Antibody-fynomer conjugates
10323095 ยท 2019-06-18
Assignee
Inventors
- Roland Newman (San Diego, CA, US)
- Steve Granger (Encinitas, CA, US)
- Michael Lyman (San Diego, CA, US)
- Dragan Grabulovski (Zurich, CH)
- Richard Woods (Zurich, CH)
- Michela Silacci (Zurich, CH)
- Wenjuan Zha (Zurich, CH)
- Isabella Attinger-Toller (Vancouver, CA)
Cpc classification
C12N9/1205
CHEMISTRY; METALLURGY
A61P29/00
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2318/20
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
C12N9/12
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
C07K16/24
CHEMISTRY; METALLURGY
Abstract
Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
Claims
1. A bi-specific fusion polypeptide comprising: (a) a fynomer sequence comprising an amino acid sequence at least 90% identical to an amino acid sequence selected from: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 1, SEQ ID NO: 4 and SEQ ID NO: 7, wherein the amino acid sequences at positions 12-17 and 31-36 of the selected fynomer sequence is maintained and the fynomer sequence binds to interleukin-17a (IL-17a); and (b) an antibody or a subsequence thereof that binds to interleukin-6 receptor (IL-6R), wherein the fynomer sequence is conjugated to the antibody, or subsequence thereof, and the fusion polypeptide binds to both IL-17a and IL-6R and inhibits both IL-17a and IL-6R activities.
2. The fusion polypeptide of claim 1, wherein the fynomer sequence is conjugated to a heavy or light chain sequence of the antibody or subsequence thereof.
3. The fusion polypeptide of claim 1, wherein the fynomer sequence is conjugated to the amino terminus or the carboxyl terminus of a heavy chain sequence of the antibody or subsequence thereof.
4. The fusion polypeptide of claim 1, wherein the fynomer sequence is conjugated to an amino terminus or a carboxyl terminus of a light chain sequence of the antibody or subsequence thereof.
5. The fusion polypeptide of claim 1, wherein the fynomer sequence comprises an amino acid sequence at least 95% identical to an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7.
6. The fusion polypeptide of claim 1, wherein the fynomer sequence comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7.
7. The fusion polypeptide of claim 1, wherein the fynomer sequence comprises the amino acid sequence of SEQ ID NO: 42.
8. The fusion polypeptide of claim 1, wherein the fynomer sequence binds to glycosylated IL-17a and thereby inhibits IL-17 receptor function or signaling.
9. The fusion polypeptide of claim 1, wherein the fynomer sequence has a binding affinity (K.sub.d) for binding to glycosylated IL-17a of about 1 to about 200 nM.
10. The fusion polypeptide of claim 1, wherein the fynomer sequence has a greater binding affinity (K.sub.d or KD) for glycosylated IL-17a than the binding affinity of the fynomer sequence as set forth in SEQ ID NO:1 for glycosylated IL-17a.
11. The fusion polypeptide of claim 1, wherein the fusion polypeptide binds to IL-17a and binds to IL-6R simultaneously.
12. The fusion polypeptide of claim 1, wherein the fusion polypeptide binds to human IL-17a or IL-6R.
13. The fusion polypeptide of claim 1, wherein the fynomer sequence is conjugated to a heavy or light chain sequence of the antibody or subsequence thereof via a linker.
14. The fusion polypeptide of claim 1, wherein the polypeptide is isolated or purified.
15. A pharmaceutical composition comprising the fusion polypeptide of claim 1.
16. The fusion polypeptide of claim 1, wherein the antibody or subsequence thereof comprises a heavy chain having the following CDR1-3: SEQ ID NO: 47, SEQ ID NO: 48, and SEQ ID NO: 49, and a light chain having the following CDR1-3: SEQ ID NO: 50, SEQ ID NO: 51, and SEQ ID NO: 52.
17. The fusion polypeptide of claim 16, wherein the antibody or subsequence thereof comprises a sequence at least 90% identical to the following heavy chain (HC) and light chain (LC) sequences: (HC) SEQ ID NO: 12 and (LC) SEQ ID NO: 13.
18. The fusion polypeptide of claim 17, wherein the antibody or subsequence thereof comprises the following heavy chain (HC) and light chain (LC) sequences: (HC) SEQ ID NO: 12 and (LC) SEQ ID NO: 13.
19. The fusion polypeptide of claim 16, wherein the antibody or subsequence thereof comprises a pair of heavy chain (HC) and light chain (LC) sequences selected from the following: (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 14 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 15; (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 16 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 17; (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 18 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 19; (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 20 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 21; (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 22 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 23; (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 24 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 25; (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 26 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 27; and (HC) a heavy chain sequence at least 90% identical to SEQ ID NO: 28 and (LC) a light chain sequence at least 90% identical to SEQ ID NO: 29.
20. The fusion polypeptide of claim 19, wherein the antibody or subsequence thereof comprises a pair of heavy chain (HC) and light chain (LC) sequences selected from the following: SEQ ID NO: 14 and 15; SEQ ID NO: 16 and 17; SEQ ID NO: 18 and 19; SEQ ID NO: 20 and 21; SEQ ID NO: 22 and 23; SEQ ID NO: 24 and 25; SEQ ID NO: 26 and 27; and SEQ ID NO: 28 and 29.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
DETAILED DESCRIPTION
(30) The term fynomer refers to a non-immunoglobulin derived binding (poly)peptide modeled after, based upon or derived from the human Fyn kinase SH3 domain, a so-called scaffold described in Gebauer and Skerra (2009) Curr Opinion in Chemical Biology 13:245-255). The SH3 domain of the human Fyn kinase may be used as a scaffold to engineer proteins (termed fynomers) that bind with high affinity and specificity to different targets, such as proteins (WO 2008/022759, WO 2011/023685, Grabulovski D. et al., (2007) J Biol Chem 282, p. 3196-3204, Bertschinger J. et al. (2007) Protein Eng Des Sel, 20, p. 57-68, and Schlatter et al. (2012) mAbs, 4(4) p. 497-50). The sequence of Fyn3 sequence, with respective RT loop (EARTED) and src loop (NSSE) regions underlined is shown below:
(31) TABLE-US-00006 (SEQ ID NO: 45) GVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQ RTloopsrcloop
(32) An IL-17a fynomer or anti-IL-17a fynomer, and grammatical variations thereof, mean a fynomer sequence that binds to an interleukin 17a (IL-17a) protein. The amino acid positions within the RT loop and src-loop are believed to determine the binding specificity to the glycosylated IL-17A. Representative IL-17a binding fynomer sequences (SEQ ID NOs:1-7) are as follows:
(33) TABLE-US-00007 RTloopsrcloop SEQIDNO1: GVTLFVALYDYANHGNRDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO2: GVTLFVALYDYKQKGHLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO3: GVTLFVALYDYSARGQLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO4: GVTLFVALYDYDKLSALDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO5: GVTLFVALYDYESVSWSDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO6: GVTLFVALYDYSSRGVLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; and SEQIDNO7: GVTLFVALYDYSRKSNLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ.
(34) An IL-6R antibody or anti-IL-6R antibody, and grammatical variations thereof, mean a polyclonal or monoclonal antibody that binds to an interleukin 6 receptor (IL-6R) protein. Representative IL-6R binding antibody heavy chain and light chain sequences (SEQ ID NOs:8 and 9) are as follows:
(35) TABLE-US-00008 Tocilizumabheavychainsequence(SEQIDNO:8), CDRsareunderlined 1 QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIG 51 YISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSL 101 ARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD 151 YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY 201 ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK 251 DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 301 TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV 351 YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL 401 DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG* Tocilizumablightchainsequence(SEQIDNO:9), CDRsareunderlined 1 DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYY 51 TSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGNTLPYTFGQ 101 GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV 151 DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG 201 LSSPVTKSFNRGEC*
(36) Additional examples of IL-6R binding antibodies, and/or heavy chain and light chain sequences of antibodies that bind to IL-6R, are described in US 20130122012; US 20120225060; US 20120128626; and US 20120077731. Nanobodies that bind to IL-6R are described in WO/2008/020079.
(37) As used herein, the terms IL-17a, IL-17a protein, IL-17a sequence, and IL-17a domain refer to all or a portion of an IL-17a protein sequence (e.g., a subsequence such as an antigenic region or epitope) isolated from, based upon or present in any naturally occurring context, or artificially produced (e.g., genetically engineered) IL-17a. Thus, the term IL-17a and the like include cellular as well as recombinantly or synthetically produced IL-17a sequences.
(38) As used herein, the terms IL-6R, IL-6R protein, IL-6R sequence, and IL-6R domain refer to all or a portion of an IL-6R protein sequence (e.g., a subsequence such as an antigenic region or epitope) isolated from, based upon or present in any naturally occurring context, or artificially produced (e.g., genetically engineered) IL-6R. Thus, the term IL-6R and the like include cellular as well as recombinantly or synthetically produced IL-6R sequences.
(39) Mammalian IL-17a and IL-6R sequences are known to those skilled in the art. A representative non-limiting example of human IL-17a protein sequence (SEQ ID NO:10) is:
(40) TABLE-US-00009 MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN IHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCI NADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPI VHHVA.
(41) A representative non-limiting example of human IL-6R protein sequence (SEQ ID NO:11) is:
(42) TABLE-US-00010 MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGV EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAG RPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQLTTNKDDDNILFRDSANA TSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGK TSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDAR DPRSPYDISNTDYFFPR.
(43) The term antibody refers to a protein that binds to another molecule (antigen) via heavy and light chain variable domains, denoted V.sub.H and V.sub.L, respectively. Antibody refers to any polyclonal or monoclonal immunoglobulin molecule, or mixtures thereof, such as IgM, IgG, IgA, IgE, IgD. Antibodies belong to any antibody class or subclass. Exemplary subclasses for IgG are IgG.sub.1, IgG.sub.2, IgG.sub.3 and IgG.sub.4.
(44) The term monoclonal, when used in reference to an antibody, refers to an antibody that is based upon, obtained from or derived from a single clone, including any eukaryotic, prokaryotic, or phage clone. A monoclonal antibody is therefore defined herein structurally, and not the method by which it is produced.
(45) Antibodies include antibodies having kappa or lambda light chain sequences, either full length as in naturally occurring antibodies, mixtures thereof (i.e., fusions of kappa and lambda chain sequences), and subsequences/fragments thereof. Naturally occurring antibody molecules contain two kappa and two lambda light chains. The primary difference between kappa and lambda light chains is in the sequences of the constant region.
(46) An antibody that includes or consists of a Heavy (H) chain and/or Light (L) chain or fragment of a Heavy (H) chain or Light (L) chain may include a single H or L chain or a single H or L chain fragment, or a plurality (2, 3, 4 or more) of Heavy (H) chains and/or Light (L) chains, or a plurality of fragments of Heavy (H) chains and/or Light (L) chains. A fusion polypeptide (FynomAb) that includes a Heavy (H) chain and/or Light (L) chain of an antibody or fragment may be but is not required to include 2 Heavy (H) chains and 2 Light (L) chains and therefore fusion polypeptides (FynomAbs) as set forth herein. An antibody or fragment thereof may be an oligomeric (higher order or valent) forms, such as a trimer, tetramer, pentamer, hexamer, heptamer, and so forth, with other antibodies, fragments thereof, Heavy (H) chain, Light (L) chain, or polypeptides distinct from an antibody Heavy (H) or Light (L) chain.
(47) As used herein, the term bi-specific and grammatical variations thereof, when used in reference to a fusion polypeptide sequence, means that the fusion polypeptide binds to two distinct targets. Polypeptide targets are considered distinct when they have distinct amino acid sequences. The bi-specific fusion polypeptide of the present invention binds to interleukin 6 receptor (IL-6R) and interleukin-17a (IL-17a).
(48) As used herein, the term fusion or chimera and grammatical variations thereof, when used in reference to a sequence, means that the sequence contains one or more portions that are based upon, derived from, or obtained or isolated from, two or more different proteins. That is, for example, a portion of the sequence may be based upon or from one particular protein, and another portion of the sequence may be based upon or from a different particular protein. Thus, a fusion or chimeric polypeptide is a molecule in which different portions of the polypeptide are of different protein origins.
(49) The terms protein, polypeptide and peptide are used interchangeably herein to refer to two or more amino acids, or residues, covalently linked by an amide bond or equivalent. Amino acid sequences may be linked by non-natural and non-amide chemical bonds including, for example, those formed with glutaraldehyde, N-hydroxysuccinimide esters, bifunctional maleimides, or N, N-dicyclohexylcarbodiimide (DCC). Non-amide bonds include, for example, ketomethylene, aminomethylene, olefin, ether, thioether and the like (see, e.g., Spatola in Chemistry and Biochemistry of Amino Acids, Peptides and Proteins, Vol. 7, pp 267-357 (1983), Peptide and Backbone Modifications, Marcel Decker, NY).
(50) The present invention provides a fusion polypeptide (FynomAbs) comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody that binds to interleukin-6 receptor (IL-6R) or subsequence thereof that binds to IL-6R. The fynomer sequence may be bound to the amino- or carboxy-terminal end of the IL-6R binding antibody or subsequence thereof. Likewise, either the amino- or carboxy-terminal end of fynomer sequence may be bound to the amino- or carboxy-terminal end of the antibody or subsequence thereof. Multiple fynomers may be bound, via the amino- or carboxy-terminal end of the fynomer sequence, to multiple amino- or carboxy-terminal ends of the antibody or subsequence thereof. In addition, end-to-end or in series multiples of fynomers may be bound to the amino- or carboxy-terminal end of the antibody or subsequence thereof.
(51) The term bind, or binding, when used in reference to a fynomer, an antibody or subsequence thereof, or a fusion polypeptide (e.g., FynomAb), means that the fynomer, the antibody or subsequence thereof, or the fusion polypeptide specifically binds to all or a part of a target. The fynomer, the antibody or subsequence thereof, or the fusion polypeptide (FynomAb) binds specifically or selectivity to IL-17a and/or IL-6R protein, which is selective for an epitope or antigenic determinant present in IL-17a or IL-6R protein. Selective binding refers to binding to a target protein. Binding to a non-target protein that does not significantly interfere with binding to the target protein is also considered selective. Selective binding may be distinguished from non-selective binding using specificity, affinity, and competitive and non-competitive binding assays, described herein or known in the art.
(52) Fynomer/antibody fusion polypeptides (FynomAbs) of the invention may have the same or substantially the same binding specificity as the exemplified fynomers, antibodies and subsequences thereof. The affinity for a target may be more or less than that of a reference fynomer, antibody, or subsequence thereof, or a reference fynomer/antibody fusion polypeptide (FynomAb). A given FynomAb may or may not detectably compete with or inhibit binding of another fynomer, antibody, subsequence or FynomAb to regions of a target that do not interfere with each other.
(53) A fynomer/antibody fusion polypeptide (FynomAb) that specifically binds to all or a part of sequence on a target may also bind to other proteins that have the same or a similar epitope as the target. Fusion polypeptides (FynomAbs) that bind to the same sequence or epitope or a part of the epitope can have more or less relative binding affinity or specificity for the target than a reference fynomer or antibody or fusion thereof.
(54) Fynomers and antibodies, and fusion polypeptides (FynomAbs), also include sequences that compete for binding to their respective targets. Thus, for example, a given fynomer, antibody, subsequence or FynomAb may inhibit or compete for binding of another fynomer, antibody, subsequence or FynomAb for binding to IL-17a and/or IL-6R. In a particular non-limiting example, a fynomer, antibody, subsequence or FynomAb may inhibit binding to IL-17a and/or IL-6R by at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%, or more of any of COVA801 to 808. Accordingly, the fynomer may be the one that competes for binding of any of the fynomers denoted as SEQ ID NOs:1-7 for binding to IL-17a (e.g., glycosylated IL-17a), and the antibody or subsequence thereof may be the one that competes for binding of an antibody comprising SEQ ID NOs:8 and 9 for binding to IL-6R.
(55) FynomAbs of the invention may include fynomer/antibody or subsequence thereof or fusion polypeptide (FynomAb) with more or less affinity for target (e.g., IL-17a or IL-6R) than a reference fynomer/antibody or subsequence thereof or fusion polypeptide (FynomAb). For example, a FynomAb of the present invention may be those having more or less affinity for IL-17a (e.g., glycosylated IL-17a) and/or IL-6R and having a sequence at least 60% or more (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to a fynomer sequence as set forth in SEQ ID NOs:1-7, or sequence at least 60% or more (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to a heavy or light chain variable region sequence as set forth in SEQ ID NOs:8 or 9. In a particular embodiment, the fusion polypeptide (FynomAb) of the invention has greater affinity for glycosylated IL-17a than a fynomer sequence as set forth in SEQ ID NO:1.
(56) FynomAbs of the invention therefore include sequences having the same or different binding affinity for IL-17a (e.g., glycosylated IL-17a) and/or IL-6R. For example, a FynomAb of the invention may have an affinity for target (e.g., glycosylated IL-17a and/or IL-6R) that is greater or less than 2-5, 5-10, 10-100, 100-1000 or 1000-10,000 fold affinity or any numerical value or range or value within such ranges, as another FynomAb, for example, COVA801-808.
(57) Binding affinity may be determined by association (K.sub.a) and dissociation (K.sub.d) rate. Equilibrium affinity constant, KD, is the ratio of K.sub.a/K.sub.d. A fynomer or antibody having the same binding affinity as another fynomer or antibody, means that the dissociation constant (K.sub.d) of each antibody is within about 1 to 10 fold (1-10 fold greater affinity or 1-10 fold less affinity, or any numerical value or range or value within such ranges, than the reference fynomer or antibody). Exemplary affinities for a target antigen (e.g., IL-17a such as glycosylated IL-17a, or IL-6R) have a dissociation constant (K.sub.d) less than 510.sup.2 M, 10.sup.2 M, 510.sup.3 M, 10.sup.3 M, 510.sup.4 M, 10.sup.4 M, 510.sup.5 M, 10.sup.5 M, 510.sup.8 M, 10.sup.8 M, 510.sup.7 M, 10.sup.7 M, 510.sup.8 M, 10.sup.8 M, 510.sup.9 M, 10.sup.9 M, 510.sup.10 M, 10.sup.10 M, 510.sup.11 M, 10.sup.11 M, 510.sup.12 M, 10.sup.12 M, 510.sup.13 M, 10.sup.13 M, 510.sup.14 M, 10.sup.14 M, 510.sup.15 M, and 10.sup.15 M. Typically, binding affinities (K.sub.d) for target may be less than 10.sup.7 M, 510.sup.8 M, 10.sup.8 M, 510.sup.9 M, 10.sup.9 M, 510.sup.10 M, 10.sup.10 M, 510.sup.11 M, 10.sup.11 M, 510.sup.12 M, or 10.sup.12 M.
(58) More particular exemplary fynomer or fusion polypeptide (FynomAb) affinities for target antigen IL-17a (e.g., glycosylated IL-17a) have a KD of between about 0.01 nM to about 0.50 nM, or about 0.02 nM to about 0.40 nM. More particular exemplary antibody or subsequence thereof or fusion polypeptide (FynomAb) affinities for target antigen IL-6R have a KD of between about 0.20 nM to about 1.25 nM, or about 0.30 nM to about 1.10 nM.
(59) Fynomers and antibodies, and fusion polypeptides (FynomAbs) may include those having at least a part of an activity or function as a reference fynomer, antibody, or a fusion comprising FynomAb. The activity or function may be binding affinity (e.g., K.sub.d, KD), binding specificity, or activity, e.g., antagonist activity. The term at least a part means that the fynomer, antibody, or fusion polypeptide (FynomAb) retains at least a measurable or detectable amount of the activity or function of the reference fynomer, antibody, or the fusion polypeptide (FynomAb) exemplified herein. The fynomer, antibody, or fusion polypeptide (FynomAb) of the present invention may have a greater or less activity or function than the reference fynomer, antibody, or fusion polypeptide (FynomAb).
(60) The fynomer, antibody, or fusion polypeptide (FynomAb) may have an antagonisting or agonisting activity or function. In one embodiment, the fynomer, antibody or fusion polypeptide (FynomAb) may be those having antagonisting or agonisting activity or function against IL-17a and/or IL-6R.
(61) An antagonist is capable of decreasing, reducing, or inhibiting one or more activities of the target molecule, such as signaling by IL-17a or IL-6R. An antagonist may interfere with the binding of IL-17a to a receptor or IL-6R to a ligand, and incapacitates or kills cells activated by the ligand, and/or interfere with signal transduction. The antagonist may completely block, substantially decrease, reduce or inhibit interactions between the ligand and receptor.
(62) An agonist is capable of increasing, inducing or activating one or more activities of a target molecule, such as signaling by IL-17a or IL-6R. Agonists may increase, induce or promote binding of a receptor to a ligand (or vice versa), or may act directly on the receptor or ligand to increase, induce, promote or activate signal transduction.
(63) Fynomers, antibodies, or fusion polypeptides (FynomAbs) having an activity or function of a reference fynomer, antibody, or a fusion polypeptide (FynomAb) may be identified through various methods disclosed herein or known in the art. For example, binding assays against IL-17a (e.g., glycosylated IL-17a) or IL-6R on plates (ELISA), or on cells (cell based ELISA) may be employed. Specific inhibition of binding to IL-17a or IL-6R may be used as a measure of binding specificity as well as affinity. Examples of assays may be those can determine function or activity, such as IL-17a or IL-6R activity, e.g., signaling activity.
(64) As set forth herein, an antibody, fynomer or fusion polypeptide (FynomAb) of the present invention may be those having one or more modifications in a reference sequence. Non-limiting examples of the modifications may include one or more amino acid substitutions (e.g., 1-3, 3-5, 5-10 or more residues), additions (e.g., 1-3, 3-5, 5-10 or more residues) or deletions (e.g., subsequences or fragments) of a reference fynomer, a reference antibody (heavy or light chain), or a fusion polypeptide (FynomAb). In particular embodiments, a modified fynomer, antibody, or fusion polypeptide (FynomAb) retains at least part of a function or an activity of unmodified reference antibody, fynomer or fusion polypeptide (FynomAb), e.g., binding affinity (e.g., K.sub.d, KD) or binding specificity to IL-6R or IL-17a (e.g., glycosylated IL-17a), in vitro or in vivo or in or on a cell (e.g., in culture), or in vivo.
(65) The fynomer, antibody or subsequence thereof or FynomAbs may include those having at least partial sequence identity (less than 100%) to a parental or reference fynomer, or antibody heavy or light chain variable region sequence, or fusion polypeptide (FynomAb) set forth herein respectively. For example, the fynomers set forth herein (SEQ ID NOs:1-7), and/or heavy and light chain sequences of tocilizumab (SEQ ID NOs:8-9). The percent identity of such fynomer, antibody, subsequence thereof or fusion polypeptide (FynomAbs) may be as little as 60%, or may be more (e.g., 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%). The percent identity may extend over the entire sequence length of a sequence as set forth in SEQ ID NOs:1-9, or a contiguous region or area within any of SEQ ID NOs:1-9. In an aspect, the length of the sequence sharing the percent identity is 5 or more contiguous amino acids, e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 contiguous amino acids. In another aspect, the length of the sequence sharing the percent identity is 20 or more contiguous amino acids, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35 contiguous amino acids. In a further aspect, the length of the sequence sharing the percent identity is 35 or more contiguous amino acids, e.g., 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 45, 47, 48, 49 or 50 contiguous amino acids. In yet further aspect, the length of the sequence sharing the percent identity is 50 or more contiguous aminoacids, e.g., 50-55, 55-60, 60-65, 65-70, 70-75, 75-80, 80-85, 85-90, 90-95, 95-100 or 100-110 contiguous amino acids.
(66) In accordance with the invention, there are provided fusion polypeptides (FynomAbs) having any of fynomer sequence, heavy or light chain variable region of the antibody as set forth in SEQ ID NOs:1-9 or a sequence containing one or more amino acid substitutions in the sequence of SEQ ID NOs: 1-9. In an embodiment, the substituted fynomer and/or antibody heavy and/or light chain sequence may retain at least partial binding affinity and/or specificity to the target IL-17a (e.g, glycosylated IL-17a) and/or IL-6R.
(67) In one embodiment, the fynomer sequence may have 1-15, 1-12, 1-8, 1-5, 1-3 or fewer (e.g., 1 or 2) amino acid substitutions. In particular, a substitution will be of an amino acid within any fynomer sequence (SEQ ID NOs:1-7).
(68) In another embodiment, any substitution is not in a motif of GVTLFVALYDY (SEQ ID NO:35), DLSFHKGEKFQIL (SEQ ID NO:36), STHEY (SEQ ID NO:46), STHEYE (SEQ ID NO:37), STHEYED (SEQ ID NO:38), WWEAR (SEQ ID NO:39), DWWEAR (SEQ ID NO:40), SLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO:41), or QILSTHEYEDWWEAR (SEQ ID NO:42) in the fynomer sequence. In another embodiment, the E amino acid residue positioned immediately after the src loop sequence in the fynomer sequence is not substituted.
(69) The antibody or fusion polypeptide (FynomAb) may have one or more substitutions in the constant or variable (e.g., hypervariable, such as CDR or FR) region. One or a few amino acid substitutions in the constant or variable regions are likely to be tolerated. Non-conservative substitution of multiple amino acids in one or more hypervariable regions is likely affect binding activity, specificity of the antibody or fusion polypeptide (FynomAb).
(70) Thus, modifications may include deleting small and large regions of amino acid sequences from the reference antibody, fynomer or fusion polypeptide (FynomAb). The deleted region may optionally be substituted with another amino acid sequence. The substituted sequence may be the same, or greater or shorter in length as the deleted region.
(71) A particular example of an antibody or fusion polypeptide (FynomAb) modification is an alteration to have a different isotype or subclass, for example, by substitution of the heavy or light chain constant region. An alteration of Ig subclass can result in a change or an improvement in a function or activity (e.g., an anti-IL-6R activity, stability). Another example is an alteration that results in an improved characteristic, such as increased serum stability and/or half-life in vivo or PK. (e.g., as described in Antibody Engineering Vol. 1, Konterman R and Duebel S, eds., 2010, Springer, WO 2006/130834 and Horton et al., Cancer Res 68:8049 (2008)). Non-limiting examples of substitutions in the Fc include I253A, H310A, H435 R, H435Q, G236R, L328 R, S239D, I332E. Non-limiting examples of substitutions in IgG1 may be at residues 238, 252, 253, 254, 255, 256, 265, 272, 289, 288, 303, 305, 307, 309, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 386, 388, 400, 413, 415, 424, 433, 434, 435, 439 and/or 477 of the Fc region.
(72) In an embodiment, a heavy or light chain CDR (CDR1, CDR2 or CDR3) or FR may have 1-15, 1-12, 1-8, 1-5, 1-3 or fewer (e.g., 1 or 2) amino acid substitutions. In an embodiment, the substitution within a variable region sequence may be a conservative amino acid substitution, e.g., within a CDR or FR. In another embodiment, the substitution within a variable region sequence may not be within a CDR. In another embodiment, the substitution may be within an FR. In another embodiment, the substitution within a variable region sequence may not be within an FR. Examples of heavy chain and light chain variable region CDR sequences that confer IL-6R binding are set forth in SEQ ID NOs:8 and 9, namely, heavy chain variable region CDRs1-3 are: SDHAWS (SEQ ID NO:47); YISYSGITTYNPSLKS (SEQ ID NO:48); and SLARTTAMDY (SEQ ID NO:49); and light chain variable region CDRs1-3 are:
(73) TABLE-US-00011 RASQDISSYLN(SEQIDNO:50);YTSRLHS (SEQIDNO:51);andQQGNTLPYT(SEQIDNO:52).
(74) The structural determinants that contribute to antigen binding by an antibody, such as complementarity determining regions (CDR) and framework regions (FR) within hyper variable regions are known in the art. The location, structure and function of additional regions, such as D- and J-regions are also known. An Antibody, subsequence thereof or a fusion polypeptide (FynomAb) that binds to a given target (e.g., IL-6R) may typically have one or more CDR and FR sequences with sufficient sequence identity to a heavy or light chain sequence that binds to IL-6R so as to retain at least partial function or IL-6R binding activity. For example, as exemplified herein, one or more CDRs of heavy or light chain sequence as set forth in SEQ ID NOs:8-9 may retain at least partial function or activity of an antibody that has binding specificity to IL-6R.
(75) Regional mutability analysis may be used to predict the effect of particular substitutions in complementarity determining regions (CDR) and framework regions (FR) (Shapiro et al., J Immunol. 163:259 (1999)). In brief, sequence comparison indicates a hierarchy of mutability among di- and trinucleotide sequences located within Ig intronic DNA, which predicts regions that are more or less mutable. Quantitative structure-activity relationship (QSAR) may be used to identify the nature of the antibody recognition domain and, therefore, amino acids that participate in ligand binding. Predictive models based upon QSAR may in turn be used to predict the effect of substitutions (mutations). For example, the effect of mutations on the association and dissociation rate of an antibody interacting with its antigen has been used to construct quantitative predictive models for both kinetic (K.sub.a and K.sub.d) constants, which may in turn be used to predict the effect of other mutations on the antibody (De Genst et al., J Biol. Chem. 277:29897 (2002)). The skilled artisan can therefore use such analysis to predict amino acid substitutions that are likely to result in an antibody or subsequence that retains at least partial activity or function of non-substituted antibody, subsequence or fusion polypeptide (FynomAb), e.g., retains at least partial binding to IL-6R.
(76) The effect of a given substitution may be assayed in order to identify antibodies and fusion polypeptides (FynomAbs) retaining at least a part of the binding activity, specificity or antibody function or activity of unsubstituted reference antibody or fusion polypeptide (FynomAb). For example, an amino acid substitution, addition, deletion or insertion in a hypervariable region of an antibody or fusion polypeptide (FynomAb) that binds to IL-6R may be assayed for IL-6R binding activity or binding specificity. Accordingly, antibodies and fusion polypeptides (FynomAbs) having amino acid substitutions, as well as additions, deletions and insertions are included so long as at least a part of a function or activity such as binding affinity, binding specificity, binding to a target (e.g., IL-6R) on a cell in vitro (e.g., in culture), or in vivo is at least partially retained.
(77) The term identity and grammatical variations thereof, mean that two or more referenced entities are the same. Thus, where two amino acid sequences are identical, they have the same amino acid sequence. The identity may be over a defined area (region or domain) of the sequence. Areas, regions or domains of homology or identity mean that a portion of two or more referenced entities share homology or are the same. Thus, where two sequences are identical over one or more sequence regions they share identity in these regions.
(78) Amino acid substitutions may be conservative or non-conservative. A conservative substitution means the replacement of one amino acid by a biologically, chemically or structurally similar residue. Biologically similar means that the substitution is compatible with biological activity, e.g., retains binding to IL-17a or IL-6R. Structurally similar means that the amino acids have side chains with similar length, such as alanine, glycine and serine, or similar size. Chemical similarity means that the residues have the same charge or are both hydrophilic or hydrophobic. Particular non-limiting examples include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids, or glutamine for asparagine, serine for threonine, and the like.
(79) Amino acid substitutions may be with the same amino acid, except a naturally occurring L-amino acid may be substituted with a D-amino acid. Modifications therefore include one or more D-amino acids substituted for L-amino acids, or mixtures of D-amino acids substituted for L-amino acids.
(80) The extent of identity between two sequences may be ascertained using a computer program and mathematical algorithm known in the art. Such algorithms that calculate percent sequence identity (homology) generally account for sequence gaps and mismatches over the comparison region or area. For example, a BLAST (e.g., BLAST 2.0) search algorithm (see, e.g., Altschul et al., J. Mol. Biol. 215:403 (1990), publicly available through NCBI) has exemplary search parameters as follows: Mismatch 2; gap open 5; gap extension 2. For polypeptide sequence comparisons, a BLASTP algorithm is typically used in combination with a scoring matrix, such as PAM100, PAM 250, BLOSUM 62 or BLOSUM 50. FASTA (e.g., FASTA2 and FASTA3) and SSEARCH sequence comparison programs are also used to quantitate the extent of identity (Pearson et al., Proc. Natl. Acad. Sci. USA 85:2444 (1988); Pearson, Methods Mol. Biol. 132:185 (2000); and Smith et al., J. Mol. Biol. 147:195 (1981)). Programs for quantitating protein structural similarity using Delaunay-based topological mapping have also been developed (Bostick et al., Biochem. Biophys. Res. Commun. 304:320 (2003)).
(81) Modifications include changes to an activity or function of a reference composition (e.g., affinity or specific binding to IL-17a or IL-6R). Modified fynomers, antibodies and fusion polypeptides (FynomAbs) having altered characteristics, such as increased binding affinity, increased antagonist activity, may be produced using a method known in the art. For example, affinity maturation techniques may be used to improve antibody binding affinity (US 2004/0162413 A1; U.S. Pat. Nos. 6,656,467, 6,531,580, 6,590,079 and 5,955,358; Fiedler et al., Protein Eng. 15:931 (2002); Pancook et al., Hybrid. Hybridomics 20:383 (2001); Daugherty et al., Protein Eng. 11:825 (1998); Wu et al., Proc. Nat'l Acad. Sci. USA 95:6037 (1998); and Osbourn et al., Immunotechnology 2:181 (1996)).
(82) Fynomers, antibodies and fusion polypeptides (FynomAbs) include subsequences (e.g., fragments) and modified forms (e.g., sequence variants) as set forth herein. A fynomer subsequence refers to a functional fragment or subsequence of a reference fynomer, e.g., a sequence having deletion of one or more amino acids of any of SEQ ID NOs:1-7. An antibody subsequence refers to a functional fragment or subsequence of an immunoglobulin. Non-limiting examples of antibody subsequences may include an Fab, Fab, F(ab).sub.2, Fv, Fd, single-chain Fv (scFv), disulfide-linked Fvs (sdFv), V.sub.L, V.sub.H, diabody ((V.sub.L-V.sub.H).sub.2 or (V.sub.H-V.sub.L).sub.2), triabody (trivalent), tetrabody (tetravalent), minibody ((scF.sub.V-C.sub.H3).sub.2), IgGdeltaCH2, scFv-Fc or (scFv).sub.2-Fc fragment. In particular aspects, an Fab, Fab, F(ab).sub.2, Fv, Fd, single-chain Fv (scFv), disulfide-linked Fvs (sdFv) V.sub.L, V.sub.H, diabody ((V.sub.L-V.sub.H).sub.2 or (V.sub.H-V.sub.L).sub.2), triabody (trivalent), tetrabody (tetravalent), minibody ((scF.sub.V-C.sub.H3).sub.2), IgGdeltaCH2, scFv-Fc and (scFv).sub.2-Fc subsequence. Such subsequences and fusion polypeptides (FynomAbs) may have at least a part of a sequence set forth in any of SEQ ID NOs:8 or 9 (e.g., one or more CDRs (CDR1-CDR3 of heavy or light chain variable region sequence) and/or FRs of SEQ ID NOs:8-9).
(83) In particular aspects, a subsequence has substantially the same or has the same IL-17a or IL-6R binding affinity or IL-17a or IL-6R binding specificity, or one or more functions or activities of IL-17a binding fynomer or IL-6R binding antibody in vitro or in vivo, on a cell in vitro or in vivo. The terms functional subsequence and functional fragment when referring to a fynomer, antibody or fusion polypeptide (FynomAb) refers to a portion of a fynomer or antibody or fusion polypeptide (FynomAb) that retains at least a part of one or more functions or activities as an intact reference fynomer or antibody or fusion polypeptide (FynomAb), e.g., a fynomer that binds to IL-17a, an antibody that binds to IL-6R or a fusion polypeptide (FynomAb) that binds to IL-17a and IL-6R.
(84) Antibody subsequences, including single-chain antibodies, may include all or a portion of heavy or light chain variable region(s) (e.g., CDR1, CDR2 or CDR3) alone or in combination with all or a portion of one or more of the following: hinge region, CH1, CH2, and CH3 domains. Also included are antigen-binding subsequences of any combination of heavy or light chain variable region(s) (e.g., CDR1, CDR2 or CDR3) with a hinge region, CH1, CH2, and CH3 domains.
(85) Additional modifications of the bi-specific fusion polypeptides (FynomAbs) included in the invention are additions (derivatives)/insertions. Examples of additions may include an addition of a polypeptide sequence, which is an amino acid sequence having one or more molecules that is not normally present in a reference native (wild type) sequence is covalently attached to the sequence. A particular example of a peptide addition is one in which a second heterologous sequence, i.e., heterologous functional domain is attached (covalent or non-covalent binding) that confers a distinct or complementary function upon the bi-specific fusion polypeptide (FynomAb). Thus, the bi-specific fusion polypeptide (FynomAb) may include a heterologous domain, wherein the domain confers a distinct function, i.e. a heterologous functional domain. For example, an Fc region may be a chimera that includes portions of human IgG1 and IgG3 Fc regions.
(86) Heterologous functional domains that can be employed in this invention are not restricted to amino acid residues or domains. Thus, a heterologous functional domain may consist of any of a variety of different types of small or large functional moieties. Such moieties may include nucleic acid, peptide, carbohydrate, lipids, small organic molecules/compounds, such as a drug (e.g., an anti-cell proliferative drug), a metal (gold, silver), or a radioisotope. Thus, in another embodiment, a FynomAb that is detectably labeled is provided here.
(87) Non-limiting examples of heterologous domains may include purification or detection tags and labels. Specific examples of purification and detectable (detection) tags and labels may include enzymes (horseradish peroxidase, urease, catalase, alkaline phosphatase, beta-galactosidase, chloramphenicol transferase); enzyme substrates; ligands (e.g., biotin); receptors (avidin); radioactive isotopes/radionuclides (e.g., C.sup.14, S.sup.35, P.sup.32, P.sup.33, H.sup.3, I.sup.125, I.sup.131, gallium-67 and 68, scantium-47, indium-111, and radium-223); T7-, polyhistidine, His-, myc-, HA- and FLAG-tags; electron-dense reagents; energy transfer molecules; paramagnetic labels; fluorophores (fluorescein, rhodamine, phycoerthrin); chromophores; chemi-luminescent (imidazole, luciferase); bio-luminescent agents; contrast agents (e.g., gadolinium; manganese; barium sulfate; an iodinated or noniodinated agent); an ionic agent or nonionic agent; magnetic and paramagnetic agents (e.g., iron-oxide chelate); nanoparticle; a prosthetic group (e.g., streptavidin/biotin and avidin/biotin); a fluorescent material (e.g., umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin); a luminescent material (e.g., luminol); or a bioluminescent material (e.g., luciferase, luciferin, aequorin). Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert a substrate such as 3,3-,5,5--tetramethylbenzidine (TMB) to a blue pigment, which may be quantified. Ligands may bind other molecules such as biotin, which may bind avidin or streptavidin, and IgG, which can bind protein A.
(88) Additional non-limiting examples of detectable labels may include a radioactive material, such as a radioisotope, a metal or a metal oxide. Radioisotopes include radionuclides that emit alpha, beta or gamma radiation, such as one or more of: .sup.3H, .sup.10B, .sup.18F, .sup.11C, .sup.14C, .sup.13N, .sup.18O, .sup.15O, .sup.32P, P.sup.33, .sup.35S, .sup.35Cl, .sup.45Ti, .sup.46Sc, .sup.47Sc, .sup.51Cr, .sup.52Fe, .sup.59Fe, .sup.57Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.72As .sup.76Br, .sup.77Br, .sup.81mKr, .sup.82Rb, .sup.85Sr, .sup.89Sr, .sup.86Y, .sup.90Y, .sup.95Nb, .sup.94mTc, .sup.99mTc, .sup.97Ru, .sup.103Ru, .sup.105Rh, .sup.109Cd, .sup.111In, .sup.113Sn, .sup.113mIn, .sup.114In, I.sup.125, I.sup.131, .sup.140La, .sup.141Ce, .sup.149Pm, .sup.153Gd, .sup.157Gd .sup.153Sm, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.169Er, .sup.169Yb, .sup.175Yb, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.201Tl, .sup.203Pb, .sup.211At, .sup.212Bi or .sup.225Ac.
(89) Still further non-limiting examples of detectable labels may include a metal or a metal oxide such as gold, silver, copper, boron, manganese, gadolinium, iron, chromium, barium, europium, erbium, praseodynium, indium, or technetium.
(90) The drug that may be used as a heterologous domain that is attached to the antibody of fusion polypeptide (FynomAb) may be a cytotoxic agent. The term cytotoxic agent used in this context refers to a substance that decreases, inhibits, suppresses, reduces, interferes with or blocks the function, or growth, of cells and/or a substance that causes destruction of cells. The cytotoxic agent may be used to kill or inhibit the proliferation or replication of the target cells.
(91) Examples of cytotoxic agents may include diptheria toxin, cholera toxin, ricin and mitomycin C. Additional examples include Calicheamicin, Duocarmycin, PBD, auristatins and dolastatins (U.S. Pat. Nos. 5,635,483 and 5,780,588); calicheamicin (U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296), Gemcitabine, Cisplatin, Doxorubicin, Irinotecan, BCNU, streptozoicin, vincristine and 5-fluorouracil (U.S. Pat. No. 5,770,710; see also, e.g., U.S. Pat. Nos. 4,362,663; 4,371,533; 5,475,092; 5,585,499; 5,846,545; and 6,333,410).
(92) Further examples of cytotoxic agents may include taxanes (e.g., Taxol) and maytansinoids. Examples of maytansinoids, which inhibit microtubule formation in mammalian cells, may include maytansinol and maytansinol analogs. Examples of maytansinol analogues include those having a modified aromatic ring, and those having modifications at other positions (see, e.g., maytansine and maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042); synthetic maytansinol and derivatives and analogues thereof (U.S. Pat. Nos. 4,137,230; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757; 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929; 4,317,821; 4,322,348; 4,331,598; 4,361,650; 4,364,866; 4,424,219; 4,450,254; 4,362,663; and 4,371,533).
(93) The bi-specific fusion polypeptide FynomAb may have an addition or may be a derivative. For example the polypeptide may include a sugar residue, phosphate group, ubiquitin, fatty acid or lipid, or may be glycosylated, phosphorylated, acetylated, amidated or formylated. The polypeptide may be derivatized by a protecting/blocking group or any of numerous chemical modifications. Modification of the polypeptide may also be intra- or inter-molecular disulfide bond(s).
(94) Linkers, such as amino acid or peptidimimetic sequences may be inserted between the fynomer and/or antibody sequence and the heterologous functional domain so that the two entities maintain, at least in part, the distinct function or activity. In an embodiment, a fynomer domain is joined to a Heavy (H) chain or Light (L) chain immediately after the last amino acid at the amino(NH.sub.2)-terminus or the carboxy(C)-terminus of the Heavy (H) chain or the Light (L) chain. Linkers may have one or more properties that include a flexible conformation, an inability to form an ordered secondary structure or a hydrophobic or charged character which could promote or interact with either domain. Examples of amino acids typically found in flexible protein regions may include Gly, Asn and Ser. Other near neutral amino acids, such as Thr and Ala, may also be used in the linker sequence. The length of the linker sequence may vary without significantly affecting the function or activity of the fusion protein (see, e.g., U.S. Pat. No. 6,087,329). In a particular aspect, a fynomer and an antibody heavy or light chain are joined by a peptide sequence having from about 1 to 25 amino acid residues.
(95) Examples of linkers may also include chemical moieties and conjugating agents, such as sulfo-succinimidyl derivatives (sulfo-SMCC, sulfo-SMPB), disuccinimidyl suberate (DSS), disuccinimidyl glutarate (DSG) and disuccinimidyl tartrate (DST). Linkers further include a linear carbon chain, such as C.sub.N (where N=1-100 carbon atoms, e.g., C, CC, CCC, CCCC, CCCCC, CCCCCC, CCCCCCC, CCCCCCCC).
(96) It is understood that a fynomer, antibody or subsequence may have multiple (e.g., two or more) variations, modifications or labels. For example, a heavy or light chain sequence of an antibody may be coupled to biotin so that it can be detected with avidin as well as labeled with I.sup.125 so that it provides detectable signal. Other permutations and possibilities are readily apparent to those of ordinary skill in the art, and are considered to be within the scope of the invention.
(97) Examples of antibodies and fusion polypeptides (FynomAbs) may include mammalian, human, humanized, and primatized sequences. The term human, in reference to an antibody means that the amino acid sequence is fully human origin. A human antibody therefore refers to an antibody having human immunoglobulin amino acid sequences, i.e., human heavy and light chain variable and constant regions that specifically bind to target. A human IL-6R antibody or human anti-IL-6R antibody therefore refers to an antibody having human immunoglobulin amino acid sequence and binds to IL-6R. That is, all of the antibody amino acids are human or can or do exist in a human antibody. Thus, for example, an antibody that is non-human may be made fully human by substituting the non-human amino acid residues with amino acid residues that can or do exist in a human antibody. Amino acid residues present in human antibodies, CDR region maps and human antibody consensus residues are known in the art (see, e.g., Kabat, Sequences of Proteins of Immunological Interest, 4.sup.th Ed. US Department of Health and Human Services. Public Health Service (1987); and Chothia and Lesk J. Mol. Biol. 186:651 (1987)). A consensus sequence of human V.sub.H subgroup III, based on a survey of 22 known human V.sub.H III sequences, and a consensus sequence of human V.sub.L kappa-chain subgroup I, based on a survey of 30 known human kappa I sequences is described in Padlan Mol. Immunol. 31: 169 (1994); and Padlan Mol. Immunol. 28: 489 (1991)). Human antibodies therefore include antibodies in which one or more amino acid residues have been substituted with one or more amino acids present in another human antibody.
(98) The term humanized when used in reference to an antibody, means that the amino acid sequence of the antibody has non-human amino acid residues (e.g., mouse, rat, goat, rabbit, non-human primate, etc.) of one or more determining regions (CDRs) that specifically bind to the desired target (e.g., IL-6R) in an acceptor human immunoglobulin molecule, and one or more human amino acid residues in the Fv framework region (FR), which are amino acid residues that flank the CDRs. Human framework region residues of the immunoglobulin may be replaced with corresponding non-human residues. Residues in the human framework regions can therefore be substituted with a corresponding residue from the non-human. CDR donor antibody to alter, generally to improve, antigen affinity or specificity, for example. In addition, a humanized antibody may include residues, which are found neither in the human antibody nor in the donor CDR or framework sequences. For example, a framework substitution at a particular position that is not found in a human antibody or the donor non-human antibody may be predicted to improve binding affinity or specificity human antibody at that position.
(99) Antibody framework and CDR substitutions based upon molecular modeling are known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions (see, e.g., U.S. Pat. No. 5,585,089; and Riechmann et al., Nature 332:323 (1988)). Antibodies referred to as primatized are within the meaning of humanized as used herein, except that the acceptor human immunoglobulin molecule and framework region amino acid residues may be any primate amino acid residue (e.g., ape, gibbon, gorilla, chimpanzees orangutan, macaque), in addition to any human residue.
(100) Fynomer and antibody subsequences may be prepared by genetic techniques including expression of all or a part of the fynomer or antibody coding sequence into a host cell. IL-6R binding antibodies may be generated using techniques including conventional hybridoma technology, recombinant, and phage display technologies, or a combination thereof (see U.S. Pat. Nos. 4,902,614, 4,543,439, and 4,411,993; see, also Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol (eds.), 1980, and Harlow et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2nd ed. 1988). IL-6R binding monoclonal antibodies may also be obtained by direct cloning of immunoglobulin sequences from animals, including primate or human subjects.
(101) An animal such as mouse, rabbit, rat, sheep, cow or steer, sheep, goat, pig, horse, guinea pig, and primates including humans may be immunized with IL-6R in order to obtain an antibody that binds to IL-6R. Such animal may be a genetically modified non-human animal having human IgG gene loci (e.g., lambda or kappa light chain), which is capable of expressing human antibody. Transgenic animals with one or more human immunoglobulin genes (kappa or lambda) that do not express endogenous immunoglobulins are described, for example in, U.S. Pat. No. 5,939,598. Such animals may therefore be used to produce human antibodies. Non-limiting examples of the animals may include human transchromosomic KM Mice (Tomizuka et al., Proc. Natl. Acad. Sci. USA 97:722 (2000); and Ishida et al., Cloning Stem Cells 4:91 (2004)) which can produce human immunoglobulin genes (WO02/43478) and HAC mice (WO02/092812). Conventional hybridoma technology using splenocytes isolated from immunized animals that respond to the antigen and fused with myeloma cells may be used to obtain human monoclonal antibodies. Additional methods for producing human polyclonal antibodies and human monoclonal antibodies are described (see, e.g., Kuroiwa et al., Nat. Biotechnol. 20:889 (2002); WO 98/24893; WO 92/01047; WO 96/34096; WO 96/33735; U.S. Pat. Nos. 5,413,923; 5,625,126; 5,633,425; 5,569,825; 5,661,016; 5,545,806; 5,814,318; 5,885,793; 5,916,771; and 5,939,598). An overview of the technology for producing human antibodies is described in Lonberg and Huszar (Int. Rev. Immunol. 13: 65 (1995)).
(102) Fynomer and antibody subsequences may also be produced by proteolytic hydrolysis. An antibody, for example, may be digested with pepsin or papain. Antibody fragments produced by enzymatic cleavage with pepsin provide a 5S fragment denoted F(ab).sub.2. This fragment may be further cleaved using a thiol reducing agent to produce 3.5S Fab monovalent fragments. Alternatively, an enzymatic cleavage using pepsin directly produces two monovalent Fab fragments and the Fc fragment (see, e.g., U.S. Pat. Nos. 4,036,945 and 4,331,647; and Edelman et al., Methods Enymol. 1:422 (1967)). Other methods of cleaving antibodies, such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic or chemical cleavage may also be used. Single-chain Fvs and antibodies may be produced as described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al., Methods Enzymol. 203:46 (1991); Shu et al., Proc. Natl. Acad. Sci. USA 90:7995 (1993); and Skerra et al., Science 240:1038 (1988).
(103) Antibodies may be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; WO91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunol. 28:489 (1991); Studnicka et al., Protein Engineering 7:805 (1994); Roguska. et al., Proc. Nat'l. Acad. Sci. USA 91:969 (1994)), and chain shuffling (U.S. Pat. No. 5,565,332). Human consensus sequences (Padlan, Mol. Immunol. 31:169 (1994); and Padlan, Mol. Immunol. 28:489 (1991)) may be used to humanize antibodies (Carter et al., Proc. Natl. Acad. Sci. USA 89:4285 (1992); and Presta et al., J. Immunol. 151:2623 (1993)).
(104) Methods for producing chimeric antibodies are known in the art (e.g., Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Gillies et al., J. Immunol. Methods 125:191 (1989); and U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816,397). Chimeric antibodies in which a variable domain from an antibody of one species is substituted for the variable domain of another species are described, for example, in Munro, Nature 312:597 (1984); Neuberger et al., Nature 312:604 (1984); Sharon et al., Nature 309:364 (1984); Morrison et al., Proc. Nat'l. Acad. Sci. USA 81:6851 (1984); Boulianne et al., Nature 312:643 (1984); Capon et al., Nature 337:525 (1989); and Traunecker et al., Nature 339:68 (1989).
(105) Nucleic acids encoding fynomers, antibodies and fusion polypeptides (FynomAbs) are also provided. In one embodiment, a nucleic acid encodes a sequence at least 60% or more (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any fynomer sequence that binds to IL-17a, for example, 60% or more identical to the nucleic acid sequence that encodes the polypeptide as set forth in SEQ ID NOs:1-7.
(106) In another embodiment, a nucleic acid encodes a sequence at least 60% or more (e.g., 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%) identical to any heavy or light chain variable region sequence as set forth in SEQ ID NOs:8 or 9. In an additional embodiment, a nucleic acid encodes a sequence at least 60% or more (e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%) identical to any heavy or light chain variable region sequence of an antibody that binds to IL-6R, such as heavy or light chain sequence as set forth in SEQ ID NOs:8 or 9 that is fused or conjugated to any fynomer sequence that binds to IL-17a, for example, a sequence set forth in SEQ ID NOs:1-7. In a further embodiment, a nucleic acid encodes a sequence having one or more amino acid additions, deletions or substitutions of SEQ ID NOs:1-7, or SEQ ID NOs:8 or 9, or a fusion polypeptide comprising any of SEQ ID NOs:1-7 fused to any of SEQ ID NOs:8 or 9.
(107) The terms nucleic acid and polynucleotide and the like refer to at least two or more ribo- or deoxy-ribonucleic acid base pairs (nucleotides) that are linked through a phosphodiester bond or equivalent. Nucleic acids include polynucleotides and polynucleosides. Nucleic acids include single, double or triplex, circular or linear, molecules. Exemplary nucleic acids include but are not limited to: RNA, DNA, cDNA, naturally occurring and non-naturally occurring nucleic acid, e.g., synthetic nucleic acid.
(108) Nucleic acids may be of various lengths. Nucleic acid lengths typically range from about 20 nucleotides to 20 Kb, or any numerical value or range within or encompassing such lengths, 10 nucleotides to 10 Kb, 1 to 5 Kb or less, 1000 to about 500 nucleotides or less in length. Nucleic acids can also be shorter, for example, 100 to about 500 nucleotides, or from about 12 to 25, 25 to 50, 50 to 100, 100 to 250, or about 250 to 500 nucleotides in length, or any numerical value or range or value within or encompassing such lengths. In particular aspects, a nucleic acid sequence has a length about 10-20, 20-30, 30-50, 50-100, 100-150, 150-200, 200-250, 250-300, 300-400, 400-500, 500-1000 or 1000-2000, nucleotides, or any numerical value or range within or encompassing such lengths. Shorter polynucleotides are commonly referred to as oligonucleotides or probes of single- or double-stranded DNA. However, there is no upper limit to the length of such oligonucleotides.
(109) The term isolated, when used in relation to the components (e.g., fynomers, antibodies, heavy or light chains sequences, fusion polypeptides (FynomAbs), nucleic acids encoding same, etc.), means that the component is made by the hand of man or is separated, completely or at least in part, from their naturally occurring in vivo environment. Generally, an isolated component substantially free of one or more materials with which they normally associate in nature, for example, one or more protein, nucleic acid, lipid, carbohydrate, cell membrane. The term isolated does not exclude alternative physical forms of the component, such as multimers/oligomers, variants, modifications or derivatized forms, or forms expressed in host cells produced by the hand of man. The term isolated also does not exclude composition or formulation containing the component that is produced by the hand of man.
(110) An isolated component may also be purified when it is free of most or all of the materials with which it typically associates in nature. Thus, an isolated fusion polypeptide (FynomAb) that also is substantially pure or purified does not include polypeptides or polynucleotides present among millions of other sequences, such as in a polypeptide library or nucleic acids in a genomic or cDNA library, for example. A purified component may be combined with one or more other molecules. Thus, purified does not exclude combinations of the components, such as combinations of FynomAbs (multiple FynomAbs), and FynomAbs in combination with other active agents or drugs.
(111) Nucleic acids may be produced using various standard cloning and chemical synthesis techniques. Techniques include, but are not limited to nucleic acid amplification, e.g., polymerase chain reaction (PCR), with genomic DNA or cDNA targets using primers (e.g., a degenerate primer mixture) capable of annealing to antibody encoding sequence. Nucleic acids can also be produced by chemical synthesis (e.g., solid phase phosphoramidite synthesis) or transcription from a gene. The sequences produced can then be translated in vitro, or cloned into a plasmid and propagated and then expressed in a cell (e.g., a host cell such as eukaryote or mammalian cell, yeast or bacteria, in an animal or in a plant).
(112) Nucleic acid may be inserted into a nucleic acid construct in which expression of the nucleic acid is influenced or regulated by an expression control element. An expression control element refers to a nucleic acid sequence element that regulates or confers expression of a nucleic acid sequence to which it is operatively linked. Expression control elements include, as appropriate, promoters, enhancers, transcription terminators, gene silencers, a start codon (e.g., ATG) in front of a protein-encoding gene, etc.
(113) An expression control element operatively linked to a nucleic acid sequence controls transcription and, as appropriate, translation of the nucleic acid sequence. Expression control elements include elements that activate transcription constitutively, that are inducible (i.e., require an external signal for activation), or derepressible (i.e., require a signal to turn transcription off; when the signal is no longer present, transcription is activated or derepressed), or specific for cell-types or tissues (i.e., tissue-specific control elements).
(114) Nucleic acid may be inserted into a plasmid for propagation into a host cell and for subsequent genetic manipulation. A plasmid is a nucleic acid that may be propagated in a host cell; plasmids may optionally contain expression control elements in order to drive expression of the nucleic acid encoding fynomer, antibody (heavy or light chains) or fusion polypeptide (FynomAb) in the host cell. A vector is used herein synonymously with a plasmid and may also include an expression control element for expression in a host cell (e.g., expression vector). Plasmids and vectors generally contain at least an origin of replication for propagation in a cell and a promoter. Plasmids and vectors are therefore useful for genetic manipulation and expression of fynomer, antibody (heavy or light chains) or fusion polypeptide (FynomAb).
(115) Nucleic acids encoding fynomer, antibody (heavy or light chains) or fusion polypeptide (FynomAb) may be produced synthetically or using recombinant methods, or isolated from a cell such as a hybridoma. Isolated nucleic acids may be inserted into a suitable expression vector, and introduced into suitable host cells (e.g., CHO, plant and other cells) which may be cultured for the production of fynomer, antibody (heavy or light chains) or fusion polypeptide (FynomAb).
(116) In accordance with the invention, there are provided host cells that express or are transformed with a nucleic acid that encodes a fynomer, antibody (heavy or light chains) or fusion polypeptide (FynomAb) of the invention. Host cells and progeny thereof may be stably or transiently transfected for expression of fynomer, antibody (heavy or light chains) or fusion polypeptide (FynomAb).
(117) Host cells may include but are not limited to prokaryotic and eukaryotic cells such as bacteria, fungi (yeast), plant, insect, and animal (e.g., mammalian, including primate and human) cells. For example, bacteria transformed with recombinant bacteriophage nucleic acid, plasmid nucleic acid or cosmid nucleic acid expression vectors; yeast transformed with recombinant yeast expression vectors; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid); insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus); and animal cell systems infected with recombinant virus expression vectors (e.g., retroviruses, adenovirus, vaccinia virus), or transformed animal cell systems engineered for stable expression.
(118) The term transformed or transfected when use in reference to a cell (e.g., a host cell) or organism, means a genetic change in a cell following incorporation of an exogenous molecule, for example, a protein or nucleic acid (e.g., a transgene) into the cell. Thus, a transfected or transformed cell is a cell into which, or a progeny thereof in which an exogenous molecule has been introduced by the hand of man, for example, by recombinant DNA techniques.
(119) The cell(s) may be propagated so that the desired polypeptide is generated. The progeny of a transfected or transformed cell may not be identical to the parent cell, since there may be mutations that occur during replication.
(120) The invention further provides a pharmaceutical composition comprising the bi-specific fusion polypeptide of the invention and a pharmaceutically or physiologically acceptable carrier, diluent or excipient. As used herein, the term pharmaceutically acceptable and physiologically acceptable, when referring to a carrier, diluent or excipient may be a solvent (aqueous or non-aqueous), detergent, solution, emulsion, dispersion media, coating or isotonic and absorption promoting or delaying agent, that is compatible with pharmaceutical administration and with the other components in the composition. Pharmaceutical composition of the present invention may be provided in the form of tablet (coated or uncoated), capsule (hard or soft), microbead, emulsion, powder, granule, crystal, suspension, syrup or elixir.
(121) A pharmaceutical composition may be formulated so that it is compatible with a particular route of administration or use. A pharmaceutical composition for parenteral, intradermal, or subcutaneous administration may contain a sterile diluent, such as water, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents. The composition may further contain one or more preservatives to prevent microorganism growth (e.g., antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose).
(122) A pharmaceutical composition for injection may be in the form of sterile aqueous solution (where water soluble) or extemporaneous preparation for sterile injectable solution or dispersion consisting of a dispersion medium and sterile powders. For intravenous administration, examples of suitable carriers may include physiological saline, bacteriostatic water, Cremophor ELT (BASF, Parsippany, N.J.) and phosphate buffered saline (PBS). The carrier may be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and polyetheylene glycol), or a suitable mixture thereof. Fluidity may be maintained, for example, by the use of a coating such as lecithin, or by the use of surfactants. Examples antibacterial and antifungal agents may include parabens, chlorobutanol, phenol, ascorbic acid and thimerosal. Including an agent that delays absorption, for example, aluminum monostearate and gelatin can prolong absorption of injectable compositions. Polysorbate 20 or polysorbate 80 may be added into the composition, for example, up to 1%. Other non-limiting examples of additives may include histidine HCl, ,-treahlose dehydrate.
(123) Additional pharmaceutical formulations and delivery systems are known to the skilled artisan and are applicable in the methods of the invention (see, e.g., Remington's Pharmaceutical Sciences (1990) 18th ed., Mack Publishing Co., Easton, Pa.; The Merck Index (1996) 12th ed., Merck Publishing Group, Whitehouse, N.J.; Pharmaceutical Principles of Solid Dosage Forms, Technonic Publishing Co., Inc., Lancaster, Pa., (1993); and Poznansky, et al., Drug Delivery Systems, R. L. Juliano, ed., Oxford, N.Y. (1980), pp. 253-315).
(124) The invention provides a method and use of the bi-specific fusion polypeptide for modulating or treating a response, disorder or disease associated with Il-17a and/or IL-6R function or activity. Examples of responses, disorders and diseases may include, without limitation, immune responses, disorders and diseases, inflammatory responses, disorders and diseases, and inflammation. Examples of responses, disorders and diseases also include, without limitation, autoimmune responses, disorders and diseases. Examples of responses may further include T cell and/or B cell responses, disorders and diseases.
(125) In one embodiment, a method or use in which the bi-specific fusion polypeptide or the pharmaceutical composition as set forth herein is administered to a subject in need of the treatment for an immune response, disorder or disease, an inflammatory response, disorder or disease, or inflammation is provided. In another embodiment, a method or use for the treatment of an autoimmune disorder or disease is provided. In an additional embodiment, a method or use for modulating a T cell and/or B cell response, or for treating a disorder and disease associated with T cell and/or B cell response is provided. In a further embodiment, a method or use for modulating Il-17a and/or IL-6R function or activity is provided.
(126) Examples of responses, disorders and diseases that can be modulated or treated in accordance with the invention may include, but are not limited to, acute and chronic undesirable or aberrant immune responses, disorders or diseases, inflammatory responses, disorders or diseases or inflammation. Examples of responses, disorders and diseases may also include, but are not limited to, acute and chronic autoimmune responses, disorders and diseases. The responses, disorders and diseases may be those mediated by antibody or cell, or a combination of antibody and cell. Furthermore, responses, disorders and diseases may be those mediated by Il-17a and/or IL-6R function or activity. Moreover, responses, disorders and diseases may be those amenable to treatment by modulating Il-17a and/or IL-6R function or activity.
(127) In one embodiment, a method or use of the bi-specific fusion polypeptide for decreasing, reducing, inhibiting, suppressing, limiting or controlling an acute or chronic undesirable or aberrant immune response, disorder or disease, inflammatory response, disorder or disease or inflammation in a subject is provided. In an embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an acute or chronic autoimmune response, disorder or disease in a subject is provided. In further embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an acute or chronic antibody and/or cell mediated response, disorder or disease in a subject is provided. In a still further embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an acute or chronic response, disorder or disease that is mediated by Il-17a and/or IL-6R function or activity is provided. In yet further embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an acute or chronic response, disorder or disease that is amenable to treatment by modulating Il-17a and/or IL-6R function or activity is provided.
(128) The terms immune disorder and immune disease mean an immune function or activity, which is characterized by different physiological symptoms or abnormalities, depending upon the disorder or disease. An undesirable immune response or aberrant immune response as used herein, refers to any immune response, activity or function that is greater or less than desired or physiologically normal response, activity or function. Examples include acute or chronic immune responses, activities or functions. Undesirable immune response is generally characterized as an undesirable or aberrant increased or inappropriate response, activity or function of the immune system. However, an undesirable immune response, function or activity may be a normal response, function or activity, for example. Thus, normal immune responses so long as they are undesirable, even if not considered aberrant, are included within the meaning of these terms. An undesirable immune response, function or activity can also be an abnormal response, function or activity. An abnormal (aberrant) immune response, function or activity deviates from normal.
(129) One non-limiting example of an undesirable or aberrant immune response is where the immune response is hyper-responsive, such as in the case of an autoimmune disorder or disease. Another non-limiting example of an undesirable or aberrant immune response is where an immune response leads to acute or chronic inflammatory response or inflammation in any tissue or organ, such as in skeletal joints (rheumatoid arthritis, juvenile idiopathic arthritis), lung or airways (allergy), or gut or gastrointestinal tract (Crohn's disease, inflammatory bowel disease (IBD) or ulcerative colitis).
(130) Undesirable or aberrant immune responses, inflammatory responses, inflammation are characterized by many different physiological adverse symptoms or complications, which may be humoral, cell-mediated or a combination thereof. Responses, disorders and diseases that may be treated in accordance with the invention include, but are not limited to, those that either directly or indirectly lead to or cause cell or tissue/organ damage in a subject. At the whole body, regional or local level, an immune response, inflammatory response, or inflammation may be characterized by swelling, pain, headache, fever, nausea, skeletal joint pain, swelling, stiffness or lack of mobility, rash, redness or other discoloration. At the cellular level, an immune response, inflammatory response, or inflammation may be characterized by one or more of T cell activation and/or differentiation, cell infiltration of the region by macrophages, monocytes, etc., production of antibodies, production of cytokines, lymphokines, chemokines, interferons and interleukins, cell growth and maturation factors (e.g., proliferation and differentiation factors), cell accumulation or migration and cell, tissue or organ damage. Thus, methods and uses of the invention include treatment of and an ameliorative effect upon any such physiological symptoms or cellular or biological responses characteristic of immune responses, inflammatory response, or inflammation.
(131) Autoimmune responses, disorders and diseases are generally characterized as an undesirable or aberrant response, activity or function of the immune system characterized by increased or undesirable humoral or cell-mediated immune responsiveness or memory, or decreased or insufficient tolerance to self-antigens. Autoimmune responses, disorders and diseases that may be treated in accordance with the invention include but are not limited to responses, disorders and diseases that cause cell or tissue/organ damage in the subject.
(132) In one embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an undesirable or aberrant immune response, immune disorder, inflammatory response, or inflammation in a subject is provided. In another embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an autoimmune response, disorder or disease in a subject is provided. In further embodiment, a method or use for decreasing, reducing, inhibiting, suppressing, limiting or controlling an adverse symptom of the undesirable or aberrant immune response, immune disorder, inflammatory response, or inflammation, or an adverse symptom of the autoimmune response, disorder or disease is provided.
(133) In one aspect, the method or use according to the invention may result in a reduction in occurrence, frequency, severity, progression, or duration of a symptom of the condition (e.g., undesirable or aberrant immune response, immune disorder, inflammatory response, or inflammation). For example, the method or use of the invention may protect the subject from the progression of, or decrease, reduce, inhibit, suppress, limit or control, severity, frequency, duration or probability of an adverse symptom of the undesirable or aberrant immune response, immune disorder, inflammatory response, or inflammation, or an autoimmune response, disorder or disease.
(134) Examples of adverse symptoms of an undesirable or aberrant immune response, immune disorder, inflammatory response, or inflammation, or an adverse symptom of an autoimmune response, disorder or disease may include swelling, pain, rash, discoloration, headache, fever, nausea, diarrhea, bloat, lethargy, skeletal joint stiffness or reduced mobility, difficulty with breathing, reduced muscle or limb mobility, paralysis, a sensory impairment, such as vision or tissue or cell damage. The adverse symptom may occur in particular tissues or organs, or regions or areas of the body, such as in skin, epidermal or mucosal tissue, gut, gastrointestinal, bowel, genito-urinary tract, pancreas, thymus, lung, liver, kidney, muscle, central or peripheral nerves, spleen, skin, a skeletal joint (e.g., knee, ankle, hip, shoulder, wrist, finger, toe, or elbow), blood or lymphatic vessel, or a cardio-pulmonary tissue or organ. Additional examples of adverse symptoms of an autoimmune response, disorder or disease may include T cell production, survival, proliferation, activation or differentiation, and/or production of auto-antibodies, or pro-inflammatory cytokines or chemokines (e.g., IL-17a and IL-6).
(135) Non-limiting examples of aberrant or undesirable immune responses, disorders and diseases may include inflammatory responses, disorders and diseases, inflammation, autoimmune responses, disorders and diseases, treatable in accordance with the invention include: polymyositis, vasculitis syndrome, giant cell arteritis, Takayasu arteritis, relapsing, polychondritis, acquired hemophilia A, Still's disease, adult-onset Still's disease, amyloid A amyloidosis, polymyalgia rheumatica, Spondyloarthritides, Pulmonary arterial hypertension, graft-versus-host disease, autoimmune myocarditis, contact hypersensitivity (contact dermatitis), gastro-oesophageal reflux disease, erythroderma, Behet's disease, amyotrophic lateral sclerosis, transplantation, Neuromyelitis Optica, rheumatoid arthritis, juvenile rheumatoid arthritis, malignant rheumatoid arthritis, Drug-Resistant Rheumatoid Arthritis, Neuromyelitis optica, Kawasaki disease, polyarticular or systemic juvenile idiopathic arthritis, psoriasis, chronic obstructive pulmonary disease (COPD), Castleman's disease, asthma, allergic asthma, allergic encephalomyelitis, arthritis, arthritis chronica progrediente, reactive arthritis, psoriatic arthritis, enterophathic arthritis, arthritis deformans, rheumatic diseases, spondyloarthropathies, ankylosing spondylitis, Reiter syndrome, hypersensitivity (including both airway hypersensitivity and dermal hypersensitivity), allergies, systemic lupus erythematosus (SLE), cutaneous lupus erythematosus, erythema nodosum leprosum, Sjgren's Syndrome, inflammatory muscle disorders, polychondritis, Wegener's granulomatosis, dermatomyositis, Steven-Johnson syndrome, chronic active hepatitis, myasthenia gravis, idiopathic sprue, autoimmune inflammatory bowel disease, ulcerative colitis, Crohn's disease, Irritable Bowel Syndrome, endocrine ophthalmopathy, scleroderma, Grave's disease, sarcoidosis, multiple sclerosis, primary biliary cirrhosis, vaginitis, proctitis, insulin-dependent diabetes mellitus, insulin-resistant diabetes mellitus, juvenile diabetes (diabetes mellitus type I), autoimmune haematological disorders, hemolytic anemia, aplastic anemia, pure red cell anemia, idiopathic thrombocytopenia (ITP), autoimmune uveitis, uveitis (anterior and posterior), keratoconjunctivitis sicca, vernal keratoconjunctivitis, interstitial lung fibrosis, glomerulonephritis (with and without nephrotic syndrome), idiopathic nephrotic syndrome or minimal change nephropathy, inflammatory disease of skin, cornea inflammation, myositis, loosening of bone implants, metabolic disorder, atherosclerosis, dislipidemia, bone loss, osteoarthritis, osteoporosis, periodontal disease of obstructive or inflammatory airways diseases, bronchitis, pneumoconiosis, pulmonary emphysema, acute and hyperacute inflammatory reactions, acute infections, septic shock, endotoxic shock, adult respiratory distress syndrome, meningitis, pneumonia, cachexia wasting syndrome, stroke, herpetic stromal keratitis, dry eye disease, iritis, conjunctivitis, keratoconjunctivitis, Guillain-Barre syndrome, Stiff-man syndrome, Hashimoto's thyroiditis, autoimmune thyroiditis, encephalomyelitis, acute rheumatic fever, sympathetic ophthalmia, Goodpasture's syndrome, systemic necrotizing vasculitis, antiphospholipid syndrome, Addison's disease, pemphigus vulgaris, pemphigus foliaceus, dermatitis herpetiformis, atopic dermatitis, eczematous dermatitis, aphthous ulcer, lichen planus, autoimmune alopecia, Vitiligo, autoimmune hemolytic anemia, autoimmune thrombocytopenic purpura, pernicious anemia, sensorineural hearing loss, idiopathic bilateral progressive sensorineural hearing loss, autoimmune polyglandular syndrome type I or type II, immune infertility or immune-mediated infertility.
(136) The term contacting means direct or indirect interaction between two or more entities (e.g., between a fusion polypeptide (FynomAb) and a target, such as IL-17a and/or IL-6R). A particular example of direct interaction is binding. Contacting as used herein may be contacting in solution, in solid phase, in vitro, ex vivo, in a cell or in vivo. Contacting in vivo may be referred to as administering, administration, to administer, delivering or delivery to a subject or patient.
(137) In the method or use of the present invention, the fusion polypeptide or composition as set forth herein may be administered prior to, substantially contemporaneously with, or following an onset of undesirable or aberrant immune response, immune disorder, inflammatory response, or inflammation, or an autoimmune response, disorder or disease, or one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the foregoing. Thus, the method or use of the invention may be practiced prior to (i.e. prophylaxis), concurrently with or after an evidence of the response, disorder or disease begins, or one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the undesirable or aberrant immune response, immune disorder, inflammatory response, inflammation or an autoimmune response, disorder or disease. Administering the fusion polypeptide or composition as set forth herein prior to, concurrently with or immediately following development of an adverse symptom may decrease, reduce, inhibit, suppress, limit or control the occurrence, frequency, severity, progression, or duration of one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the undesirable or aberrant immune response, immune disorder, inflammatory response, inflammation or autoimmune response, disorder or disease.
(138) According to the method or use of the present invention, the bi-specific fusion polypeptide of the present invention may be formulated and/or administered in combination with a second agent, such as an immunosuppressive, anti-inflammatory, or palliative agent. The fusion polypeptide of the present invention may be administered prior to, substantially contemporaneously with or following administering the second agent, such as an immunosuppressive, anti-inflammatory, or palliative agent. The fusion polypeptide of the present invention may be formulated in combination with the second agent such as an immunosuppressive, anti-inflammatory, or palliative agent.
(139) Non-limiting examples of the second agents may include anti-inflammatory agents, such as steroidal and non-steroidal anti-inflammatory drugs (NSAIDs) and anti-inflammatory biologics such as antibodies that limit or control inflammatory responses or symptoms. Second agents and drugs include immunosuppressive corticosteroids (steroid receptor agonists) such as budesonide, prednisone, flunisolide; anti-inflammatory agents such as flunisolide hydrofluoroalkane, estrogen, progesterone, dexamethasone and loteprednol; beta-agonists (e.g., short or long-acting) such as bambuterol, formoterol, salmeterol, albuterol; anticholinergics such as ipratropium bromide, oxitropium bromide, cromolyn and calcium-channel blocking agents; antihistamines such as terfenadine, astemizole, hydroxyzine, chlorpheniramine, tripelennamine, cetirizine, desloratadine, mizolastine, fexofenadine, olopatadine hydrochloride, norastemizole, levocetirizine, levocabastine, azelastine, ebastine and loratadine; antileukotrienes (e.g., anti-cysteinyl leukotrienes (CysLTs)) such as oxatomide, montelukast, zafirlukast and zileuton; phosphodiesterase inhibitors (e.g., PDE4 subtype) such as ibudilast, cilomilast, BAY 19-8004, theophylline (e.g., sustained-release) and other xanthine derivatives (e.g., doxofylline); thromboxane antagonists such as seratrodast, ozagrel hydrochloride and ramatroban; prostaglandin antagonists such as COX-1 and COX-2 inhibitors (e.g., celecoxib and rofecoxib), aspirin; and potassium channel openers. Additional non-limiting examples of classes of other agents and drugs include anti-inflammatory agents that are immunomodulatory therapies, such as pro-inflammatory cytokine antagonists, such as TNF antagonists (e.g. etanercept, aka Enbrel); immune cell antagonists, such as the B cell depleting agent rituximab, and the T cell costimulation blocker abatacept, which have been used to treat rheumatoid arthritis, and anti-inflammatory antibodies that bind to cytokines, such as anti-IgE (e.g., rhuMAb-E25 omalizumab), and anti-TNF, IFN, IL-1, IL-2, IL-5, IL-6, IL-9, IL-13, IL-16, and growth factors such as granulocyte/macrophage colony-stimulating factor.
(140) As disclosed herein, the method or use of the present invention using the bi-specific fusion polypeptide can provide a detectable or measurable therapeutic benefit or improvement to a subject.
(141) The therapeutic benefit or improvement may be any measurable or detectable, objective or subjective, transient, temporary, or longer-term benefit to the subject or improvement in the response, disorder or disease, or one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the undesirable or aberrant response, disorder or disease. Therapeutic benefits and improvements may include, but are not limited to, decreasing, reducing, inhibiting, suppressing, limiting or controlling the occurrence, frequency, severity, progression, or duration of an adverse symptom of undesirable or aberrant response, disorder or disease. Therapeutic benefits and improvements may also include, but are not limited to, decreasing, reducing, inhibiting, suppressing, limiting or controlling amounts or activity of inflammation and inflammatory responses, such as T cells, B-cells, auto-antibodies, immune cell infiltration or mobilization, pro-inflammatory cytokines, lymphokines or chemokines.
(142) According to the present invention, an effective or sufficient amount of the bi-specific fusion polypeptide is administered to a subject. An effective amount or sufficient amount refers to an amount that provides, in single or multiple doses, alone or in combination, with one or more other components (therapeutic agent such as a drug), treatments, protocols, or therapeutic regimens agents, a detectable response of any duration of time (long or short term), an expected or desired outcome in or a benefit to a subject of any measurable or detectable degree or for any duration of time (e.g., for minutes, hours, days, months, years, or cured).
(143) The term effective amount or sufficient amount for treatment (e.g., to ameliorate or to provide a therapeutic benefit or improvement) typically refers to an amount effective to provide a response, disorder or disease, of one, multiple or all adverse symptoms, consequences or complications of the response, disorder or disease, one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications, for example, those caused by or associated with an undesirable or an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, to a measurable extent, although decreasing, reducing, inhibiting, suppressing, limiting or controlling progression or worsening of the response, disorder or disease of a cell, tissue or organ, or an adverse symptom thereof, is a satisfactory outcome.
(144) An effective amount or a sufficient amount may but need not be provided in a single administration, may require multiple administrations, and, can but need not be, administered alone or in combination with another composition (e.g., agent), treatment, protocol or therapeutic regimen. For example, the amount may be proportionally increased as indicated by the need of the subject, type, status and severity of the response, disorder, or disease treated or side effects (if any) of treatment. In addition, an effective amount or a sufficient amount need not be effective or sufficient if given in single or multiple doses without a second composition (e.g., another drug or agent), treatment, protocol or therapeutic regimen, since additional doses, amounts or duration above and beyond such doses, or additional compositions (e.g., drugs or agents), treatments, protocols or therapeutic regimens may be included in order to be considered effective or sufficient in a given subject. Amounts considered effective also include amounts that result in a reduction of the use of another treatment, therapeutic regimen or protocol.
(145) As is typical for treatments, some subjects may exhibit a greater response, or less or no response to a given treatment. An effective amount or a sufficient amount therefore need not be effective in each and every subject treated, prophylactically or therapeutically, nor a majority of treated subjects in a given group or population. An effective amount or a sufficient amount means effectiveness or sufficiency in a particular subject, not a group or the general population. Accordingly, appropriate amounts will depend upon the condition treated, the therapeutic effect desired, as well as the individual subject (e.g., the bioavailability within the subject, gender or age).
(146) The term ameliorate refers to a detectable or measurable improvement in a subject's condition or an underlying cellular response. A detectable or measurable improvement includes a subjective or objective decrease, reduction, inhibition, suppression, limit or control in the occurrence, frequency, severity, progression, or duration of the response, disorder or disease, such as an undesirable or undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, or one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the response, disorder or disease, such as an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, or a reversal of the response, disorder or disease, such as an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. Such improvements can also occur at the cellular level.
(147) Thus, a successful treatment outcome can lead to a therapeutic effect, or benefit of decreasing, reducing, inhibiting, suppressing, limiting, controlling or preventing the occurrence, frequency, severity, progression, or duration of an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, or one or more adverse symptoms or underlying causes or consequences of the undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, in a subject. Treatment methods affecting one or more underlying causes of the response, disorder or disease or adverse symptom are therefore considered to be beneficial. A decrease or reduction in worsening, such as stabilizing an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, is also a successful treatment outcome.
(148) A therapeutic benefit or improvement therefore need not be complete ablation of an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, or any one, most or all adverse symptoms, complications, consequences or underlying causes associated with the an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. Thus, a satisfactory endpoint may be achieved when there is an incremental improvement in a subject's response, disorder or disease, or a partial decrease, reduction, inhibition, suppression, limit, control or prevention in the occurrence, frequency, severity, progression, or duration, or inhibition or reversal, of the response, disorder or disease (e.g., stabilizing one or more symptoms or complications), such as an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, or one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, over a short or long duration of time (hours, days, weeks or months).
(149) Effectiveness of a method or use, such as a treatment that provides a potential therapeutic benefit or improvement of a response, disorder or disease, such as an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, may be ascertained by various methods. Such methods include, for example, scores measuring swelling, pain, rash, headache, fever, nausea, diarrhea, bloat, lethargy, skeletal joint stiffness, lack of mobility, rash, or tissue or cell damage. Measuring T or B cell activation and/or differentiation, cell infiltration of a region, cell accumulation or migration to a region, production of antibodies, cytokines, lymphokines, chemokines, interferons and interleukins, cell growth and maturation factors using various immunological assays, such as ELISA. Determining the degree of cell, tissue or organ damage may be ascertained by CT scanning, MRI, ultrasound, molecular contrast imaging, or molecular ultrasound contrast imaging. For skeletal joints, inflammation may be assessed by patient self-assessment, tender joint-counts and swollen joint-counts, and the erythrocyte sedimentation rate (ESR) or C-reactive protein (CRP). For gastrointestinal tract, inflammation may be assessed by, endoscopy (colonoscopy, gastroscopy, ERCP), for example. For inflammation of the central nervous system (CNS), cells and cytokines in spinal tap reflect inflammation, for example.
(150) The term subject refers to an animal, typically a mammalian animal, such as human, a non-human primate (e.g., ape, gibbon, chimpanzee, orangutan or macaque), a companion animal (e.g., dog and cat), a farm animal (e.g., horse, cow, goat, sheep or pigs) or an experimental animal (e.g., mouse, rat, rabbit or guinea pig). Examples of subjects may include animal disease models, for example, animal models of an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease (e.g., CIA, BXSB, EAE and SCID mice), for in vivo analysis.
(151) Examples of subjects appropriate for the treatment may include those having an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, those undergoing treatment for an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, as well as those who have undergone treatment or therapy for an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, including subjects where the undesirable or aberrant immune response, disorder or disease, inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, is in remission.
(152) Examples of the subjects may include those having or at risk of having any of: polymyositis, vasculitis syndrome, giant cell arteritis, Takayasu arteritis, relapsing, polychondritis, acquired hemophilia A, Still's disease, adult-onset Still's disease, amyloid A amyloidosis, polymyalgia rheumatica, Spondyloarthritides, Pulmonary arterial hypertension, graft-versus-host disease, autoimmune myocarditis, contact hypersensitivity (contact dermatitis), gastro-oesophageal reflux disease, erythroderma, Behet's disease, amyotrophic lateral sclerosis, transplantation, Neuromyelitis Optica, rheumatoid arthritis, juvenile rheumatoid arthritis, malignant rheumatoid arthritis, Drug-Resistant Rheumatoid Arthritis, Neuromyelitis optica, Kawasaki disease, polyarticular or systemic juvenile idiopathic arthritis, psoriasis, chronic obstructive pulmonary disease (COPD), Castleman's disease, asthma, allergic asthma, allergic encephalomyelitis, arthritis, arthritis chronica progrediente, reactive arthritis, psoriatic arthritis, enterophathic arthritis, arthritis deformans, rheumatic diseases, spondyloarthropathies, ankylosing spondylitis, Reiter syndrome, hypersensitivity (including both airway hypersensitivity and dermal hypersensitivity), allergies, systemic lupus erythematosus (SLE), cutaneous lupus erythematosus, erythema nodosum leprosum, Sjgren's Syndrome, inflammatory muscle disorders, polychondritis, Wegener's granulomatosis, dermatomyositis, Steven-Johnson syndrome, chronic active hepatitis, myasthenia gravis, idiopathic sprue, autoimmune inflammatory bowel disease, ulcerative colitis, Crohn's disease, Irritable Bowel Syndrome, endocrine ophthalmopathy, scleroderma, Grave's disease, sarcoidosis, multiple sclerosis, primary biliary cirrhosis, vaginitis, proctitis, insulin-dependent diabetes mellitus, insulin-resistant diabetes mellitus, juvenile diabetes (diabetes mellitus type I), autoimmune haematological disorders, hemolytic anemia, aplastic anemia, pure red cell anemia, idiopathic thrombocytopenia (ITP), autoimmune uveitis, uveitis (anterior and posterior), keratoconjunctivitis sicca, vernal keratoconjunctivitis, interstitial lung fibrosis, glomerulonephritis (with and without nephrotic syndrome), idiopathic nephrotic syndrome or minimal change nephropathy, inflammatory disease of skin, cornea inflammation, myositis, loosening of bone implants, metabolic disorder, atherosclerosis, dislipidemia, bone loss, osteoarthritis, osteoporosis, periodontal disease of obstructive or inflammatory airways diseases, bronchitis, pneumoconiosis, pulmonary emphysema, acute and hyperacute inflammatory reactions, acute infections, septic shock, endotoxic shock, adult respiratory distress syndrome, meningitis, pneumonia, cachexia wasting syndrome, stroke, herpetic stromal keratitis, dry eye disease, iritis, conjunctivitis, keratoconjunctivitis, Guillain-Barre syndrome, Stiff-man syndrome, Hashimoto's thyroiditis, autoimmune thyroiditis, encephalomyelitis, acute rheumatic fever, sympathetic ophthalmia, Goodpasture's syndrome, systemic necrotizing vasculitis, antiphospholipid syndrome, Addison's disease, pemphigus vulgaris, pemphigus foliaceus, dermatitis herpetiformis, atopic dermatitis, eczematous dermatitis, aphthous ulcer, lichen planus, autoimmune alopecia, Vitiligo, autoimmune hemolytic anemia, autoimmune thrombocytopenic purpura, pernicious anemia, sensorineural hearing loss, idiopathic bilateral progressive sensorineural hearing loss, autoimmune polyglandular syndrome type I or type II, immune infertility or immune-mediated infertility.
(153) Examples of the subjects may further include those that are at increased risk of an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. A candidate subject, for example, has an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease, or is being treated with a therapy or drug for an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. Candidate subjects also include subjects that would benefit from or are in need of treatment for an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease.
(154) At risk subject may typically have increased risk factors for an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. Particular examples of the subjects at risk may include those that have had an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. Examples of subjects at risk may also include those prescribed a treatment or therapy for an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease. Examples of at risk subjects may also include those with risk factors such as a family history (e.g., genetic predisposition), gender, lifestyle (diet, smoking), occupation (medical and clinical personnel, agricultural and livestock workers) or environmental factors (allergen exposure).
(155) According to the present invention, the composition comprising the fusion polypeptide may be packaged in a dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages treatment; each unit contains a quantity of the composition in association with the carrier, excipient, diluent, or vehicle calculated to produce the desired treatment or therapeutic (e.g., beneficial) effect. The unit dosage forms may vary according to factors including, but not limited to, the particular composition employed, the disorder or disease treated, the effect to be achieved, and the subject to be treated. Exemplary unit doses range from about 25-250, 250-500, 500-1,000, 1,000-2,500, 2,500-5,000, 5,000-25,000, or 5,000-50,000 pg; from about 50-500, 500-5,000, 5,000-25,000 or 25,000-50,000 ng; from about 50-500, 500-5,000, 5,000-25,000 or 25,000-50,000 g; from about 25-250, 250-500, 500-1,000, 1,000-2,500, 2,500-5,000, 5,000-25,000, or 5,000-50,000 mg; and from about 1-5, 5-10, 10-25, 25-50, 50-100, 100-250, 250-500, 500-1,000, 1,000-2,500, or 2,500-5,000 grams.
(156) As set forth herein, fusion polypeptides and compositions thereof may be contacted or provided in vitro, ex vivo or administered or delivered in vivo to a subject or patient in various doses and amounts, and frequencies. For example, a fusion polypeptide or a composition thereof may be administered or delivered to provide the intended effect, as a single or as multiple dosages, for example, in an effective or sufficient amount. Exemplary doses range from about 25-250, 250-500, 500-1,000, 1,000-2,500, 2,500-5,000, 5,000-25,000, or 5,000-50,000 pg/kg; from about 50-500, 500-5,000, 5,000-25,000 or 25,000-50,000 ng/kg; from about 50-500, 500-5,000, 5,000-25,000 or 25,000-50,000 pg/kg; and from about 25-250, 250-500, 500-1,000, 1,000-2,500, 2,500-5,000, 5,000-25,000, or 5,000-50,000 mg/kg, on consecutive days, alternating days or intermittently.
(157) Single or multiple (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more times) administrations or doses of the composition may be administered on the same or consecutive days, alternating days or intermittently. For example, the composition comprising the fusion polypeptide may be administered one, two, three, four or more times daily, on alternating days, bi-weekly, weekly, monthly, bi-monthly, or annually. the composition comprising the fusion polypeptide may be administered for any appropriate duration, for example, for period of 1 hour, or less, e.g., 30 minutes or less, 15 minutes or less, 5 minutes or less, or 1 minute, or less.
(158) The composition comprising the fusion polypeptide may be administered to a subject prior to, substantially contemporaneously with, or within about 1-60 minutes, hours (e.g., within 1, 2, 3, 4, 5, 6, 8, 12, 24 hours), or days (1, 2, 3, 4, 5, 6, 7, 7-14, 14-21, 21-28, 28-45, 45-60 or 60-90 days) of a symptom or onset of an undesirable or aberrant immune response, disorder or disease, an inflammatory response, disorder or disease, inflammation, an autoimmune response, disorder or disease.
(159) The composition comprising the fusion polypeptide may be administered via systemic, regional or local administration, by any route. For example, the composition comprising the fusion polypeptide may be administered systemically, regionally or locally, via injection, infusion, orally (e.g., ingestion or inhalation), topically, intravenously, intra-arterially, intramuscularly, intraperitoneally, intradermally, subcutaneously, intracavity, intracranially, transdermally (topical), parenterally, e.g. transmucosally or intrarectally (enema) catheter, or optically. Fusion polypeptides, compositions, methods and uses of the invention including pharmaceutical formulations administered via a (micro)encapsulated delivery system or packaged into an implant for administration.
(160) The present invention also provides a kit including the fusion polypeptide (FynomAb) of the invention and packaged into suitable packaging material. A kit may optionally include a label or packaging insert including a description of the components or instructions for use in vitro, in vivo, or ex vivo, of the components therein. Exemplary instructions include instructions for a method, treatment protocol or therapeutic regimen.
(161) A kit may contain a collection of components, e.g., two or more compositions each comprising different bi-specific fusion polypeptide, or a composition comprising a bi-specific fusion polypeptide and a composition comprising another therapeutically useful composition (e.g., an anti-proliferative or immune-enhancing drug). The term packaging material refers to a physical structure housing the components of the kit. The packaging material may maintain the components sterilely, and may be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampules, vials, or tubes).
(162) The kit may include a label or insert. The label or insert may be a printed matter, e.g., paper or cardboard, or separate or affixed to a component, a kit or packing material (e.g., a box), or attached to an ampule, tube or vial containing a kit component. The label or insert may be a computer readable medium, optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory type cards.
(163) The label or insert may include identifying information of one or more components therein, dose amounts, clinical pharmacology of the active ingredient(s) including mechanism of action, pharmacokinetics (PK) and pharmacodynamics (PD). Labels or inserts can include information identifying manufacturer information, lot numbers, manufacturer location and date.
(164) The label or insert may include information on a condition, disorder, disease or symptom for which a kit component may be used. Labels or inserts can include instructions for the clinician or for a subject for using one or more of the kit components in a method, treatment protocol or therapeutic regimen. Instructions can include dosage amounts, frequency or duration, and instructions for practicing any of the methods, treatment protocols or therapeutic regimes set forth herein. Kits of the invention therefore may additionally include a label or instruction for practicing any of the methods and uses of the invention described herein.
(165) The label or insert may include information on any benefit that a component may provide, such as a prophylactic or therapeutic benefit. The label or insert may include information on potential adverse side effects, such as warnings to the subject or clinician regarding situations where it would not be appropriate to use a particular composition. Adverse side effects could also occur when the subject has, will be or is currently taking one or more other medications that may be incompatible with the composition, or the subject has, will be or is currently undergoing another treatment protocol or therapeutic regimen which would be incompatible with the composition and, therefore, instructions could include information regarding such incompatibilities.
(166) The kit may additionally include other components. Each component of the kit may be enclosed within an individual container and all of the various containers may be within a single package. Invention kits may be designed for cold storage. Invention kits can further be designed to contain host cells expressing fusion polypeptides of the invention, or that contain nucleic acids encoding fusion polypeptides. The cells in the kit may be maintained under appropriate storage conditions until the cells are ready to be used. For example, a kit including one or more cells can contain appropriate cell storage medium so that the cells may be thawed and grown.
(167) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein may be used in the practice or testing of the present invention, suitable methods and materials are described herein.
(168) All applications, publications, patents and other references, GenBank citations and ATCC citations cited herein are incorporated by reference in their entirety. In case of conflict, the specification, including definitions, will control.
(169) As used herein, the singular forms a, and, and the include plural referents unless the context clearly indicates otherwise. Thus, for example, reference to a fusion polypeptide (FynomAb) or a target (e.g., IL-17a or IL-6R), may include single or a plurality of such fusion polypeptides, targets, and so forth.
(170) As used herein, numerical values are often presented in a range format throughout this document. The use of a range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention unless the context clearly indicates otherwise. Accordingly, a range expressly includes all possible subranges, all individual numerical values within that range, and all numerical values or numerical ranges including integers within such ranges and fractions of the values or the integers within ranges unless the context clearly indicates otherwise. This construction applies regardless of the breadth of the range and in all contexts throughout this patent document. Thus, for example, reference to a range of 90-100% includes 91-99%, 92-98%, 93-95%, 91-98%, 91-97%, 91-96%, 91-95%, 91-94%, 91-93%, and so forth. Reference to a range of 90-100% also includes 91%, 92%, 93%, 94%, 95%, 95%, 97%, etc., as well as 91.1%, 91.2%, 91.3%, 91.4%, 91.5%, etc., 92.1%, 92.2%, 92.3%, 92.4%, 92.5%, and so forth.
(171) In addition, reference to a range of 1-5,000 fold includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 fold, etc., as well as 1.1, 1.2, 1.3, 1.4, 1.5, fold, etc., 2.1, 2.2, 2.3, 2.4, 2.5, fold, etc., and any numerical range within such a ranges, such as 1-2, 5-10, 10-50, 50-100, 100-500, 100-1000, 500-1000, 1000-2000, 1000-5000, etc. In a further example, reference to a range of KD 10.sup.5 M to about KD 10.sup.13 M includes any numerical value or range within or encompassing such values.
(172) As also used herein a series of ranges are disclosed throughout this document. The use of a series of ranges include combinations of the upper and lower ranges to provide another range. This construction applies regardless of the breadth of the range and in all contexts throughout this patent document. Thus, for example, reference to a series of ranges such as 5-10, 10-20, 20-30, 30-40, 40-50, 50-75, 75-100, 100-150, 150-200, etc., includes ranges such as 5-20, 5-30, 5-40, 5-50, 5-75, 5-100, 5-150, 5-200, and 10-30, 10-40, 10-50, 10-75, 10-100, 10-150, 10-171, and 20-40, 20-50, 20-75, 20-100, 20-150, 20-200, and so forth.
(173) The invention is generally disclosed herein using affirmative language to describe the numerous embodiments. The invention also specifically includes embodiments in which particular subject matter is excluded, in full or in part, such as substances or materials, method steps and conditions, protocols, procedures, assays or analysis. Thus, even though the invention is generally not expressed herein in terms of what the invention does not include aspects that are not expressly included in the invention are nevertheless disclosed herein.
(174) A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, the following examples are intended to illustrate but not limit the scope of invention described in the claims.
EXAMPLES
Example 1
(175) Fyn SH3-derived polypeptides of the invention bind to IL-17A as determined by monoclonal lysate ELISA.
(176) Method
(177) Process for producing fynomers that bind IL-17a is described in PCT/EP2013/069481. In brief, Fyn-SH3 derived binding proteins specific to IL-17A were isolated using recombinant IL-17A (R&D Systems) as antigen and standard phage display as selection technology (Grabulovski D. et al., (2007) J Biol Chem 282, p. 3196-3204, Viti, F. et al. (2000) Methods Enzymol. 326, 480-505). Fyn SH3-derived polypeptide of the invention 1L3-B09 carrying the n-src-loop sequence STHEYE was enriched during the selection process. 1L3-B09 bound IL-17A and was found to inhibit glycosylated IL-17A as good as non-glycosylated IL-17A. In order to obtain Fyn SH3-derived IL-17A binders with higher affinities, 1L3-B09 was used as template for affinity maturation. The n-src-loop sequence STHEYE was kept constant and was combined with a randomized RT-loop repertoire (6 amino acid residues designated as (X1) (X2) (X3) (X4) (X5) (X6)). The process of affinity maturation library generation was essentially the same as described for cloning of the nave library with a randomized RT-loop (library 0 in Schlatter et al. (2012) mAbs, 4(4) p. 497-50).
(178) After nave and affinity maturation selections, enriched Fyn SH3-derived polypeptides were screened for binding to IL-17A by lysate ELISA. DNA encoding the Fyn SH3-derived binding proteins were cloned into the bacterial expression vector pQE12 (Qiagen) so that the resulting constructs carried a C-terminal myc-hexahistidine tag as described in Grabulovski et al. (Grabulovski et al. (2007) JBC, 282, p. 3196-3204). The polypeptides were expressed in the cytosol of E. coli bacteria in a 96-well format and 200 l of cleared lysate per well was prepared as described in Bertschinger et al. (Bertschinger et al. (2007) Protein Eng Des Sel 20(2): p. 57-68). Briefly, transformed bacterial colonies were picked from the agar plate and grown in a round bottom 96-well plate (Nunc, cat. no. 163320) in 200 l 2YT medium containing 100 g/ml ampicillin and 0.1% (w/v) glucose. Protein expression was induced after growth for 3 h at 37 C. and 200 r.p.m. by adding 1 mM IPTG (Applichem, Germany). Proteins were expressed overnight in a rotary shaker (200 r.p.m., 30 C.). Subsequently, the 96-well plate was centrifuged at 1800 g for 10 min and the supernatant was discarded. The bacterial pellets were resuspended in 200 l lysis buffer (50 mM NaH2PO4, 300 mM NaCl, 10 mM imidazole, pH 8.0) containing 1 mg/ml lysozyme and left for 30 min on ice. Afterwards, the bacterial cells were lysed by sonication in a water bath (six bursts for 10 s) and then centrifuged at 1800 g for 10 min. Monoclonal bacterial lysates were used for ELISA: biotinylated IL-17A (produced in-house in HEK EBNA cells, biotinylation was performed with NHS-PEO4-biotin (Pierce) according to the manufacturer's instructions) was immobilized on streptavidin-coated wells (StreptaWells, High Bind, Roche), and after blocking with PBS, 2% milk (Rapilait, Migros, Switzerland), 50 l of PBS, 4% milk containing 6 g/ml anti-myc antibody 9E10 (final concentration 3 g/ml) and 50 l of bacterial lysate were applied. After incubating for 1 h and washing, bound Fyn SH3-derived polypeptides were detected with anti-mouse-HRP antibody conjugate (Sigma). The detection of peroxidase activity was done by adding BM blue POD substrate (Roche) and the reaction was stopped by adding 1 M H2SO4. The DNA sequence of the specific binders was verified by DNA sequencing.
(179) Results
(180) The sequences of seven representative IL-17A binding fynomer sequences (SEQ ID NOs:1-7) are as follows:
(181) TABLE-US-00012 SEQIDNO:1(1L3-B9): GVTLFVALYDYANHGNRDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO:2(11L0-C06): GVTLFVALYDYKQKGHLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO:3(11L5-B06): GVTLFVALYDYSARGQLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO:4(11L6-F03): GVTLFVALYDYDKLSALDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO:5(11L9-C09): GVTLFVALYDYESVSWSDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; SEQIDNO:6(11L10-A05): GVTLFVALYDYSSRGVLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ; and SEQIDNO:7(11L11-A09): GVTLFVALYDYSRKSNLDLSFHKGEKFQILSTHEYEDWWEARSLTTGETG YIPSNYVAPVDSIQ.
(182) Eight (8) different fynomer-antibody (FynomAbs) fusions were created by fusing four (4) separate anti-IL-17A binding fynomers to either the C-terminus of the heavy chain (COVA801, COVA803, COVA805, COVA807) or to the C-terminus of the light chain (COVA802, COVA804, COVA806, COVA808) of an IL-6R binding antibody, tocilizumab (see Table 1).
(183) TABLE-US-00013 TABLE 1 FynomAb description. MW FynomAb Fynomer Format (kDa) pI Actemra parental 145.0 8.62 COVA801 11L0-C06 HC, C-term 161.6 8.23 COVA802 11L0-C06 LC, C-term 161.6 8.23 COVA803 11L5-B06 HC, C-term 161.5 8.09 COVA804 11L5-C06 LC, C-term 161.5 8.09 COVA805 11L9-C09 HC, C-term 161.6 7.65 COVA806 11L9-C09 LC, C-term 161.6 7.65 COVA807 11L10-A05 HC, C-term 161.4 8.09 COVA808 11L10-A05 LC, C-term 161.4 8.09 HC: heavy chain; LC: light chain; pI: Isoelectric point; MW: molecular weight; kDa: kilodalton
(184) The studies assess the biochemical and functional characteristics as well as the pharmacokinetic properties of these different FynomAbs. Several different lots of the COVA801-808 FynomAbs were assessed. FynomAbs were either produced from transient or stable transfections of CHO cells. FynomAbs for the mouse and cynomolgus (cyno) monkey PK studies were produced from stable CHO cell lines.
Example 2
(185) Protein Expression and Purification
(186) Four separate lots of FynomAbs were prepared and evaluated in the studies documented below. Two lots of material were derived from transiently transfected CHO cells. The lots of material generated in house were derived from stable CHO pools using the Lonza expression vectors as described below.
(187) The heavy and light chain sequences of Actemra (tocilizumab) were obtained from the CAS database and also confirmed as Sequence #15 in US 2011/0076275 A1. A modification was made to the sequence to mutate amino acids 356-358 DEL to EEM. This is a mutation from the G1m1 allotype to the nG1m1 and could potentially reduce immunogenicity.
(188) TABLE-US-00014 Actemra(tocilizumab)heavychainsequence (SEQIDNO:8)(CDRsinbold) 1 QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIG 51 YISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSL 101 ARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD 151 YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY 201 ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK 251 DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 301 TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV 351 YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL 401 DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG* Actemra(tocilizumab)lightchainsequence (SEQIDNO:9)(CDRsinbold) 1 DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYY 51 TSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGNTLPYTFGQ 101 GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV 151 DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG 201 LSSPVTKSFNRGEC*
(189) These sequences for the tocilizumab heavy and light chains were codon optimized for CHO expression and the genes synthesized. Signal sequences were added to the 5 ends of each gene (Hc ss=MEWSWVFLFFLSVTTGVHS; Lc ss=MSVPTQVLGLLLLWLTDARC). The FynomAb fusion proteins were constructed by putting each of the four fynomer sequences on the C-terminus of either the heavy or light chain of tocilizumab, with a 15 amino acid linker in between (GGGGSx3). This created the genes required to generate eight FynomAbs. The synthesized genes were cloned into the Lonza pEE 12.4 (heavy chain) and 6.4 (light chain) vectors. These vectors were then combined to make a single expression vector to express the heavy and light chains combinations for tocilizumab and all eight FynomAb molecules.
(190) TABLE-US-00015 TABLE2 FynomAbdescriptionwithfynomersequences Molecule Description FynomerSequence COVA801 tocilizumabwith GVTLFVALYDYKQKGHLDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L0_C06fynomer YIPSNYVAPVDSIQ(SEQIDNO: onheavychain 2) COVA802 tocilizumabwith GVTLFVALYDYKQKGHLDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L0_C06fynomer YIPSNYVAPVDSIQ(SEQIDNO: onlightchain 2) COVA803 tocilizumabwith GVTLFVALYDYSARGQLDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L5_B06fynomer YIPSNYVAPVDSIQ(SEQIDNO: onheavychain 3) COVA804 tocilizumabwith GVTLFVALYDYSARGQLDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L5_B06fynomer YIPSNYVAPVDSIQ(SEQIDNO: onlightchain 3) COVA805 tocilizumabwith GVTLFVALYDYESVSWSDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L9_C09fynomer YIPSNYVAPVDSIQ(SEQIDNO: onheavychain 5) COVA806 tocilizumabwith GVTLFVALYDYESVSWSDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L9_C09fynomer YIPSNYVAPVDSIQ(SEQIDNO: onlightchain 5) COVA807 tocilizumabwith GVTLFVALYDYSSRGVLDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L10_A05 YIPSNYVAPVDSIQ(SEQIDNO: fynomeron 6) heavychain COVA808 tocilizumabwith GVTLFVALYDYSSRGVLDLSFHKGE C-terminal KFQILSTHEYEDWWEARSLTTGETG 11L10_A05 YIPSNYVAPVDSIQ(SEQIDNO: fynomeron 6) lightchain
(191) CHO-K1-SV cells were nucleofected (Amaxa) with linearized DNA of each of the eight FynomAb vectors and tocilizumab. These cells were put into MSX selection and cultured in pairs of static flasks until the cultures recovered. Once the cells recovered they were transferred to shake flasks and either immediately frozen or expanded to production flasks for large scale protein expression.
(192) The first rounds of production flasks were purified for generating material for the in-house mouse PK study and for use in the in vitro assays. The frozen cultures of these same pools were later thawed and expanded when more protein was needed for the cynomolgus PK studies.
(193) Expression levels were quantified by AlphaLISA and Western blot. Expression levels of the stable pools ranged from approximately 100-500 mg/L. Production flasks were cultured for ten days before harvest, filtration, and freezing with protease inhibitors. Some low expression pools were cold captured and sortedthe antibody on the cell surfaces was stained and then the cells sorted by flow cytometry to capture the highest producing cells for culture and production. Supernatants from the stable pools (0.5-8.0 L) were filtered through a 0.2 M vacuum filter upon harvest and protease inhibitor tablets (Sigma, cat# P2714, 1 tablet/100 mL supernatant) were added prior to freezing or storage at 4 C.
(194) Supernatants for all FynomAb production cell lines were initially purified under aseptic conditions using HiTrap MabSelect SuRe columns (1 or 5 mL columns; sometimes multiples in tandem) loading at a flow rate of 5-20 mL/minute. Columns were washed with PBS until a baseline A280 reading was reached, followed by elution with glycine, pH 3.0.
(195) The different lots of the CHO stable material made for each FynomAb along with protein yields are listed in Table 3.
(196) TABLE-US-00016 TABLE 3 yields of FynomAbs and tocilizumab produced Conc. Yield Host/ Yield mg/mL Volume (mg/L Construct Expression (mg) (M) (mL) sup) tocilizumab CHO-S/ 1.31 5.0 (35.5) 0.26 2.6 transient tocilizumab CHO-K1SV/ 2.9 4.40 (30.3) 0.66 1.2 stable tocilizumab CHO-K1SV/ 291 2.75 (19.0) 105.8 36.4 stable (sorted) COVA801 CHO-K1SV/ 36.0 4.0 (24.7) 9.0 >72 stable COVA801 CHO-K1SV/ 410 1.35 (8.3) 303.7 205 stable COVA802 CHO-K1SV/ 1.43 3.96 (24.4) 0.36 3.0 stable COVA802 CHO-K1SV/ 7.1 1.68 (10.3) 4.3 1.6 stable COVA802 CHO-K1SV/ 252 0.91 (5.6) 276.9 45.8 stable COVA803 CHO-K1SV/ 26.1 3.86 (23.8) 6.8 >50 stable COVA803 CHO-K1SV/ 330 1.27 (7.8) 259.8 110.0 stable COVA804 CHO-K1SV/ 32.2 4.81 (29.7) 6.7 >72 stable COVA804 CHO-K1SV/ 337 0.96 (5.9) 351.0 112.3 stable COVA805 CHO-K1SV/ 19.5 2.78 (17.2) 7.0 >41 stable COVA806 CHO-K1SV/ 47.9 5.1 (31.5) 9.4 >90 stable COVA806 CHO-K1SV/ 428 2.74 (16.9) 156.2 142.7 stable COVA807 CHO-K1SV/ 59.7 6.63 (40.9) 9.0 >120 stable COVA807 CHO-K1SV/ 59.7 6.63 (40.9) 9.0 >120 stable COVA808 CHO-K1SV/ 22.8 3.35 (20.7) 6.8 >48 stable COVA808 CHO-K1SV/ 245 1.41 (8.7) 173.8 54.4 Stable (sorted)
Example 3
(197) SDS-PAGE Analysis
(198) SDS-PAGE analysis was performed on three separate lots of each FynomAb and tocilizumab. Five micrograms of each protein were electrophoresed under both reducing and non-reducing conditions on 4-20% Tris-glycine gradient gels using Tris-glycine SDS sample and running buffers. Gels were stained overnight with Coomassie brilliant blue (SimplyBlue SafeStain, Invitrogen) and de-stained until sufficiently clear with distilled water. Results are shown in
Example 4
(199) Analytical HPLC-SEC
(200) Three separate lots of FynomAbs were assessed by analytical HPLC-SEC. One lot of transient CHO material, and the other two lots were produced internally from stably transfected CHO cell lines. Ten micrograms of each FynomAb protein were injected onto a Zenix-C SEC-300 column (Sepax Technologies) using PBS as the mobile phase with a flow rate of 1 mL/min. Absorbance at A280 was monitored. The presence of the fynomer retards the elution of the FynomAbs compared to Actemra to varying degrees, presumably due to a secondary interaction between the solid phase and the fynomers. Soluble aggregation is observed as peaks eluting before the major peak of the FynomAb, and is most evident in the heavy chain fusion constructs COVA801, COVA803, COVA805 and COVA807.
(201) The light chain fusions (COVA802, COVA804, COVA806 and COVA808 FynomAbs) had much cleaner SEC profiles, with no aggregation observed for COVA804 or COVA806 FynomAbs. These data are consistent with prior data, which also showed that the light chain fusions had cleaner SEC profiles with less apparent soluble aggregation.
Example 5
(202) Affinity Measurements for Human IL-17a and Human IL-6R
(203) To determine the affinity and kinetic parameters of FynomAb binding to human IL-17A and human IL-6R, an anti-human antibody was amine coupled to a GLM chip. The COVA801-808 FynomAbs or control antibodies were then captured as ligand, and either IL-17A or IL-6R was flowed as the analyte. PBST was utilized as mobile phase, and regeneration was achieved with two 15-second injections of 100 mM HCl. Secukinumab was used as a positive control for IL-17A binding and as a negative control for IL-6R binding. Tocilizumab and/or Actemra were used as positive controls for IL-6R binding and as negative controls for IL-17-A binding.
(204) Secukinumab was used as a positive control for IL-17A binding and as a negative control for IL-6R binding. The VH and VL chains of Secukinumab are as follows:
(205) TABLE-US-00017 VariableLightchain(SEQIDNO:33) Signalsequence(underlined),variabledomain (kappa)(inbold) MSVPTQVLGLLLLWLTDARCEIVLTQSPGTLSLSPGERATLSCRASQSVS SSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSPCTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* VariableHeavychain(SEQIDNO:34) Signalsequence(underlined),variabledomain (kappa)(inbold) MEWSWVFLFFLSVTTGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSN YWMNWVRQAPGKGLEWVAAINQDGSEKYYVGSVKGRFTISRDNAKNSLYL QMNSLRVEDTAVYYCVRDYYDILTDYYIHYWYFDLWGRGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG*
Tocilizumab and/or Actemra were used as a positive control for IL-6R binding and as negative controls for IL-17-A binding.
(206) IL-17a Binding
(207) Representative sensorgrams for IL-17A binding by the COVA801-808 FynomAbs as well as for secukinumab (positive control and reference) and tocilizumab or Actemra (negative controls) are shown in
(208) Fit kinetics are in fairly good agreement with other data values, and most constructs have an apparent KD similar to secukinumab. The assessment of binding to IL17A is confounded by complex association with the FynomAbs, as seen by significant deviation from 1:1 binding in the FynomAb data sets but not in the secukinumab data set. It appears that significant re-binding of IL-17A is occurring that is more easily observed with a prolonged dissociation phase. Thus, the reported kinetic and affinity values for the FynomAb/IL-17A interaction should be carefully interpreted. Although COVA807 and COVA808 had lower KD values, the significant deviation from 1:1 binding of IL-17A by these two FynomAbs may account for their apparent higher affinity. We observed inferior functional activity of the COVA807 FynomAb in the IL-17A functional assay (see HT29 IL-17A functional assay data below).
(209) TABLE-US-00018 TABLE 4 Summary of SPR data for FynomAb binding to human IL-17A No. of Avg. k.sub.a Avg. k.sub.d Avg. KD St. dev. experi- FynomAb (1/Ms) (1/s) (nM) of KD (M) ments COVA801 6.17E+06 4.11E04 4.86E11 6.61E10 4 COVA802 3.26E+06 2.53E04 7.82E11 1.14E10 4 COVA803 4.96E+06 3.57E04 6.89E11 1.26E10 5 COVA804 2.42E+06 1.29E04 4.68E11 6.78E11 8 COVA805 3.53E+06 5.81E04 1.43E10 1.92E10 2 COVA806 2.01E+06 2.33E04 9.98E11 1.27E10 5 COVA807 4.34E+06 9.66E05 2.23E11 7.07E14 2 COVA808 2.95E+06 7.97E05 3.11E11 1.74E11 5 secukinumab 6.46E+05 1.01E04 4.47E10 3.97E10 4
(210) Due to the complex association of the FynomAb constructs with the recombinant IL-17A homodimer, a simple binding ELISA was performed to study the specificity and relative affinities of COVA804 and COVA806 for human IL-17A. Briefly, 1 g/mL of recombinant human IL-17A in PBS was coated on an ELISA plate, followed by blocking with BSA and incubation with 0-10 g/mL test antibody or FynomAb. A goat-anti-human antibody conjugated to horseradish peroxidase was used to detect binding using TMB. The results of concentration-response binding to IL-17A were highly reproducible over four studies, with a representative study shown in
(211) IL-6R Binding
(212) Representative sensorgrams for IL-6R binding by the COVA801-808 FynomAbs as well as for tocilizumab and Actemra (positive controls and reference) and secukinumab (negative control) are shown in
(213) TABLE-US-00019 TABLE 5 Summary of SPR data for FynomAb binding to human IL-6R No. of Avg. k.sub.a Avg. k.sub.d Avg. KD St. dev. experi- FynomAb (1/Ms) (1/s) (nM) of KD (M) ments COVA801 4.99E+05 1.50E04 2.97E10 0.29E10 4 COVA802 4.72E+05 1.68E04 3.95E10 1.45E10 6 COVA803 3.63E+05 2.19E04 6.04E10 3.31E10 6 COVA804 4.08E+05 2.01E04 6.32E10 3.71E10 9 COVA805 6.13E+05 1.78E04 3.14E10 1.49E10 2 COVA806 4.34E+05 1.72E04 5.14E10 3.20E10 5 COVA807 6.92E+05 1.89E04 3.07E10 1.53E10 2 COVA808 4.25E+05 1.70E04 5.46E10 3.04E10 4 tocilizumab 4.73E+05 1.86E04 4.17E10 1.06E10 4 Actemra 4.13E+05 1.91E04 4.99E10 1.42E10 6
Example 6
(214) HT-29 IL-17a Inhibition Assay
(215) To assess the bioactivity of the COVA801-808 FynomAbs against human IL-17A, HT-29 cells (ATCC, #HTB-38) were stimulated with IL-17A (1.9 nM) in the presence of various concentrations of each FynomAb, ranging from 100 nM to 6 pM. Secukinumab was used as a positive control for blockade of IL-17A function. For each condition, 20,000 viable cells were added and incubated for 48 hours in a flat bottom 96-well plate at 37 C. and 5% CO2. Each condition was tested in duplicate.
(216) Stimulation of HT29 cells with IL17A resulted in the production and release of Gro into cell supernatant. Gro concentrations in the supernatants were then measured by ELISA, using the DuoSet ELISA kit from R&D Systems (DY275). The ELISA was performed according to the manufacturer's manual (except all antibodies were used at 1:200).
(217) The means of duplicate results were plotted with standard deviations, and IC50 values were calculated using a four-parameter dose-response inhibition function in GraphPad Prism. Representative data from multiple studies using three different lots of the COVA801-808 FynomAbs are shown in
(218) TABLE-US-00020 TABLE 6 FIG. 7A 801 802 Secukinumab IC50 1.362 1.148 1.542 FIG. 7B 803 804 Secukinumab IC50 1.476 1.104 1.457 FIG. 7C 805 806 Secukinumab IC50 0.8135 0.8537 1.155 FIG. 7D 807 808 Secukinumab IC50 1.929 1.702 1.597 FIG. 8A 801 in-house 802 in-House Secukinumab IC50 1.599 1.783 2.395 FIG. 8B 803 in-house 804 in-House Secukinumab IC50 2.625 2.317 2.560 FIG. 8C 805 in-house 806 in-House Secukinumab LogIC50 0.2796 0.07429 0.2138 FIG. 8D 807 in-house 808 in-House Secukinumab LogIC50 0.6443 0.4065 0.3166 FIG. 9A 801 802 Secukinumab IC50 1.520 0.9410 1.259 FIG. 9B 803 804 Secukinumab IC50 12.118 1.507 1.960 FIG. 9C 806 808 Secukinumab IC50 1.132 2.036 2.070
Example 7
(219) HEK-Blue IL-6R Inhibition Assay
(220) To assess the bioactivity of the anti-IL-6R part in COVA801-808 constructs, HEK Blue IL-6 cells (Invivogen, hkb-il6) were stimulated with IL-6 (15 pM) in the presence of various concentrations of FynomAb, ranging from 500 nM to 0.2 nM. The inhibitors were pre-incubated with the cells for 30 minutes before addition of IL-6. As controls, medium only, or medium containing IL-6 (15 pM) were used. Also, tocilizumab or Actemra was used as a positive control for IL-6R blockade. For each sample, 50,000 viable cells were added and incubated for 20-24 hours in a well of a 96-well plate at 37 C., 5% CO2. Each condition was tested in triplicate.
(221) Addition of IL-6 to the cells resulted in stimulation of the IL-6R signaling pathway, which activated the STAT3-inducible SEAP reporter gene. SEAP in the supernatants was measured using the HEK-Blue detection reagent (Invivogen, hb-det2), used according to the manufacturer's manual.
(222) The means of triplicate results were plotted, with standard deviation. IC50-values were calculated using a four-parameter dose-response inhibition function in GraphPad Prism. Representative data from multiple studies using three different lots of the COVA801-808 FynomAbs are shown in
(223) TABLE-US-00021 TABLE 7 FIG. 10A Actemra COVA801 IC50 19.96 22.28 FIG. 10B Actemra COVA802 IC50 19.96 21.29 FIG. 10C Actemra COVA803 IC50 19.96 25.52 FIG. 10D Actemra COVA804 IC50 19.09 20.84 FIG. 10E Actemra COVA805 IC50 19.09 21.14 FIG. 10F Actemra COVA806 IC50 19.09 22.80 FIG. 10G Actemra COVA807 IC50 14.37 26.18 FIG. 10H Actemra COVA808 IC50 14.37 21.45 FIG. 10I Actemra Tocilizumab IC50 14.37 19.23 FIG. 11A Actemra COVA801 IC50 7.869 8.214 FIG. 11B Actemra COVA802 IC50 7.869 8.526 FIG. 11C Actemra COVA803 IC50 7.869 11.63 FIG. 11D Actemra COVA804 IC50 10.55 12.29 FIG. 11E Actemra COVA805 IC50 10.55 12.38 FIG. 11F Actemra COVA806 IC50 10.55 14.76 FIG. 11G Actemra COVA807 IC50 17.05 19.32 FIG. 11H Actemra COVA808 IC50 17.05 14.69 FIG. 11I Actemra Tocilizumab IC50 17.05 12.35 FIG. 12A 801 802 Tocilizumab Actemra IC50 12.26 13.40 13.29 6.903 FIG. 12B 803 804 Tocilizumab Actemra IC50 10.75 9.108 9.176 8.406 FIG. 12C 806 808 Tocilizumab Actemra IC50 8.957 11.79 11.15 8.142
Example 8
(224) Serum Stability Assay
(225) To assess the stability of each FynomAb in human serum, COVA801-808 FynomAbs were each incubated in 90% human serum (Sigma #H4522) for 6 days at 37 C. at a concentration of 10 g/ml, and then tested in a sandwich ELISA to assess whether the FynomAbs retained their ability to bind both IL-17A and IL-6R. A sandwich ELISA was used to assess simultaneous binding of FynomAbs after incubation in PBS or human serum. The setup of the sandwich ELISA is shown in
(226) Briefly, human IL17A was coated on a Maxisorp 96 well plate at 5 g/ml in PBS, and the FynomAb samples were diluted 5 fold in 1% BSA/PBST from 50 nM to 0.003 nM and added to the plates. His-tagged human IL-6R was then added to each well containing the FynomAbs and developed with an anti-His-HRP mAb. The plate was then washed and developed using TMB substrate (Sigma #T0440) and stopped with acid. The means of the triplicates were plotted along with standard deviations (see
(227) In more detail, COVA801-808 FynomAbs were incubated under the following conditions (a-d), and then assessed for retention of dual binding activity in the ELISA outlined in
(228) A separate set of control samples was incubated for 6 days at 4 C. in PBS (PBS day 6). Another set of control samples was diluted in human serum and immediately used in the assay (Human serum day 0). The purpose of the human serum day 0 samples was to assess whether the presence of human serum would affect the ability of the FynomAbs to bind both of its targets simultaneously. As shown in
Example 9
(229) Simultaneous Binding of IL-6R and IL-17a
(230) Data indicated that COVA801-808 FynomAbs were all able to simultaneously bind to human IL-17A and human IL-6R.
(231) A cell-based flow cytometric assay was performed to demonstrate that the COVA801-808 FynomAbs could bind simultaneously to IL-6R on the cell surface and to soluble IL-17A. In this assay, HEK Blue IL-6 cells expressing human IL-6R on the surface (Invivogen hkb-il6) were used. Briefly, the COVA801-808 FynomAbs (or controls) were each incubated for 60 minutes with HEK-Blue IL-6 cells (or HEK-293 cells as a negative control) at various concentrations ranging from 300 nM to 5 pM. Following this primary incubation, binding of the constructs to IL-6R was detected using an anti-human-IgG antibody conjugated to the Alexa488 fluorophore (Invitrogen A11013).
(232) Results are shown in
(233) The data in
Example 10
(234) Functional Activity of Bi-Specific FynomAbs in the Presence of Both IL-17A and IL-6R
(235) The data in
(236) The results are shown in
(237) As shown in
(238) TABLE-US-00022 TABLE 8 FIG. 17A 804 806 Secukinumab IC50 1.077 0.6264 1.283 FIG. 17B 804 806 Secukinumab IC50 1.112 0.6472 1.766
(239) A similar study was performed to assess IL-6R blockade by the FynomAbs in the presence of IL-17A (see
(240) As shown in
(241) TABLE-US-00023 TABLE 9 FIG. 18A 803 803 + IL-17A IC50 41.73 37.67 FIG. 18B 804 804 + IL-17A IC50 31.19 44.84 FIG. 18C Tocilizumab Tocil + IL-17A IC50 30.38 27.18
Example 11
(242) Fynomer Polypeptides Bind to Glycosylated Human IL-17A with High Affinity
(243) This example shows the expression yields of IL-17A-binding fynomer polypeptides and the characterization of these polypeptides by size exclusion chromatography and surface plasmon resonance studies.
(244) Affinity Measurements
(245) Affinity measurements were performed using a BIAcore T200 instrument (GE. Healthcare). For the interaction analysis between glycosylated IL-17A (produced in-house in HEK EBNA cells) and monomeric IL-17A-binding fynomer polypeptides, a Series S CM5 chip (GE Healthcare) was used with 2000 RU IL-17A immobilized using the Amine coupling kit (GE healthcare). The running buffer was PBS containing 0.05% Tween 20. The interactions were measured at a flow of 30 l/min and injection of different concentrations of the IL-17A-binding fynomer polypeptides. All kinetic data of the interaction were evaluated using BIAcore T200 evaluation software.
(246) Binding Properties
(247) The binding properties were analyzed by real-time interaction analysis on a BIAcore chip revealing the following dissociation constants (KD) for selected IL-17A-binding fynomer polypeptides:
(248) TABLE-US-00024 TABLE 10 Kinetics constants of the binding of fynomer IL- 17A-binding polypeptides to recombinant human glycosylated IL-17A (produced in HEK EBNA cells). FYNOMER SEQ ID NO. K.sub.D (nM) 1L3-B09 1 245 11L0-C06 2 7 11L5-B06 3 12 11L6-F03 4 11 11L9-C09 5 11 11L10-A05 6 7 11L11-A09 7 24 Data in Example 11 was disclosed in WO2014/044758 (PCT/EP2013/069481).
Example 12
(249) Fynomer Polypeptides Inhibit Glycosylated IL-17A
(250) Clone 1L3-B09 (SEQ ID NO:1) and five fynomer polypeptides with the highest binding affinity to IL-17A (11L0-006, 11L5-B06, 11L6-F03, 11L9-009, 11L10-A05, SEQ ID NOs:2-6) have been tested for their ability to inhibit IL-17A. The inhibitory activities of the indicated IL-17A-binding fynomer polypeptides were tested by stimulating human dermal fibroblasts with recombinant glycosylated IL-17A (produced in-house in HEK EBNA cells) and recombinant TNF (Thermo Fisher Scientific) in the absence or presence of various concentrations of the IL-17A binding fynomer polypeptides. Cell culture supernatants were taken after 24 h of stimulation and IL-6 concentration in the supernatant was determined by ELISA. The results show that the IL-17A binding fynomer polypeptides were able to specifically inhibit glycosylated IL-17A.
(251) Methods
(252) For endotoxin removal, the protein solutions were filtered three times with the Acrodisc Mustang E membrane (VWR). After filtration the endotoxin levels of the protein solutions containing inhibitory IL-17A-binding fynomer polypeptides were less than 0.1 EU/ml, as determined by the Limulus amebocyte lysate (LAL) test (PYROGENT Single test Gel Clot LAL Assay (Lonza)). 100 l of a cell suspension containing about 3900 Normal Human Dermal Fibroblasts (PromoCell, NHDF-c, C12300) were distributed per well (96 well plate, TPP or Corning) and cultured for 24 hours at 37 C. (medium: Fibroblast Growth Medium C-23010, PromoCell). The supernatant was aspirated and after mixing different concentrations of IL-17A-binding fynomer polypeptides with IL-17A and TNF containing medium (final concentrations 1 ng/ml and 50 pg/ml respectively), 100 l of the corresponding solution were added per well. As controls PBS was mixed with the IL-17A/TNF containing medium (pos. control=no inhibitor) and medium with the single cytokines IL-17A or TNF only (latter being the TNF control well). As a negative control PBS was mixed with medium only. For comparison, the assay has also been performed using non-glycosylated IL-17A (R&D Systems) using the same conditions. After 24 hours incubation at 37 C. the supernatant was in an ELISA to determine the IL-6 concentration using an IL-6 ELISA kit following the manufacturer's instructions (IL-6 ELISA kit, R&D Systems). The percentages of inhibition were plotted and IC50 values were calculated using the software Prism 5. The percentage of IL-17A inhibition was determined with the following formula:
(253)
(254) Results
(255) Normal Human Dermal Fibroblasts were incubated with IL-17A/TNF and different concentrations of indicated IL-17A-binding fynomer polypeptides. It was observed that the fynomer polypeptides inhibited glycosylated IL-17A. The IC50 values are shown in Table 11.
(256) TABLE-US-00025 TABLE 11 IC50 values for inhibition of glycosylated IL-17A obtained for IL-17A-binding fynomer polypeptides. FYNOMER SEQ ID NO. IC.sub.50 value (nM) 1L3-B09 1 300 11L0-C06 2 35 11L5-B06 3 43 11L6-F03 4 63 11L9-C09 5 32 11L10-A05 6 28
(257) Dose-dependent inhibition curves of the indicated IL-17A-binding fynomer polypeptides inhibiting both glycosylated and non-glycosylated IL-17A are shown in
(258) It was found that the IL-17A-binding fynomer polypeptides are able to completely inhibit glycosylated IL-17A with similar potencies as compared to non-glycosylated IL-17A. This is an advantageous property as compared to the Fyn SH3-derived IL-17A-binding polypeptides previously described in WO2011/023685.
(259)
(260) Fyn SH3 derived IL-17 binder 2C1 (SEQ ID NO:107 in WO2011/023685), Fyn SH3 derived IL-17 binder A1_2 (SEQ ID NO:53 in WO2011/023685) and Fyn SH3 derived IL-17 binder B1_2 (B1) (SEQ ID NO:39 in WO2011/023685) either do not inhibit glycosylated IL-17A completely even at high concentrations and/or show large differences in inhibition potency (IC50 values) between glycosylated and non-glycosylated IL-17A.
Example 13
(261) Data in Example 13 was disclosed in WO2014/044758 (PCT/EP2013/069481).
(262) Fynomer Polypeptide 11L11-A09 Inhibits Glycosylated IL-17A
(263) Methods
(264) Fynomer 11L11-A09 has been tested for its ability to inhibit IL-17A. The study conditions were the same as described above for the other fynomer polypeptides.
(265) Results
(266) Normal Human Dermal Fibroblasts were incubated with IL-17A/TNF and different concentrations of the fynomer polypeptide 11L11-A09. It was observed that 11L11-A09 inhibited glycosylated IL-17A with an IC50 value of 66 nM (Table 12).
(267) TABLE-US-00026 TABLE 12 IC50 value for inhibition of glycosylated IL-17A obtained for the IL-17A-binding fynomer polypeptide 11L11-A09. FYNOMER SEQ ID NO. IC.sub.50 value (nM) 11L11-A09 7 66
(268)
Example 14
(269) Pharmacokinetic Study in C57BL/6 Mice
(270) In order to help rank the COVA801-808 FynomAbs, pharmacokinetic profile of all 8 FynomAbs was assessed in C57BL/6 mice.
(271) Dosing and Blood Sampling
(272) The determination of the pharmacokinetic properties of FynomAbs denoted COVA801 COVA802, COVA803, COVA804, COVA805, COVA806, COVA807, COVA808, and Tocilizumab were performed by measuring the concentrations by ELISA in mouse serum taken at different time points after a single retro-orbital injection. Six to 8 week old female C56BL/6 mice (Charles River, USA) were intravenously injected with 10 mg/kg dose based on individual weight. Each group consisted of 5 mice. Blood was withdrawn from the caudal vein (tail vein) 30 minutes, 6, 24, 48, 96, 144, 192, 240, and 288 hours after retro-orbital injection. Blood was collected in blood tube clotting activator microvettes (CB300, Sarstedt) and serum was prepared by centrifugation for 10 min at 10,000 rpm. The serum was stored at 20 C. until analysis.
(273) IL-6R and IL-17A ELISA
(274) The serum concentrations of tested FynomAbs and tocilizumab were determined by ELISA using immobilized human IL-17 alpha (Cell Signaling Technologies, 8928BF) and recombinant human IL-6R alpha (R&D Systems, Inc. 227-SR/CF) on high binding Nunc ELISA plates (Thermo Scientific, 456537), respectively. Both were coated at 5 mg/ml at 4 C. in PBS overnight. Plates were washed in PBS+0.05% Tween (PBST) and blocked for 2 hours with BSA (Fischer Scientific, 37525) diluted to 1% in PBST. For each mouse and time point, 800, 4,000 and 20,000-fold dilutions of serum were prepared in blocker diluent. The corresponding standard for each FynomAb was prepared making serial dilutions in blocker diluent starting at 4 nM with 2 fold titrations (4 nM-0.03125 nM). Fifty l of standards (in duplicate) and serum dilutions (in triplicate) were added to plates and incubated for 1 hour at RT. The plates were washed 3 times with PBST and incubated with 50 l of Peroxidase-AffiniPure Goat Anti-Human IgG (H+L) (Jackson ImmunoResearch, 109-035-003) diluted at 1:5,000 for 1 hour at RT. The plates were washed 3 times with PBST. 50 l of TMB liquid substrate (Sigma-Aldrich Inc., T0440-1L) were added to all wells. Plates were incubated for 3 min and stopped with 50 l stop solution. Absorbance values were recorded at 405 nM (PHERAstar Plus).
(275) Data Analysis
(276) Serum concentrations for each mouse were calculated using the standard curve and 4 parameter fit analysis (X value logarithmic, Y value linear). For every time-point and mouse, the average nM serum concentration of triplicates were multiplied by the corresponding dilution factor and then converted to ug/ml concentration. The STDEV and % CV was calculated for each time point and for the 3 dilution factors. One value with lowest % CV and best represented the linear portion of the standard curve was chosen as the value for each time point. These values were subjected to pharmacokinetic parameter analysis (Phoenix 64, WinNonlin 6.3). Half-life (h), area under the curve (AUC; h*ug/ml), volume of distribution (Vz; ml) and clearance (Cl; ml/h) were calculated using Non-compartmental PK analysis, Model Type: Plasma (200-202), Calculation Method: Linear Trapezoidal Linear Interpolation. Standard curves for each mouse were based on uniform weighting and best fit lambda Z calculation, required at least 3 data points in the regression, and did not include the Cmax.
(277) Results
(278) The serum concentrations and pharmacokinetic parameters of each FynomAb and tocilizumab are shown in Tables 13-21. Although both the IL-6R and IL-17A ELISAs were used to calculate the serum concentrations and PK parameters, only the IL-6R data is shown here. However, similar serum concentrations and PK parameters were determined from the IL-17A ELISA data. Thus the serum concentration versus time curves for the two different ELISA methods look very similar for each FynomAb (see
(279) Tables 13A and 13B: Serum Concentrations and PK Parameters of Tocilizumab.
(280) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A.
(281) TABLE-US-00027 TABLE 13A Tocilizumab (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 319.00 299.66 270.66 261.00 309.33 291.93 25.02 6 435.00 222.33 251.33 328.66 270.66 301.60 84.10 24 232.00 232.00 222.33 261.00 174.00 224.27 31.62 48 251.33 183.67 164.33 232.00 145.00 195.27 45.03 96 174.00 133.40 116.00 174.00 87.00 136.88 37.72 144 143.07 116.00 106.33 222.33 106.33 138.81 49.05 192 116.00 87.00 104.40 145.00 75.40 105.56 27.02 240 58.00 63.80 58.00 87.00 50.27 63.41 14.03
(282) TABLE-US-00028 TABLE 13B Pharmacokinetic Parameters Tocilizumab Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 99.67 0.028 0.00020 42167.16 2 111.30 0.037 0.00023 32673.59 3 126.63 0.043 0.00024 31425.15 4 70.92 0.018 0.00018 46549.51 5 88.81 0.038 0.00030 27087.75 Average 99.47 0.033 0.00023 35980.63 STDEV 21.25 0.010 0.00005 8073.83
Tables 14A and 14B: Serum Concentrations and PK Parameters of COVA801.
(283) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(284) TABLE-US-00029 TABLE 14A COVA801 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 355.56 355.56 204.72 422.36 430.98 353.83 90.68 6 258.59 409.43 196.10 275.83 284.45 284.88 77.73 24 159.46 209.02 135.76 161.62 183.17 169.81 27.61 48 96.97 144.38 96.97 129.29 118.52 117.23 20.65 96 64.65 96.97 75.42 96.97 84.04 83.61 14.00 144 38.79 103.43 114.21 90.51 120.67 93.52 32.67 192 51.72 64.65 58.18 45.25 58.18 55.60 7.37 240 38.79 38.79 43.10 38.79 45.25 40.94 3.05
(285) TABLE-US-00030 TABLE 14B Pharmacokinetic Parameters COVA 801 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 94.41 0.055 0.00041 19322.94 2 67.84 0.030 0.00030 29118.09 3 68.28 0.037 0.00038 22189.49 4 104.49 0.049 0.00033 24658.46 5 67.84 0.032 0.00032 26453.49 Average 80.57 0.041 0.00035 24348.49 STDEV 17.60 0.011 0.00004 3781.32
Tables 15A and 15B: Serum Concentrations and PK Parameters of COVA802.
(286) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(287) TABLE-US-00031 TABLE 15A COVA802 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 193.94 258.59 340.47 297.38 269.36 271.95 53.88 6 131.45 247.81 226.26 258.59 193.94 211.61 51.16 24 129.29 161.62 129.29 161.62 122.83 140.93 19.07 48 96.97 140.07 88.35 129.29 120.67 115.07 21.80 96 64.65 88.35 62.49 109.90 84.04 81.89 19.39 144 45.25 77.58 56.03 99.13 25.86 60.77 28.44 192 30.17 53.87 43.10 64.65 30.60 44.48 14.95 240 16.81 45.25 32.32 23.27 20.26 27.58 11.44
(288) TABLE-US-00032 TABLE 15B Pharmacokinetic Parameters COVA 802 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 77.02 0.064 0.00058 15459.11 2 116.06 0.053 0.00032 23760.41 3 120.98 0.073 0.00042 18109.20 4 45.92 0.024 0.00037 25673.85 5 71.45 0.053 0.00052 17240.67 Average 86.28 0.054 0.00044 20048.64 STDEV 31.72 0.018 0.00011 4419.56
Tables 16A and 16B: Serum Concentrations and PK Parameters of COVA803.
(289) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(290) TABLE-US-00033 TABLE 16A COVA803 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 355.21 430.56 441.32 402.57 376.74 401.28 36.01 6 236.81 236.81 230.35 236.81 245.42 237.24 5.36 24 129.17 129.17 135.63 122.71 157.15 134.76 13.32 48 90.42 81.81 127.01 129.17 114.10 108.50 21.45 96 71.04 64.58 83.96 81.81 79.65 76.21 8.14 144 64.58 58.13 73.19 68.89 73.19 67.60 6.39 192 47.36 31.43 49.51 49.51 45.21 44.61 7.58 240 38.75 25.83 30.14 36.60 38.75 34.01 5.78
(291) TABLE-US-00034 TABLE 16B Pharmacokinetic Parameters COVA 803 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 158.43 0.081 0.00035 19528.98 2 99.28 0.067 0.00047 17750.35 3 74.99 0.043 0.00039 22094.56 4 105.20 0.056 0.00037 21705.44 5 110.88 0.057 0.00036 21858.29 Average 109.76 0.061 0.00039 20587.53 STDEV 30.45 0.014 0.00005 1891.15
Tables 17A and 17B: Serum Concentrations and PK Parameters of COVA804.
(292) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(293) TABLE-US-00035 TABLE 17A COVA804 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 441.32 419.79 387.50 376.74 398.27 404.72 25.92 6 419.79 312.15 292.78 262.64 226.04 302.68 73.11 24 215.28 202.36 167.92 144.24 161.46 178.25 29.57 48 178.68 176.53 142.08 129.17 129.17 151.13 24.75 96 129.17 142.08 129.17 92.57 122.71 123.14 18.48 144 96.88 124.86 131.32 103.33 116.25 114.53 14.39 192 66.74 101.18 94.72 96.88 73.19 86.54 15.48 240 24.54 75.35 75.35 53.82 64.58 58.73 21.09
(294) TABLE-US-00036 TABLE 17B Pharmacokinetic Parameters COVA 804 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 69.55 0.029 0.00029 31852.27 2 160.73 0.044 0.00019 35010.19 3 119.78 0.038 0.00022 32102.31 4 190.81 0.065 0.00024 27240.23 5 171.03 0.056 0.00023 28424.82 Average 142.38 0.047 0.00023 30925.96 STDEV 48.26 0.014 0.00004 3113.00
Tables 18A and 18B: Serum Concentrations and PK Parameters of COVA805.
(295) (A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(296) TABLE-US-00037 TABLE 18A COVA805 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 336.10 323.17 463.21 264.78 290.85 335.62 76.58 6 185.28 165.89 193.90 172.36 159.43 175.37 14.09 24 99.11 86.18 96.95 95.87 92.64 94.15 5.03 48 84.02 73.25 66.79 58.82 73.25 71.23 9.30 96 64.63 45.24 48.69 43.95 58.17 52.14 8.93 144 51.71 40.50 0.00 43.74 45.24 36.24 20.66 192 25.42 32.32 32.32 32.32 32.32 30.94 3.08 240 19.82 25.85 26.28 19.35 23.70 23.00 3.27
(297) TABLE-US-00038 TABLE 18B Pharmacokinetic Parameters COVA 805 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 90.72 0.072 0.00055 15571.82 2 148.22 0.111 0.00052 13653.16 3 161.96 0.113 0.00048 14571.72 4 81.58 0.076 0.00065 13174.81 5 102.91 0.083 0.00056 14412.29 Average 117.08 0.091 0.00055 14276.76 STDEV 35.84 0.020 0.00006 920.02
Tables 19A and 19B: Serum Concentrations and PK Parameters of COVA806.
(298) (A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(299) TABLE-US-00039 TABLE 19A COVA806 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 258.54 321.02 312.40 355.49 333.94 316.28 36.13 6 183.13 215.45 185.28 226.22 226.22 207.26 21.51 24 96.95 129.27 129.27 109.88 124.96 118.06 14.24 48 68.94 105.57 105.57 88.33 94.80 92.64 15.16 96 62.48 79.72 77.56 66.79 86.18 74.54 9.71 144 51.71 71.10 68.94 73.25 58.17 64.63 9.27 192 43.09 51.71 58.17 51.71 40.93 49.12 7.05 240 38.78 38.78 38.78 45.24 21.54 36.63 8.88
(300) TABLE-US-00040 TABLE 19B Pharmacokinetic Parameters COVA 806 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 218.56 0.112 0.00036 15925.26 2 109.78 0.059 0.00037 20661.31 3 137.35 0.071 0.00036 20384.46 4 184.33 0.084 0.00032 19501.67 5 73.77 0.050 0.00047 19107.40 Average 144.76 0.075 0.00037 19116.02 STDEV 57.73 0.024 0.00006 1892.53
Tables 20A and 20B: Serum Concentrations and PK Parameters of COVA807.
(301) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(302) TABLE-US-00041 TABLE 20A COVA807 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 505.82 404.66 441.25 368.07 374.52 418.86 56.59 6 320.71 355.15 245.38 226.01 192.43 267.94 67.75 24 222.78 234.62 154.98 129.15 127.21 173.74 51.52 48 204.48 139.91 137.76 187.26 106.76 155.23 39.82 96 161.43 161.43 120.54 94.71 92.34 126.09 34.11 144 129.15 152.82 109.77 109.77 70.17 114.34 30.38 192 71.03 103.32 75.34 79.64 72.32 80.33 13.27 240 66.73 55.96 71.03 64.57 53.17 62.29 7.49
(303) TABLE-US-00042 TABLE 20B Pharmacokinetic Parameters COVA 807 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 106.59 0.033 0.00021 36284.17 2 66.24 0.023 0.00024 36737.27 3 186.18 0.056 0.00021 28796.38 4 125.40 0.045 0.00025 28400.87 5 187.97 0.074 0.00027 22447.23 Average 134.48 0.046 0.00024 30533.18 STDEV 52.56 0.020 0.00003 6010.62
Tables 21A and 21B: Serum Concentrations and PK Parameters of COVA808.
(304) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(305) TABLE-US-00043 TABLE 21A COVA808 (IL-6R) Concentration (ug/ml) Time Mouse Mouse Mouse Mouse Mouse Average (hr) 1 2 3 4 5 (ug/ml) STDEV 0.5 226.01 256.14 290.58 408.96 279.82 292.30 69.77 6 172.20 191.57 163.59 288.43 204.48 204.05 49.82 24 129.15 161.43 96.86 129.15 126.99 128.72 22.85 48 90.40 124.84 77.49 126.99 161.43 116.23 33.17 96 77.49 90.40 66.73 96.86 109.77 88.25 16.74 144 77.49 96.86 64.57 105.47 96.86 88.25 16.74 192 51.66 58.12 49.51 73.18 75.34 61.56 12.04 240 45.20 21.09 40.90 66.73 27.98 40.38 17.63
(306) TABLE-US-00044 TABLE 21B Pharmacokinetic Parameters COVA 808 Half Life Vz Cl AUC (IL-6R) Mouse ID (h) (ml) (ml/h) (h*ug/ml) 1 158.86 0.076 0.00033 19671.12 2 43.65 0.026 0.00041 23188.10 3 145.68 0.081 0.00039 17277.61 4 220.91 0.066 0.00021 26725.74 5 85.72 0.042 0.00034 25926.65 Average 130.96 0.058 0.00034 22557.84 STDEV 68.48 0.024 0.00008 4041.39
(307)
(308) The mean serum concentrations+/ standard deviation (STDEV) as determined by either IL6R or IL-17A ELISAs are shown for COVA801 and COVA802 with tocilizumab (IL-6R ELISA) as a comparator.
(309)
(310) The mean serum concentrations+/ standard deviation (STDEV) as determined by either IL6R or IL-17A ELISAs are shown for COVA803 and COVA804 with tocilizumab (IL-6R ELISA) as a comparator.
(311)
(312) The mean serum concentrations+/ standard deviation (STDEV) as determined by either IL6R or IL-17A ELISAs are shown for COVA805 and COVA806 with tocilizumab (IL-6R ELISA) as a comparator.
(313)
(314) The mean serum concentrations+/ standard deviation (STDEV) as determined by either IL6R or IL-17A ELISAs are shown for COVA807 and COVA808 with tocilizumab (IL-6R ELISA) as a comparator.
Example 15
(315) Pharmacokinetic Study in Cynomolgus Monkeys
(316) Dosing, Blood Sampling
(317) The determination of the pharmacokinetic properties of FynomAbs denoted as COVA801, COVA802, COVA803, COVA804, COVA806, COVA808, and Tocilizumab were performed by measuring the concentrations by ELISA in cynomolgus monkey serum taken at different time points after a single i.v. injection. Male and female monkeys were intravenously injected with 5 mg/kg dose based on individual weight. Each group consisted of 4 monkeys. Blood was withdrawn at 5 min, 30 min, 2 hr, 6 hr, 24 hr, day 3, day 4, day 5, day 7, day 10, day 13, day 17, day 22, and day 27 after i.v. injection. Blood was collected in tubes without any anti-coagulants and serum was prepared by centrifugation for 1-2 min at 10,000 rpm. The serum was stored at 80 C. until analysis.
(318) IL-6R and IL-17A ELISA
(319) The serum concentration of tested FynomAbs and Tocilizumab were determined by ELISA according to the same protocol outlined above for the mouse PK study.
(320) Data Analysis
(321) Serum concentrations for each monkey were calculated using the standard curve and 4 parameter fit analysis (X value logarithmic, Y value linear). For every time-point and monkey, the average nM serum concentration of duplicate was multiplied by the corresponding dilution factor and then converted to ug/ml STDEV and % CV were calculated for each time point and for the 3 dilution factors. One value with lowest % CV that best represented the linear portion of the standard curve was chosen as the value for each time point. These values were subjected to pharmacokinetic parameter analysis (Phoenix 64, WinNonlin 6.3). Half-life (h), area under the curve (AUC; h*ug/ml), volume of distribution (Vz; ml) and clearance (Cl; ml/h) were calculated using Non-compartmental PK analysis, Model Type: Plasma (200-202), Calculation Method: Linear Trapezoidal Linear Interpolation. Standard curves for each monkey were based on uniform weighting and best fit lambda Z calculation, required at least 3 data points in the regression, and did not include the Cmax.
(322) Results
(323) The serum concentrations and pharmacokinetic parameters of each FynomAb and tocilizumab are shown in Tables 22-28. Although both the IL-6R and IL-17A ELISAs were used to calculate the serum concentrations and PK parameters, only the IL-6R data is shown here. However, similar serum concentrations and PK parameters were determined from the IL-17A ELISA data. Thus the serum concentration versus time curves for the two different ELISA methods look very similar for each FynomAb (see
(324) In general, all of the FynomAbs showed favorable PK profiles as none of the FynomAbs were cleared rapidly from circulation. COVA804 appeared to have the most favorable PK profile with the best AUC that was very similar to tocilizumab.
(325) Tables 22A-22B: Serum Concentrations and PK Parameters of Tocilizumab in Cynomolgus Monkeys.
(326) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A.
(327) TABLE-US-00045 TABLE 22A Tocilizumab (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 141.52 168.20 121.51 129.05 140.07 20.49 0.5 139.20 131.37 91.35 116.29 119.55 21.07 6 95.70 118.90 88.45 109.04 103.02 13.59 24 76.85 88.45 76.85 100.05 85.55 11.11 72 62.35 65.83 46.40 92.80 66.84 19.26 120 40.60 40.89 37.70 69.60 47.20 15.00 168 27.84 33.06 25.81 63.80 37.63 17.71 240 22.62 22.91 21.17 32.19 24.72 5.04 312 11.54 14.67 7.02 21.46 13.67 6.07 408 5.10 3.31 8.64 5.68 2.71 528 2.44 2.44
(328) TABLE-US-00046 TABLE 22B Pharmacokinetic Parameters Tocilizumab Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 68.09 0.035 0.00036 13880.12 2 86.91 0.041 0.00033 14893.51 3 92.55 0.055 0.00041 11238.18 4 68.68 0.022 0.00023 21782.04 Average 79.05 0.038 0.00033 15448.47 STDEV 12.54 0.013 0.00008 4494.75
Tables 23A-23B: Serum Concentrations and PK Parameters of COVA801 in Cynomolgus Monkeys.
(329) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(330) TABLE-US-00047 TABLE 23A COVA801 (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 177.78 119.60 161.62 174.55 158.38 26.78 0.5 189.09 112.16 132.53 126.06 139.96 33.84 6 136.08 84.04 109.90 106.67 109.17 21.31 24 83.72 66.59 74.34 67.88 73.13 7.83 72 48.81 52.04 58.18 58.18 54.30 4.67 120 36.53 27.54 32.32 38.79 33.79 4.96 168 21.66 19.59 25.86 19.39 21.62 3.00 240 10.67 9.37 12.93 8.40 10.34 1.96 312 4.27 2.91 0.16 408 528
(331) TABLE-US-00048 TABLE 23B Pharmacokinetic Parameters COVA 801 Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 62.71 0.039 0.00043 11282.55 2 64.86 0.049 0.00052 9321.33 3 84.64 0.050 0.00041 10538.40 4 54.77 0.037 0.00047 10030.71 Average 66.74 0.044 0.00046 10293.25 STDEV 12.70 0.007 0.00005 827.12
Tables 24A-24B: Serum Concentrations and PK Parameters of COVA802 in Cynomolgus Monkeys.
(332) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(333) TABLE-US-00049 TABLE 24A COVA802 (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 131.88 118.63 103.43 129.29 120.81 12.93 0.5 110.22 115.07 96.97 109.90 108.04 7.75 6 91.48 74.34 54.95 96.97 79.43 18.96 24 56.57 53.98 51.72 77.58 59.96 11.91 72 40.73 43.31 42.02 51.72 44.44 4.96 120 22.30 21.92 32.32 38.79 28.83 8.20 168 11.64 15.84 19.39 21.98 17.21 4.49 240 6.53 10.54 12.93 14.87 11.22 3.59 312 2.72 5.82 408 528
(334) TABLE-US-00050 TABLE 24B Pharmacokinetic Parameters COVA 802 Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 66.00 0.060 0.00063 7259.29 2 70.05 0.061 0.00061 7962.71 3 103.17 0.076 0.00051 7862.69 4 78.34 0.048 0.00043 10999.95 Average 79.39 0.062 0.00055 8521.16 STDEV 16.66 0.011 0.00009 1681.48
Tables 25A-25B: Serum Concentrations and PK Parameters of COVA803 in Cynomolgus Monkeys.
(335) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(336) TABLE-US-00051 TABLE 25A COVA803 (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 125.94 129.29 129.29 142.22 131.69 7.20 0.5 132.40 117.98 106.67 135.76 123.20 13.45 6 119.48 83.07 67.88 119.60 97.51 26.18 24 83.96 59.48 58.18 84.04 71.41 14.54 72 54.90 44.61 45.25 54.95 49.93 5.78 120 32.29 25.86 32.32 38.79 32.32 5.28 168 9.69 19.07 20.04 25.86 18.66 6.69 240 10.86 11.64 12.93 11.81 1.05 312 2.91 3.23 6.46 408 528
(337) TABLE-US-00052 TABLE 25B Pharmacokinetic Parameters COVA 803 Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 48.48 0.036 0.00052 9015.21 2 51.32 0.032 0.00043 11191.67 3 67.61 0.037 0.00038 12088.07 4 45.28 0.055 0.00084 5844.74 Average 53.17 0.040 0.00054 9534.92 STDEV 9.93 0.010 0.00021 2777.94
Tables 26A-26B: Serum Concentrations and PK Parameters of COVA804 in Cynomolgus Monkeys.
(338) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(339) TABLE-US-00053 TABLE 26A COVA804 (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 226.04 309.36 238.96 263.50 259.46 36.71 0.5 203.44 269.64 227.66 201.82 225.64 31.62 6 177.60 140.47 157.91 205.70 170.42 27.99 24 116.25 158.23 115.28 125.61 128.84 20.14 72 83.96 77.50 96.23 82.99 85.17 7.90 120 61.35 50.38 54.90 49.73 54.09 5.36 168 38.75 31.65 29.06 26.80 31.57 5.18 240 23.90 19.83 17.05 20.26 3.44 312 12.92 2.52 408 4.52 528
(340) TABLE-US-00054 TABLE 26B Pharmacokinetic Parameters COVA 804 Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 69.55 0.026 0.00026 18904.03 2 74.29 0.030 0.00028 14644.67 3 76.60 0.030 0.00027 16104.51 4 54.49 0.024 0.00030 16522.15 Average 68.73 0.027 0.00028 16543.84 STDEV 9.94 0.003 0.00002 1767.38
Tables 27A-27B: Serum Concentrations and PK Parameters of COVA806 in Cynomolgus Monkeys.
(341) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(342) TABLE-US-00055 TABLE 27A COVA806 (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 182.27 156.74 193.90 185.82 179.68 16.05 0.5 166.11 141.23 190.67 168.05 166.51 20.21 6 124.42 121.19 161.58 118.60 131.45 20.23 24 70.45 74.33 96.95 53.65 73.84 17.83 72 52.03 63.02 64.63 42.01 55.42 10.55 120 33.29 34.26 38.78 24.24 32.64 6.09 168 25.85 29.09 32.32 14.87 25.53 7.58 240 10.73 16.80 13.57 13.70 3.04 312 6.92 408 528
(343) TABLE-US-00056 TABLE 27B Pharmacokinetic Parameters COVA 806 Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 81.01 0.050 0.00043 10356.49 2 81.60 0.045 0.00038 12207.01 3 78.52 0.039 0.00034 13102.11 4 64.05 0.054 0.00058 7244.31 Average 76.29 0.047 0.00043 10727.48 STDEV 8.27 0.007 0.00010 2588.31
Tables 28A-28B: Serum Concentrations and PK Parameters of COVA808 in Cynomolgus Monkeys.
(344) A) Serum concentrations for each time point as determined by ELISA (IL-6R) are shown. The average values and standard deviation (STDEV) are also depicted. (B) Summary of important pharmacokinetic parameters such as half-life, volume of distribution (Vz), clearance (Cl) and area under the curve (AUC). The parameters were calculated using the serum concentrations presented in A. Similar serum concentrations and PK parameters were determined from IL-17A ELISA.
(345) TABLE-US-00057 TABLE 28A COVA808 (IL-6R) Concentration (ug/ml) Time Monkey Monkey Monkey Monkey Average (hr) 1 2 3 4 (ug/ml) STDEV 0.083 200.18 175.96 129.15 163.05 167.08 29.61 0.5 217.61 172.41 109.77 164.02 165.95 44.23 6 151.75 109.77 96.86 106.55 116.23 24.30 24 79.10 80.39 61.34 71.03 72.97 8.79 72 77.49 65.54 45.20 54.56 60.70 13.94 120 36.16 37.13 32.29 31.32 34.22 2.85 168 22.02 36.81 32.29 17.37 27.12 8.97 240 14.53 20.34 12.91 5.29 13.27 6.20 312 408 528
(346) TABLE-US-00058 TABLE 28B Pharmacokinetic Parameters COVA 808 Half Life Vz Cl AUC (IL-6R) Monkey ID (h) (ml) (ml/h) (h*ug/ml) 1 92.98 0.047 0.00035 12386.59 2 102.19 0.048 0.00033 12365.78 3 87.98 0.056 0.00044 9641.05 4 46.38 0.034 0.00051 9477.10 Average 82.38 0.046 0.00041 10967.63 STDEV 24.71 0.009 0.00008 1627.86
(347)
(348)
(349)
(350)
SUMMARY OF THE EXAMPLES
(351) The data disclosed herein show that all 8 FynomAbs can bind and functionally block both IL-17A and IL-6R. All 8 constructs had very similar affinities for IL-17A and IL-6R and had similar functional activity in cell based assays, and the light chain fynomer fusions (FynomAbs denoted COVA802, COVA804, COVA806 and COVA808) had better SEC profiles and were less prone to aggregation.