which are the target cells of the anti-CD137 monoclonal antibodies, and the FcγRIIB expressing monocytes and macrophages were also present in the PBMC. Once T cells were activated by anti-CD137 antibodies, anti-tumor cytokines such as IFN-7 or IL-2 were secreted as an indication for anti-tumor efficacy. The two reference antibodies were used in this reporter system as described above to evaluate the activities of the anti-CD137 clones.

[0478] Human PBMCs were isolated using Ficoll-Paque® PLUS (Cat. No. 17-1440-02, GE Healthcare). Anti-CD3 antibody (OKT3) 1 ug/ml and serial dilution of anti-CD137 mAbs were added into PBMCs in Gibco RPMI medium 1640 (Cat. No. A1049101, Thermo Fischer). 48 hour later, media were collected, and IFNγ and IL2 levels were determined using ELISA method (Human IFN-7 ELISA MAX™ Deluxe, Cat. No. 430106, BioLegend; Human IL2 ELISA MAX™ Deluxe, Cat. No. 421601, BioLegend).

[0479] As shown in FIG. 4A, a dose-dependent secretion of IFNγ by the effector cells (i.e., PBMCs) was observed in the presence of anti-CD137 antibodies. As expected, reference antibody 1, a strong agonist, induced higher IFN-7 compared to reference antibody 2, a weak agonist. Furthermore, clone 2-9 with different Fc regions, such as 2-9-1 IgG1 SELF, 2-9-1 IgG2 wildtype and 2-9-1 IgG2 SELF all showed significantly higher IFN-7 maximum release compared to the two reference antibodies. The experiments were repeated three times with different donors, and similar results were observed.

[0480] As shown in FIG. 4B, a dose-dependent secretion of IL2 by the effector cells (i.e., PBMCs) was observed in the presence of anti-CD137 antibodies. As expected, reference antibody 1, a strong agonist, induced IL-2 secretion. Furthermore, clone 2-9 with different Fc regions, i.e., 2-9-1 IgG1 SELF and 2-9-2 IgG4, both showed significantly higher IL2 maximum release compared to reference antibody 1.

[0481] In conclusion, the 2-9 mAbs induced cytokine production in a dose-dependent manner, and induced higher IFN-γ and IL2 levels compared to the two reference antibodies. As IFN-γ and IL2 are important antitumor cytokines, the data indicate that clone 2-9 antibodies, including Fc mutations and wild type, have enhanced antitumor efficacy compared to the two reference antibodies.

[0482] E. In Vivo Antitumor Efficacy Study

[0483] The 2-9 variants were further tested in vivo in a Biocytogen facility to evaluate their antitumor efficacy. Using h-CD137 (a.k.a. 4-1B) Knock-In C57BL/6 mice and MC38 murine colon cancer model, efficacies of 2-9 IgG2 wt, 2-9-1 IgG2 SELF and 2-9-1 IgG1 SELF were studied and compared to vehicle control. MC38 tumor cells were implanted one week before treatment. Treatment started when tumor volume reached approximately 100 mm.sup.3, where drugs were dosed intraperitoneally twice a week for 4 weeks at 10, 1, 0.3 mg/kg for 2-9-1-IgG1 SELF antibody, or 1 mg/kg for both 2-9-1-IgG2 SELF and 2-9-IgG2 wt antibodies. On day 24 post-treatment, tumor volumes in multiple mice of the control group reached tumor size limits (2000 mm.sup.3) for termination of the procedure. Other groups continued treatment and tumor measurement until day 28. Day 28 post-treatment was the data end point for the analyses. The treatment with 2-9 IgG2 wt, 2-9-1 IgG1 SELF and 2-9-1 IgG2 SELF significantly reduced tumor growth compared to vehicle control as shown in FIG. 5A and Table 8. Comparing the treatment with 2-9 IgG2 wt, 2-9-1 IgG1 SELF and 2-9-1 IgG2 SELF using the same dosage regime (1 mg/kg), the number of animals that reached tumor volume below 100 mm.sup.3 out of the total number of animals in each group (N=8) is 2/8, 5/8 and 5/8, respectively. Body weight changes were not significant between the groups throughout the study (FIG. 5B), indicating the treatments were well tolerated.

TABLE-US-00009 TABLE 8 In vivo antitumor efficacy of exemplary anti-CD137 antibodies Tumor volume (mm.sup.3).sup.a Before Day 24 post Groups Test articles reatment treatment TGI (%) P.sup.b G1 Vehicle 117 ± 4 2006 ± 240 — — G2 2-9-1 IgGl SELF 117 ± 5  46 ± 16 103.8 ***<0.001 (10 mg/kg) G3 2-9-1 IgGl SELF 118 ± 5 155 ± 72 98.0 ***<0.001 (1 mg/kg) G4 2-9-1 IgGl SELF 118 ± 5  340 ± 125 88.2 ***<0.001 (0.3 mg/kg) G5 2-9-1 IgG2 SELF 118 ± 4  94 ± 42 101.3 ***<0.001 (1 mg/kg) G6 2-9 IgG2 WT 118 ± 6  371 ± 109 86.6 ***<0.001 (1 mg/kg) .sup.aMean ± SEM; .sup.bT-test on tumor volume of each treatment group versus Vehicle control on day 24 post-treatment.

[0484] Furthermore, Biocytogen previously tested a utomilumab analog in the MC38 murine colon cancer model using h-CD137 (a.k.a. 4-1BB) Knock-In C57BL/6 mice under conditions similar to the above study for 2-9 variants. As shown in FIG. 6A, the utomilumab analog was tested using two dosage regimens, 1 mg/kg and 10 mg/kg. Compared to an IgG control antibody, the 1 mg/kg treatment group resulted in a Tumor Growth Inhibition (TGI) of 60.0%, and the 10 mg/kg treatment group resulted in a TGI of 85.4% (the results can also be found at www.biocytogen.com). Utomilumab is known to have a relatively safe toxicity profile, and FIG. 6B shows that the utomilumab treatment did not change mouse body weight significant.

[0485] As this study was conducted under conditions similar to the study of the 2-9 variants, the data of the 2-9 variants and the utomilumab analog are comparable. In particular, the 2-9 variants resulted in a higher TGI compared to the TGIs of the utomilumab analog treatment regardless of the dosage regimes (FIG. 5A, 6A and Table 8). When compared at the same dosage level of 1 mg/kg, the TGI of each of 2-9 IgG2 wt (86.6%), 2-9-1 IgG2 SELF (101.3%) and 2-9-1 IgG2 wt (98.0%) is significantly higher than the TGI of the utomilumab analog (60.0%). When compared at the same dosage level of 10 mg/kg, the TGI of 2-9-1 IgG1 SELF (103.8%) is significantly higher that the TGI of the utomilumab analog (85.4%). These results indicate that each of the 2-9 variants is more efficacious in vivo compared to the utomilumab analog.

Example 3: Construction of Anti-CD137×TAA (i.e., Tumor-Associated Antigen) Bispecific Antibodies

[0486] CD137 (4-1BB) is a costimulatory molecule expressed on T and NK cell to support cell activation, proliferation and survival. However, current benchmark antibodies in clinical studies are either associated with safety concerns or lack of efficacy. For example, Urelumab, a strong agonist antibody to CD137 in Phase II clinical trial, is very effective but limited by liver toxicity with doses of ≥1 mg/kg. (Segal N H, et al. Clin Cancer Res. 2017 Apr. 15; 23(8):1929-1936). The other reference antibody, Utomilumab (PF-05082566), a weak agonist antibody to CD137 also in Phase II clinical trial, was shown to be safe at up to 10 mg/kg but demonstrated limited efficacy in clinical. (Tolcher A W et al. Clin Cancer Res. 2017 Sep. 15; 23(18):5349-5357.). Based on these findings, the next-generation of anti-CD137 therapeutic antibody should achieve high CD137 activation only specifically at tumor site. To address these issues, bispecific antibodies with one arm targeting CD137 and the other arm targeting a tumor-associated antigen were designed.

[0487] Clone 2-9, an anti-CD137 monoclonal antibody described in Examples 1 and 2 was selected to construct a single chain Fv (scFv). Anti-TAA antibodies were maintained as IgG format. To construct the bispecific antibody, the anti-CD137 scFv was fused to anti-TAA antibodies at heavy chain N-terminus (HC-N), heavy chain C-terminus (HC-C), light chain N-terminus (LC-N) or light chain C-terminus (LC-C) via a linker (e.g., (GSG)4). See FIG. 7.

[0488] Specifically, anti-CD137 scFv derived from clone 2-9 was fused to an exemplary anti-HER2 full length antibody, which is derived from the amino acid sequences of trastuzumab, at N- or C-terminus of heavy chains (HC-N, HC-C, such as 2-9scFv-αHER2-HC-C) or N- or C-terminus of light chains (LC-N, LC-C) of the anti-HER2 antibody via a linker.

[0489] In some working examples, an Fc backbone with reduced effector function, such as IgG1 (LALA mutations) and IgG4 (FALA mutations), or an IgG4 with an S228P mutation was used. IgG1 LALA mutations are Leu234Ala together with Leu235Ala mutations on IgG1 Fc region to diminish effector functions (Lund, J., et al. (1992) Mol. Immunol., 29, 53-59). IgG4 FALA mutations are a Ser228Pro mutation together with PHE234Ala and Leu235Ala mutations on IgG4 Fc with diminished effector function (Vafa 0, et al. Methods. (2014) 65:114-26. 10.1016).

[0490] Using pAS puro plasmid, recombinant immunoglobulin variants were expressed in ExpiCHO-S cells (Thermo Fischer) according to manufacturer protocols. Heavy chain and light chain were transfected at a ratio of 1:2. ExpiCHO-S cell culture was typically harvest around 10-12 days post transfection. ExpiCHO-S cell culture was clarified and filtered. Culture supernatant was purified by Protein A purification (MabSelect SuRe™ LX, GE Healthcare) on AKTA Avant (GE Healthcare). First, the column was equilibrated with PBS for 5 column volumes (CV). Then the culture supernatant was loaded at a resident time to 5 min onto the column. After that, the column was washed with 5 CV of high salt buffer (100 mM Sodium Acetate, 500 mM Sodium Chloride, pH 5.5) and 5 CV of low salt buffer (50 mM Sodium Acetate, pH 5.5). Antibody was eluted with 3 CV of elution buffer (100 mM Sodium Acetate, pH 3.5) and subsequently neutralized with 1 M Tris-HCl, pH 8.5. The protein A purified proteins were used for in vitro functional assays.

[0491] Protein A purified protein sample was further purified by cation-exchange purification (Capto S ImpAct, GE Healthcare). Buffer A was 20 mM Sodium Acetate, pH 5.5. Buffer B was 20 mM Sodium Acetate, 500 mM Sodium Chloride, pH 5.5. Protein A purified sample was adjusted to similar pH and conductivity as buffer A before loading. Loading residence time was 4 min. Elution gradient was 30%-80% of buffer B for 15 CV. Fractions with minimal aggregation was pooled. The two-stepped purified proteins were used for stability study and in vivo efficacy model.

Example 4: Characterization of Anti-CD137×her-2 Bispecific Antibodies

[0492] As described in Example 3, anti-CD137 scFv derived from clone 2-9 was fused to an anti-HER2 full length antibody derived from the amino acid sequences of trastuzumab at N- and C-terminus of heavy chains (HC-N, HC-C) and N- and C-terminus of light chains (LC-N, LC-C) of the anti-HER2 antibody.

[0493] A. Affinity Measurement

[0494] Biolayer interferometry was used to measure the association and dissociation constants for the binding kinetics of bispecific antibodies. The binding kinetics was measured on a FortieBio Octet Red 96 at 30° C. and analyzed with the FortieBio Data Analysis 9.0 software. Anti-human-IgG Fc (AHC) sensor was used to capture the bispecific or control antibodies. Double binding was performed by association with the first antigen, then dissociation, and association with the second antigen, then dissociation. A regeneration cycle with 20 mM glycine, pH 1.5 was used between different antibody cycles. The 1× kinetic buffer (FortieBio) was used for baseline. Human HER2-His (Sino Biologicals Cat: 10001-H08B) and human CD137-His protein (Sino Biologicals Cat: 10041-H08H) were diluted into kinetic buffer in a series of concentrations. A kinetic buffer only well was set as a reference well for subtraction during data processing. Data were fitted with a 1:1 Langmuir model for association and dissociation using Rmax linked global fitting for each antibody-antigen binding. Experiment was repeated with two sequential binding orders: 1) CD137-His first, HER2-His second, and 2) HER2-His first, CD137-His second. See FIGS. 8A-8B and Table 9 below. Human CD137-his is a recombinant CD137 protein with a poly histidine tag fused to C-terminus of human CD137 antigen (Sino Biological, 10041-H08H). Human HER2-his a is recombinant HER2 protein with a poly histidine tag fused to C-terminus of human HER2 antigen (Acro Biosystem, HE2-H5225-100 ug).

TABLE-US-00010 TABLE 9 samples antigen Kd(M) Kon (1/Ms) Koff(1/s) Rm ax Anti-CD137 scFv-anti-HER2 IgGl CD137-his 3.41E−09 2.10E+04 7.16E−05 0.1799 HC-C Anti-CD137 scFv-anti-HER2 IgGl Her-2-his 1.25E−09 2.40E+05 2.99E−04 0.3989 HC-C Anti-CD137 2-9 IgG2 CD137-his 4.52E−09 6.62E+04 2.99E−04 0.2638 Anti-HER2 IgGl Her-2-his 1.45E−09 2.05E+05 2.98E−04 0.4037

[0495] In conclusion, each antigen binding moiety of the exemplary CD137×HER2 bispecific antibody (i.e., 2-9scFv_αHER2-HC-C) maintains desired target binding affinity, where the binding kinetics is similar to the monoclonal antibodies.

[0496] The binding affinity of bispecific antibodies to cell surface receptors were also quantified in whole cell binding assay. To measure HER2 binding affinity, 10,000 cells of HER2 positive cells SKBR3 (ATCC) or CD137 stably transfected 293T cell (established in house) were incubated with a series concentration of bispecific antibodies for 1 hour at 4° C. in FACS buffer (1×PBS, 2% FBS). Afterwards, cells were washed with PBS twice and then incubated with secondary Alexa Fluor® 488 AffiniPure Goat Anti-Human IgG, F(ab′)2 fragment specific antibody (Jackson ImmunoResearch, Code 109-545-006) for 30 min at 4° C. in FACS buffer. Then the cells were washed with PBS twice and resuspended in FACS buffer. Flow cytometry (Beckman Coulter, CytoFlex) was used to quantify bound antibodies and the result was analyzed using CytExpert. The median fluorescence intensity was fitted using a non-linear model with GraphPad 8.0.

[0497] As shown in FIG. 9A, exemplary anti-CD137×HER2 bispecific antibody (i.e., 2-9scFv_αHER2-HC-C with IgG1 or IgG4 FALA mutations) showed whole cell binding to CD137 positive cells (CD137/NFκB transfected 293T cells) in a dose dependent manner. As shown in FIG. 9B, exemplary anti-CD137×HER2 bispecific antibody (i.e., 2-9scFv_αHER2-HC-C) showed similar binding affinity as parental anti-HER2 monoclonal antibody (αHER2 mAb, derived from trastuzumab) to HER2 positive cells (SKBR3). Anti-EGFR mAb was used as a negative control. This assay demonstrated that IgG Fc mutations do not affect binding of the bispecific antibody.

[0498] B. Reporter Assay

[0499] The CD137 agonist activity of the anti-CD137×HER2 bispecific antibodies were first evaluated in a NF-κB reporter assay. It was hypothesized that high levels of HER2 on tumor cells can locate the bispecific antibody into the tumor site and super cross-linking CD137 on the nearby T cells and thus induce strong T cell activation. To test this hypothesis, the reporter cell line stably transfected with CD137 and a NFκB Luciferase reporter gene. a high HER2 expressing cell line, N87 (ATCC), and a low HER2 expressing cell line, SKHep1 (ATCC) were used in this assay. HER2 high cell line N87 was used to mimic the target tumor cells, HER2 low cell line SKHep1 was used to mimic the peripheral or non-target cells, and CD137/NFκB reporter 293T cells were used to mimic the T cells. Coincubation of N87 cells with CD137/NFκB reporter 293T cells mimics the tumor microenvironment, where tumor cells expressing high levels of HER2 and T cells coexist. It was hypothesized that high levels of HER2 on N87 cells can locate bispecific antibody into the tumor site and super cross-linking CD137 on the reporter cell line, thus induce strong NFκB signaling and activation. Coincubation of SKHep1 cell with 293T reporter cells mimics the peripheral or non-target site, which is used to test the safety profile of the bispecific antibodies.

[0500] ATCC recommended medium and condition were used for the cell culture. Each cell line was individually seeded into a 96-well plate overnight. 15,000 N87 or SK-Hep1 cells per well per 100 ul medium were used for seeding. On the next day, the cells were washed and treated with antibodies in a series of concentrations for 20 min at 37° C. The antibodies were then washed away. This step was to eliminate the excess antibodies and avoid hook effect. 120,000 293T CD137/NFκB reporter cells were then added into to the N87 or SK-Hep1 cells in DMEM medium (HyClone, Cat No. 16777-200). The combination of monospecific parental clone 2-9 antibody in combination with anti-HER2 antibody was used as a control. TNFα 20 ng/ml were used as a positive control in this assay, as TNFα is a direct NF-κB activator. PBS was used as a negative control. 5 hour later, luciferase activity was measured using Bright-Glo™ Luciferase Assay System (Promega, Cat No. E2610) following manufacturer protocol.

[0501] The results showed a dose-dependent CD137 activation of the exemplary CD137×HER2 bispecific antibodies of all the formats (HC-C, HC-N, LC-C, and LC-N) in the presence of HER2 high NCI-N87 cells (FIG. 10B), but not in the presence of HER2 low SK-Hep1 cells (FIG. 10C), whereas the combination of monospecific parental clone 2-9 antibody and anti-HER2 antibody did not induce any CD137 activation (FIGS. 10B and 10C), The results indicated the efficacy advantage of the bispecific antibodies in tumor site and the safety profile of the bispecific antibodies in peripheral or non-target site. Among the four formats of the bispecific antibodies, the HC-C format shows superior activity in the presence of NCI-N87 cells as compared to the other three formats.

[0502] The CD137 agonist activity of the anti-CD137×HER2 bispecific antibodies with Fc mutations were also evaluated in a similar reporter assay. The high HER2 expressing cell line SKBR3 (ATCC), and the low HER2 expressing cell line SKHep1 (ATCC) were used in this experiment. ATCC recommended medium and condition were used for the cell culture. Each cell line was individually seeded into a 96-well plate for overnight. 15,000 SKBR3 or SK-Hep1 cells per well per 100 ul medium were used for seeding. On the next day, the cells were washed and treated with antibodies in a series of concentration for 20 min at 37° C. The antibodies were then washed away. This step was to eliminate the excess antibodies and avoid hook effect. 120,000 293T CD137/NFκB reporter cells were then added to the cancer cells in DMEM medium (HyClone, Cat No. 16777-200). Monospecific parental clone 2-9 antibodies and Reference Ab 1 were used as controls. TNFα 20 ng/ml were used as a positive control in this assay, as TNFα is a direct NF-κB activator. 5 hour later, luciferase activity was measured using Bright-Glo™ Luciferase Assay System (Promega, Cat No. E2610) following manufacturer protocol

[0503] The results showed a dose-dependent CD137 activity of the exemplary anti-CD137×HER2 bispecific antibodies having different Fc regions in the presence of HER2 high SKBR3 cells (FIG. 11A), but not in the presence of HER2 low SK-Hep1 cells (FIG. 11A). Fc effector function did not affect reporter activity in the presence of HER2 high cells (SKBR3). In the presence of HER2 low cells (SK-Hep1), the bispecific antibodies did not induce significant CD137 activation, indicating the safety profile in peripheral or non-target site.

[0504] C. Cytokine Release Assay

[0505] The potency of bispecific antibodies on HER2 dependent T cell activation was further measured through cytokine release. The high HER2 expressing cell line SKBR3 (ATCC), and the low HER2 expressing cell line MDA-MB-231 (ATCC) were used in this experiment. ATCC recommended medium and condition were used for the cell culture. Each cell line was individually seeded into a 96-well plate overnight. 15,000 SKBR3 or MDA-MB-231 cells per well per 100 ul medium were used for seeding. Human PBMCs were isolated using Ficoll-Paque® PLUS (Cat. No. 17-1440-02, GE Healthcare). Monocytes were depleted by culturing the isolated PBMCs in petri dish for at least 3 hours to allow monocytes to attach. On the next day, SKBR3 or MDA-MB-231 cells were washed and treated with antibodies in a series of concentrations for 20 min at 37° C. The antibodies were then washed away. This step was to eliminate the excess bispecific antibodies and avoid hook effect. PBMCs were then added into to the SKBR3 or MDA-MB-231 cells in Gibco RPMI medium 1640 (Cat. No. A1049101, Thermo Fischer). Monospecific parental clone 2-9 antibody was used as a control. An effector cells (PBMC) to target cells (SKBR3 or MDA-MB-231 cells) ratio of 10:1 was used in all assays. 24 hour later, media were collected, and IFNγ and IL-2 levels were determined using ELISA method (Human IFN-γ ELISA MAX™ Deluxe, Cat. No. 430106, BioLegend; Human IL-2 ELISA MAX™ Deluxe, Cat. No. 431804, BioLegend).

[0506] As shown in FIG. 12, a dose-dependent secretion of IFNγ and IL-2 by the effector cells (i.e., PBMCs) was observed in the presence of HER2 high cells, but not in the presence of HER2 low cells. The bispecific antibodies showed higher cytokine release compared to anti-CD137 monoclonal antibody in the presence of HER2 high cells (SKBR3), indicating the efficacy advantage of the bispecific antibodies in tumor site. In the presence of HER2 low cells (MDA-MB-231), the bispecific antibodies did not induce significant cytokine release, indicating the safety profile of the bispecific antibodies in peripheral or non-target site. The assay was repeated multiple times with different donors and similar results were observed. In conclusion, anti-CD137×HER2 bispecific antibody treatment induced cytokine production in a HER2 dependent manner.

[0507] E. In Vivo LoVo Xenograft Model

[0508] The in vivo efficacy of the bispecific antibody was investigated in LoVo/PBMC xenograft model. In the LoVo model, 5 million LoVo, human colon cancer cells were mixed at a 3:1 ratio with freshly isolated human PBMCs and subsequently injected subcutaneously in immunodeficiency (NOD/SCID) mice. On day 3 after the engraftment, animals were treated with bispecific antibodies through intraperitoneal injection twice per week for four weeks. Twenty days after the first treatment, anti-tumor effects were observed. The measurement of the tumor size was conducted with a caliper, and the tumor volume (TV, in mm.sup.3) was estimated using the formula: TV=a×b.sup.2/2, where “a” and “b” are the long and short diameters of a tumor, respectively. The TVs were used for calculation of the tumor growth inhibition (TGI, an indicator of antitumor effectiveness) using the formula: TGI (%)=[1−(T.sub.t−T.sub.0)/(C.sub.t−C.sub.0)]×100%, where T.sub.t=mean TV of a treated subject at time t, T.sub.0=mean TV of a treated subject at time 0 (baseline), C.sub.t=mean TV of the control at time t, and C.sub.0=mean TV of the control at time 0 (baseline).

[0509] As shown in FIG. 13 and Table 10, mice treated with the anti-CD137×HER2 bispecific antibody (HCC) having IgG4 FALA mutantions showed 52.5% tumor growth inhibition (TGI), whereas mice treated with the combination of parental anti-HER2 antibody and parental anti-CD137 antibody showed 19.4% TGI. For treatment group without PBMC, no significant difference in tumor inhibition was observed in each group (data not shown). The results demonstrated the superior therapeutic efficacy of the anti-CD137×HER2 bispecific antibody compared to the combination of monospecific anti-CD137 antibody and anti-HER2 antibody.

TABLE-US-00011 TABLE 10 αCD 137ScFv- αHER2-IgG4 αHER2 + FALA HCC-L7 αCD137 Vehicle 10 mg/kg LoVo/ 7.5mg/kg control Day 28 hPBMC LoVo/hPBMC LoVo/hPBMC Tumor size 421.4 ±76.16 671.7 ± 162.8 821.4 ± 163.8 Mean ± SEM (mm.sup.3) TGI 52.5% 19.4% P value 0.020(*) 0.263 (T test with Vehicle Control)

[0510] F. In Vivo OE-19 Xenograft Model

[0511] The in vivo efficacy of the bispecific antibody was also investigated in OE19/PBMC xenograft model. OE-19 is a human gastric cancer cell line. In the OE-19 model, 5 million OE-19 cells were mixed at a 3:1 ratio with freshly isolated human PBMCs and subsequently injected subcutaneously in immunodeficiency (NOD/SCID) mice. On day 1 after the engraftment, animals were treated with bispecific antibodies through intraperitoneal injection twice per week for three weeks. Twenty-one days after the first treatment, anti-tumor effects were observed. The measurement of tumor size is conducted with a caliper and the tumor volume (mm.sup.3) is estimated using the formula: TV=a×b.sup.2/2, where “a” and “b” are long and short diameters of a tumor, respectively. The TVs are used for calculation of the tumor growth inhibition (TGI, an indicator of antitumor effectiveness) using the formulate: TGI (%)=[1−(T.sub.t−T.sub.0)/(C.sub.t−C.sub.0)]×100%. Where T.sub.t=mean TV of treated at time t, T.sub.0=mean TV of treated at time 0 (baseline), C.sub.t=mean TV of control at time t and C.sub.0=mean TV of control at time 0 (baseline).

[0512] As shown in FIG. 14A and Table 11, mice treated with the anti-CD137×HER2 bispecific antibody (HCC) having IgG4 FALA mutations showed significant tumor growth inhibition (TGI) compared to mice treated with the combination of parental anti-HER2 antibody and parental anti-CD137 antibody showed (p<0.05). FIG. 14B showed individual tumor volumes of different treatment groups on day 21. The results demonstrated the superior therapeutic efficacy of the anti-CD137×HER2 bispecific antibody compared to the combination of monospecific anti-CD137 antibody and anti-HER2 antibody.

TABLE-US-00012 TABLE 11 αCD137ScFV-αHER2- αHER2 + IgG4 FALA HCC-L7 0.3mg/kg + 2-9 αHER2 Vehicle Day 21 0.4 mg/kg mAb 0.3 mg/kg 0.3 mg/kg control Tumor size 660 ± 126 1143 ± 256 1493 ± 304 1712 ± 309 Mean ± SEM TGI% 61 22 13

[0513] It will be apparent to those skilled in the art that various modifications and variations can be made in the compositions and methods of the disclosed subject matter without departing from the spirit or scope of the disclosed subject matter. Thus, it is intended that the disclosed subject matter include modifications and variations that are within the scope of the appended claims and their equivalents.

[0514] Various publications, patents and patent applications are cited herein, the contents of which are hereby incorporated by reference in their entireties.