Senecavirus A antigens and methods of use

10323069 ยท 2019-06-18

Assignee

Inventors

Cpc classification

International classification

Abstract

A Senecavirus A polypeptide generally includes at least a portion of 151-434 of SEQ ID NO:1, amino acids 435-673 of SEQ ID NO:1, or amino acids 674-937 of SEQ ID NO:1. The Senecavirus A polypeptide may be used as a capture antigen in a method or device for detecting antibody that specifically binds to the Senecavirus A polypeptide. The Senecavirus A polypeptide may be used as a immunogen to vaccinate a subject having or at risk of having a Senecavirus A infection.

Claims

1. A device comprising: a substrate; and a Senecavirus A polypeptide immobilized to the substrate, the Senecavirus A polypeptide comprising: a fragment of amino acids 151-434 of SEQ ID NO:1, the fragment comprising at least: amino acids 162-167 of SEQ ID NO:1, amino acids 179-190 of SEQ ID NO:1, amino acids 223-241 of SEQ ID NO:1, or amino acids 252-294 of SEQ ID NO:1; or at least a portion of amino acids 674-937 of SEQ ID NO:1.

2. The device of claim 1 wherein the fragment of amino acids 151-434 of SEQ ID NO:1 further comprises: amino acids 325-333 of SEQ ID NO:1, amino acids 344-359 of SEQ ID NO:1, amino acids 364-373 of SEQ ID NO:1, amino acids 386-397 of SEQ ID NO:1, or amino acids 409-417 of SEQ ID NO:1.

3. A method for detecting antibody that specifically binds to a Senecavirus A polypeptide in a biological sample obtained from a subject, the method comprising: contacting at least a portion of the sample with a Senecavirus A polypeptide, the Senecavirus A polypeptide comprising: a fragment of amino acids 151-434 of SEQ ID NO:1, the fragment comprising at least: amino acids 162-167 of SEQ ID NO:1, amino acids 179-190 of SEQ ID NO:1, amino acids 223-241 of SEQ ID NO:1, or amino acids 252-294 of SEQ ID NO:1; or at least a portion of amino acids 674-937 of SEQ ID NO:1; and detecting antibody from the biological sample specifically bound to the Senecavirus A polypeptide.

4. The method of claim 3 wherein the Senecavirus A polypeptide is immobilized to a substrate.

5. The method of claim 3, wherein the fragment of amino acids 151-434 of SEQ ID NO:1 further comprises: amino acids 325-333 of SEQ ID NO:1, amino acids 344-359 of SEQ ID NO:1, amino acids 364-373 of SEQ ID NO:1, amino acids 386-397 of SEQ ID NO:1, or amino acids 409-417 of SEQ ID NO:1.

6. A composition comprising: a Senecavirus A polypeptide comprising: a fragment of amino acids 151-434 of SEQ ID NO:1, the fragment comprising at least: amino acids 162-167 of SEQ ID NO:1, amino acids 179-190 of SEQ ID NO:1, amino acids 223-241 of SEQ ID NO:1, or amino acids 252-294 of SEQ ID NO:1; or at least a portion of amino acids 674-937 of SEQ ID NO:1; and an adjuvant.

7. The composition of claim 6, wherein the fragment of amino acids 151-434 of SEQ ID NO:1 further comprises: amino acids 325-333 of SEQ ID NO:1, amino acids 344-359 of SEQ ID NO:1, amino acids 364-373 of SEQ ID NO:1, amino acids 386-397 of SEQ ID NO:1, or amino acids 409-417 of SEQ ID NO:1.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIG. 1. Senecavirus A (SVA) VP1, VP2, and VP3 purified proteins. SVA VP1, VP2, and VP3 genes were cloned and protein was expressed in E. coli. Expressed protein were eluted from cobalt affinity columns and visualized using SDS-PAGE. Left lane shows molecular weight markers (Bio-Rad laboratories, Inc., Hercules, Calif.). Samples are noted on the gel and approximate sizes for each protein are noted on the right side as approximated from the known size of the markers. The marker lane was from the same gel, but part of the image was removed for clarity.

(2) FIG. 2. Time course of antibody responses to SVA VP1, VP2, and VP3. Serum samples collected from sows at the onset of clinical signs until 60 days later were tested in duplicate wells coated with 500 ng of each antigen. Negative control serum (Neg) was from a matched SVA-negative farm. Results are shown as a box whisker plot using the Tukey method for outliers for A) VP1, B) VP2, and C) VP3 proteins. The suspect positive OD range is shown as a grey bar with negatives below and positives above the bar.

(3) FIG. 3. Avidity analysis on VP2 ELISA positive samples. An SVA VP2 avidity ELISA was performed and the avidity index (AI) calculated for each sample. The average AI over the time course is shown as a line using the right y-axis. The percent of samples with a low AI (<50%) at each time point is shown in light grey and the percent with a high AI (>50%) is shown in dark grey using the left y-axis.

(4) FIG. 4. Cross-reactivity analysis of SVA VP2 ELISA to other virus seropositive samples. SVA VP2 ELISA was performed on pig samples that were seropositive to other viruses (FMDV, EMCV, or PEDV), but whose SVA antibody status was unknown. The positive/negative cut-off values for EMCV and PEDV tested at the University of Minnesota, and FMDV tested at PIADC are shown by the dashed line.

(5) FIG. 5. VP2 ELISA and IFA comparison. The percent of VP2 ELISA positive (closed circles) samples and the percent of IFA positive (open squares) and IFA suspect (closed squares) samples are shown over a 60-day time course.

DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS

(6) This disclosure describes an indirect ELISA assay to identify serum antibodies to the Seneca Valley virus Senecavirus A (SVA). Viral protein 1, 2, and 3 (VP1, VP2, VP3) were expressed, isolated, and purified from E. coli and used to coat plates for an indirect ELISA. Sera from pigs with and without idiopathic vesicular disease (IVD) symptoms were analyzed using this indirect ELISA to determine the antibody responses to VP1, VP2, and VP3. A time course study following animals from an infected farm was also performed using the ELISA. Antibody responses to VP2 were higher than VP1 and VP3 and showed high affinity binding on an avidity ELISA. The quantitative ELISA results were compared with an immunofluorescence antibody (IFA) assay, also in development, showing similar results.

(7) Seneca Valley virus (SVV) is a member of the family Picornaviridae, genus Senecavirus. Senecavirus A (SVA) is a recently identified single-stranded RNA virus closely related to members of the Cardioviruses genus. SVV was originally identified as a cell culture contaminant and was not associated with disease until 2007 when it was first observed in pigs with Idiopathic Vesicular Disease (IVD). Vesicular disease is sporadically observed in swine, is not debilitating, but is significant due to its resemblance to foreign animals diseases, such as foot and mouth disease. IVD disrupts swine production until foreign animal diseases can be ruled out. Identifying and characterizing SVA as a cause of IVD can help to quickly rule out infection by foreign animal diseases.

(8) IVD has been observed recently in Canada, the United States, and Brazil, with vesicular foreign animal disease being ruled out while SVA was present. A quick test to diagnose SVA infection is necessary to help rule out infection by foreign animals disease. As of now, SVA infection is diagnosed by RT-PCR, a serum neutralizing assay, IFA, or cELISA (complement-enzyme-linked immunosorbent assay). RT-PCR is a quick and easy way to determine if animals are infected with or if vesicles contain SVA, but a negative result may mean that the animal has already cleared the infection; it cannot be properly interpreted as meaning that the animal was never infected. Detecting antibodies to SVA can determine whether an animal has been infected and is still protected against infection. Although serum neutralizing assays and IFA can measure the presence of serum antibodies, ELISAs are quicker and less expensive assays. A rapid, specific, and sensitive assay for detecting SVA-specific antibodies is needed. A cELISA for detecting SVA antibodies is available, but requires an antibody competition between well characterized monoclonal antibodies and serum antibodies for binding to viral antigen. An indirect ELISA only requires a purified antigen. An indirect ELISA is not yet available for the detection of anti-SVA antibodies in pigs.

(9) This disclosure describes the development and characterization of an indirect ELISA assay to identify serum antibodies to SVA. Viral protein 1, 2 and 3 (VP1, VP2, VP3) were expressed, isolated, and purified from E. coli and used to coat plates for an indirect ELISA. This ELISA can now be used to help differentially diagnose IVD due to SVA helping to quickly rule out the presence of economically devastating foreign animal disease.

(10) The SVA VP1, VP2, and VP3 proteins were cloned, expressed, and purified. Protein preparations were observed to be >90% pure (FIG. 1). ELISA plates were coated with 500 ng/well of VP1, VP2, or VP3 protein and samples were examined for anti-SVA antibody reactivity. As a negative control, samples from a farm that was clinically negative and PCR negative for SVA were analyzed. These samples were used to determine the cut-off values for negative (<OD.sub.avg+1StdDev) and positive samples (>OD.sub.avg+2StdDev). Suspect positive samples occurred if the OD value fell between the negative and positive sample cut-off values.

(11) The SVA ELISA was tested using samples from a farm showing clinical signs. A time course of samples starting at the day clinical signs were first observed (Day 0) and sampled up to 60 days post-break (Days 4, 11, 18, 25, 39, 60) were examined. ELISAs using VP1, VP2, or VP3 protein were performed (FIG. 2). The VP2 protein gave the largest range of OD values and the biggest difference between positive and negative sample values. The VP2 protein was used for further ELISA analysis of samples for SVA.

(12) An ELISA using a combination of 100 ng of each VP1, VP2, and VP3 proteins was also performed on negative samples as well as on the time course samples. Results correlated with that of VP2 alone (r.sup.2=0.927, p<0.0001), although background values for the combination ELISA were higher (data not shown).

(13) Examination of negative samples, positive samples, and backgrounds were used to optimize the ELISA. Coating of the ELISA plates with 200 ng/well of each protein was chosen for further analysis of samples. A ROC analysis was performed using 116 negative samples and 205 positive samples to determine optimal cut-off values for the VP2 ELISA. The area under the curve to differentiate positive from negative values was 0.9622 with a p value <0.0001. A positive sample cut-off value of OD>0.6 was selected to identify positive samples. This gives a sensitivity of 94.2% and a specificity of 89.7%.

(14) An avidity ELISA was performed on a subset of negative samples as well as the samples over a time course of infection. The avidity index was determined at each time point for those samples that were tested as ELISA positive (OD>0.6 cut-off). Both the average avidity index and the number of samples with a high avidity index (AI>50%) increased over time (FIG. 3). This suggests that the avidity index may be able to be used as an indicator of the amount of time that has passed since original infection.

(15) An SVA immunofluorescence assay (IFA) was developed at the University of Minnesota diagnostic lab and is in the process of being validated. A set of SVA negative samples as well as the time course samples were examined by IFA. A comparison between positive and negative IFA and ELISA results was performed at each time point. The percent of samples that matched (either both positive or both negative) at each time point or in the negative samples is shown in FIG. 5. By 4 days after clinical signs were first observed, the two assays correlated in 81% of samples. However, on the day that clinical signs were first observed, the two assays only correlated in 40% of samples, with many samples positive by ELISA, but negative or suspect by IFA. This suggests that ELISA is able to detect SVA antibodies earlier than the IFA test.

(16) The incidence of SVA cases has greatly increased since the middle of 2015. Due to the similarity of SVA symptoms to the symptoms of foreign animal disease (FAD, such as FMDV), which present as vesicular disease, SVA causes a halt in animal movement and production until FAD is ruled out. Diagnostics that can quickly identify SVA as the cause of IVD, as well as running diagnostics to rule out FAD, are necessary for maintaining healthy and efficient swine production. The SVA VP2 ELISA described herein is sensitive and specific for the diagnosis of SVA-specific antibodies.

(17) The SVA ELISA uses the SVA VP2 protein as the antigen to determine the presence of antibodies to SVA, thus suggesting past infection by SVA. The sensitivity (94.2%) and specificity (89.7%) of the ELISA are such that infected herds will be easily identified. SVA antibodies continue to be observed at 60 days post-clinical signs and should continue to be present longer than that. Analysis of the avidity of the antibodies has been shown to differentiate between antibodies from early in infection (up to 18 days post-clinical signs) to those from later time points (25 days or more after clinical signs first observed), thus allowing for an approximation of when the herd was infected.

(18) A comparison of the ELISA results with that of an IFA test showed that ELISA was more sensitive in diagnosing early time points of infection. At later time points in infection ELISA and IFA were both able to identify SVA positive animals at similar rates.

(19) This SVA VP2 ELISA can quickly and effectively detect SVA antibodies present in swine. Identification of SVA infection as the cause of IVD can help to quickly rule out the presence of economically devastating foreign animal diseases in swine and allow the farm to return to normal production after clinical signs have resolved.

(20) This disclosure therefore describes, in one aspect, a device and a method for detecting SVA antibodies in a biological sample obtained from a subject. Generally, the device includes a Senecavirus A polypeptide immobilized to the substrate. The Senecavirus A polypeptide includes a portion of SEQ ID NO:1. In various embodiments, the Senecavirus A polypeptide includes the SVA VP2 (amino acids 151-434 of SEQ ID NO:1), SVA VP1 (amino acids 674-937 of SEQ ID NO:1), or SVA VP3 (amino acids 435-673 of SEQ ID NO:1). In one particular embodiment, the Senecavirus A polypeptide includes the SVA VP2 (amino acids 151-434 of SEQ ID NO:1). In other embodiments, however, the Senecavirus A polypeptide can include a fragment of VP1, VP2, or VP3. Exemplary fragment of VP2 that can form the basis of a Senecavirus A polypeptide include amino acids 162-167 of SEQ ID NO:1, amino acids 179-190 of SEQ ID NO:1, amino acids 223-241 of SEQ ID NO:1, amino acids 252-294 of SEQ ID NO:1, amino acids 325-333 of SEQ ID NO:1, amino acids 344-359 of SEQ ID NO:1, amino acids 364-373 of SEQ ID NO:1, amino acids 386-397 of SEQ ID NO:1, or amino acids 409-417 of SEQ ID NO:1.

(21) In some embodiments, the Senecavirus A polypeptide can include one or more amino acids appended to the N-terminal or the C-terminal of the VP1, VP2, or VP3 amino acid sequence. Exemplary amino acids additions include, for example, the MYC-tag (EQKLISEEDL, SEQ ID NO:2) or the 6His-tag (HHHHHH, SEQ ID NO:3) or both in combination. In the preferred embodiment, the MYC-tag is positioned at the N-terminus and the 6His-tag is positioned at the C-terminus. Other embodiments include production of chimeric proteins containing the VP1, VP2, or VP3 amino acid sequence fused in frame at either the N-terminus or the C-terminus to various other proteins (or a fragment thereof) including, but not limited to, glutathione-S-transferase, maltose-binding protein, streptavidin, and the streptavidin-binding peptide. In still other embodiments, a Senecavirus A polypeptide can include additional amino acids from SEQ ID NO:1, so long as the Senecavirus A polypeptide contains no more than about 1000 amino acids of SEQ ID NO:1. Thus, in some embodiments, the Senecavirus A polypeptide can include up to approximately 800 amino acids.

(22) In use, the device may be contacted with at least a portion of sample from a subject that has been, or is at risk of having been, exposed to Senecavirus A. The portion of the sample is contacted with the device under conditions effective to allow antibody in the sample to specifically bind to the Senecavirus A polypeptide. As used herein, the term specifically bind refers to having a differential or a non-general affinity, to any degree, for a particular target such as the Senecavirus A polypeptide. In some cases, the specificity of the binding can be established by allowing antibody to specifically bind to the Senecavirus A polypeptide, then washing away antibody (and other components of the sample) that do not bind to the Senecavirus A polypeptide or that exhibit only general, non-differential binding to the Senecavirus A polypeptide.

(23) The antibody remaining after the wash forms a complex with the Senecavirus A polypeptide that may be detected by any suitable method. In one exemplary embodiment, the antibody-Senecavirus A polypeptide complex may be detected using a secondary antibody that binds to antibody produced by the subject from which the biological sample was obtained. In a second exemplary embodiment, the antibody-Senecavirus A polypeptide complex may be detected by reactivity with Senecavirus A polypeptide that is modified in the same way as a secondary antibody so that it can be detected. Another exemplary embodiment involves the use of a blocking assay, in which a labeled antibody (e.g., a monoclonal antibody) against the Senecavirus A polypeptide is applied to the device in combination with the sample. The presence of sample antibodies specific for Senecavirus A polypeptide is inferred from the reduction in reactivity of the labeled antibody due to competition with sample antibodies.

(24) In another aspect, this disclosure describes a composition that includes any embodiment of the Senecavirus A polypeptide described immediately above and an adjuvant. The composition may be used to provide treatment of a subject having or at risk of having a Senecavirus A infection. As used herein, treat, treatment, and variations thereof refer to reducing, limiting progression, ameliorating, or resolving, to any extent, the symptoms or signs related to a condition. A treatment may be therapeutic or prophylactic. Therapeutic and variations thereof refer to a treatment that ameliorates one or more existing symptoms or clinical signs associated with a condition. Prophylactic and variations thereof refer to a treatment that limits, to any extent, the development and/or appearance of a symptom or clinical sign of a condition. Generally, a therapeutic treatment is initiated after the condition manifests in a subject, while prophylactic treatment is initiated before a condition manifests in a subject. As used herein, symptom refers to any subjective evidence of disease or of a patient's condition, while sign or clinical sign refers to an objective physical finding relating to a particular condition capable of being found by one other than the patient. The term at risk refers to a subject that may or may not actually possess the described risk. Thus, for example, a subject at risk of infection by Senecavirus A (SVA) is a subject present in an area where individuals have been identified as infected by SVA and/or is likely to be exposed to SVA even if the subject has not yet manifested any detectable indication of infection by SVA and regardless of whether the subject may harbor a subclinical amount of SVA.

(25) A composition that includes a Senecavirus A polypeptide may be formulated with a pharmaceutically acceptable carrier. As used herein, carrier includes any solvent, dispersion medium, vehicle, coating, diluent, antibacterial, and/or antifungal agent, isotonic agent, absorption delaying agent, buffer, carrier solution, suspension, colloid, and the like. The use of such media and/or agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the Senecavirus A polypeptide, its use in the therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions. As used herein, pharmaceutically acceptable refers to a material that is not biologically or otherwise undesirable, i.e., the material may be administered to an individual along with the Senecavirus A polypeptide without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.

(26) The Senecavirus A polypeptide may therefore be formulated into a pharmaceutical composition. The pharmaceutical composition may be formulated in a variety of forms adapted to a preferred route of administration. Thus, a composition can be administered via known routes including, for example, oral, parenteral (e.g., intradermal, transcutaneous, percutaneous, subcutaneous, intramuscular, intravenous, intraperitoneal, etc.), or topical (e.g., intranasal, intrapulmonary, intramammary, intravaginal, intrauterine, intradermal, transcutaneous, rectally, etc.). A pharmaceutical composition can be administered to a mucosal surface, such as by administration to, for example, the nasal or respiratory mucosa (e.g., by spray or aerosol). A composition also can be administered via a sustained or delayed release.

(27) Thus, the composition may be provided in any suitable form including but not limited to a solution, a suspension, an emulsion, a spray, an aerosol, or any form of mixture. The composition may be delivered in formulation with any pharmaceutically acceptable excipient, carrier, or vehicle. For example, the formulation may be delivered in a conventional topical dosage form such as, for example, a cream, an ointment, an aerosol formulation, a non-aerosol spray, a gel, a lotion, and the like. The formulation may further include one or more additives including such as, for example, an adjuvant, a skin penetration enhancer, a colorant, a fragrance, a flavoring, a moisturizer, a thickener, and the like.

(28) A formulation may be conveniently presented in unit dosage form and may be prepared by methods well known in the art of pharmacy. Methods of preparing a composition with a pharmaceutically acceptable carrier include the step of bringing the Senecavirus A polypeptide into association with a carrier that constitutes one or more accessory ingredients. In general, a formulation may be prepared by uniformly and/or intimately bringing the active compound into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into the desired formulations.

(29) The amount of Senecavirus A polypeptide administered can vary depending on various factors including, but not limited to, the specific Senecavirus A polypeptide included in the composition, the weight, physical condition, and/or age of the subject, and/or the route of administration. Thus, the absolute weight of Senecavirus A polypeptide included in a given unit dosage form can vary widely, and depends upon factors such as the species, age, weight and physical condition of the subject, and/or the method of administration. Accordingly, it is not practical to set forth generally the amount that constitutes an amount of Senecavirus A polypeptide effective for all possible applications. Those of ordinary skill in the art, however, can readily determine the appropriate amount with due consideration of such factors.

(30) In some embodiments, the method can include administering sufficient Senecavirus A polypeptide to provide a dose of, for example, from about 20 g to 200 g to the subject, although in some embodiments the methods may be performed by administering Senecavirus A polypeptide in a dose outside this range. In some of these embodiments, the method includes administering sufficient Senecavirus A polypeptide to provide a dose of 20 g to 100 g per animal per dose.

(31) In some embodiments, Senecavirus A polypeptide may be administered, for example, from a single dose to multiple doses at an interval of one week up to four weeks, although in some embodiments the method can be performed by administering Senecavirus A polypeptide at a frequency outside this range. In certain embodiments, Senecavirus A polypeptide may be administered once or twice or three times in the first four to eight weeks of life. Senecavirus A polypeptide might also be administered to nave juveniles or adults not previously administered Senecavirus A polypeptide in the same manner, or to previously administered juveniles or adults in the same manner at intervals of time as a boost to maintain a positive immune status. The interval of time may vary from 3 months to 12 months.

(32) In the preceding description and following claims, the term and/or means one or all of the listed elements or a combination of any two or more of the listed elements; the terms comprises, comprising, and variations thereof are to be construed as open endedi.e., additional elements or steps are optional and may or may not be present; unless otherwise specified, a, an, the, and at least one are used interchangeably and mean one or more than one; and the recitations of numerical ranges by endpoints include all numbers subsumed within that range (e.g., 1 to 5 includes 1, 1.5, 2, 2.75, 3, 3.80, 4, 5, etc.).

(33) In the preceding description, particular embodiments may be described in isolation for clarity. Unless otherwise expressly specified that the features of a particular embodiment are incompatible with the features of another embodiment, certain embodiments can include a combination of compatible features described herein in connection with one or more embodiments.

(34) For any method disclosed herein that includes discrete steps, the steps may be conducted in any feasible order. And, as appropriate, any combination of two or more steps may be conducted simultaneously.

(35) The present invention is illustrated by the following examples. It is to be understood that the particular examples, materials, amounts, and procedures are to be interpreted broadly in accordance with the scope and spirit of the invention as set forth herein.

EXAMPLES

(36) Cloning, Expression and Purification of SVA VP1, VP2, and VP3 Protein

(37) The full-length gene sequence for SVA VP1, VP2, and VP3 strain 11-55910-3 (Genbank ID AGM16001) was optimized for expression in E. coli and the optimized genes were synthesized (Integrated DNA Technologies, Inc., Coralville, Iowa) and cloned into a modified pET24b vector (Novagen, Madison, Wis.; Puvanendiran et al., Virus Res 157(1):92-98, 2011) using the In-Fusion cloning kit (Clontech, Mountain View, Calif.) following the manufacturer's directions. Gene sequences for VP1, VP2, and VP3 antigens were confirmed by sequencing. Protein expression and purification was performed as previously described (Dvorak et al., Veterinary Microbiology 189:86-90, 2016). Purity was analyzed by SDS-PAGE and concentration was determined using the Quick start Bradford protein assay following manufacturer's instructions (Bio-Rad laboratories, Inc., Hercules, Calif.) using a Bio-tek Epoch plate reader (BioTek Instruments, Inc., Winooski, Vt.).

(38) Serum Samples

(39) Porcine serum samples were obtained from the University of Minnesota Diagnostic laboratory. Samples included serum from presumed SVA negative farms and an SVA positive farm sampled over a 60-day time course following the observation of clinical signs (noted as day 0).

(40) Antibody Detection by ELISA and IFA

(41) Detection of antibodies to SVA VP1, VP2, and VP3 protein was performed by indirect ELISA as previously described (Puvanendiran et al., Virus Res 157(1):92-98, 2011; Dvorak et al., Veterinary Microbiology 189:86-90, 2016). Before optimization of the assay, the test samples were run on plates coated with 500 ng of antigen/well. Plates for the optimized VP2 ELISA were coated with 200 ng/well. Positive and negative serum samples were run on each plate.

(42) An avidity ELISA was performed following the ELISA protocol above with the addition of a guanidine wash step. Before secondary antibody was added, 1 M guanidine in phosphate-buffered saline containing 0.05% Tween 20 (PBST), pH 7.4, was added to each well and incubated for 10 minutes. Plates were then washed as usual, secondary antibody was added, and the remainder of the protocol was performed as usual. The avidity index was determined by dividing the OD of the sample with guanidine by the OD of the sample without guanidine multiplied by 100: (OD.sub.Gn+/OD.sub.Gn)100.

(43) Human lung cancer NCI-H1299 cells were inoculated with SVA strain isolated from a 2015 outbreak in the U.S.A. Infected cells were washed with PBS, fixed with acetone and incubated using two-fold dilutions of serum from 1:20 to 1:320 at 27 C. for one hour. Fluorescein-labeled goat anti-pig IgG was diluted 1:50 in PBS, added into the wells and incubated at 37 C. for one hour. The cells were observed under fluorescence microscopy. A positive signal at a sample dilution of 1:20 was considered suspect and 1:40 or higher was considered to be positive.

(44) Statistical Methods

(45) ELISA analysis and comparison to the IFA results were performed using GraphPad Prism software (Version 5.0a, GraphPad Software, Inc., La Jolla, Calif.).

(46) The complete disclosure of all patents, patent applications, and publications, and electronically available material (including, for instance, nucleotide sequence submissions in, e.g., GenBank and RefSeq, and amino acid sequence submissions in, e.g., SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq) cited herein are incorporated by reference in their entirety. In the event that any inconsistency exists between the disclosure of the present application and the disclosure(s) of any document incorporated herein by reference, the disclosure of the present application shall govern. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.

(47) Unless otherwise indicated, all numbers expressing quantities of components, molecular weights, and so forth used in the specification and claims are to be understood as being modified in all instances by the term about. Accordingly, unless otherwise indicated to the contrary, the numerical parameters set forth in the specification and claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques.

(48) Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. All numerical values, however, inherently contain a range necessarily resulting from the standard deviation found in their respective testing measurements.

(49) All headings are for the convenience of the reader and should not be used to limit the meaning of the text that follows the heading, unless so specified.

Sequence Listing Free Text

(50) TABLE-US-00001 SenecavirusApolyprotein(AGM16001.1) SEQIDNO:1 1 MQNSHFSFDTASGTFEDVTGTKVKIVEYPRSVNNGVYDSSTHLEILNLQGEIEILRSFNE 61 YQIRAAKQQLGLDIVYELQGNVQTTSKNDFDSRGNNGNMTFNYYANTYQNSVDFSTSSSA 121 SGAGPGNSRGGLAGLLTNFSGILNPLGYLKDHNTEEMENSADRVITQTAGNTAINTQSSL 181 GVLCAYVEDPTKSDPPSSSTDQPTTTFTAIDRWYTGRLNSWTKAVKTFSFQAVPLPGAFL 241 SRQGGLNGGAFTATLHRHFLMKCGWQVQVQCNLTQFHQGALLVAMVPETTLDVKPDGKAK 301 SLQELNEEQWVEMSDDYRTGKNMPFQSLGTYYRPPNWTWGPNFINPYQVTVFPHQILNAR 361 TSTSVDISVPYIGETPTQSSETQNSWTLLVMVLVPLDYKEGATTDPEITFSVRPTSPYFN 421 GLRNRYTTGTDEEQGPIPTAPRENSLMFLSTIPDDTVPAYGNVRTPPVNYLPGEITDLLQ 481 LARIPTLMAFGRVSEPEPASDAYVPYVAVPTQFDDKPLISFPITLSDPVYQNTLVGAISS 541 NFANYRGCIQITLTFCGPMMARGKFLLSYSPPNGTQPQTLSEAMQCTYSIWDIGLNSSWT 601 FVIPYISPSDYRETRAITNSVYSADGWFSLHKLTKITLPPDCPQKPCILFFASAGEDYTL 661 RLPVDCNPSYVFHSTDNAETGVIEAGNTDTDFSGELAAPGSNHTNVKFLFDRSRLLNVIK 721 VLEKDAVFPRPFPTETGAQQDDGYFCLLTPRPTVASRPATRFGLYVNPSDSGVLANTSLD 781 FNFYSLACFTYFRSDLEVTVVSLEPDLEFAVGWFPSGSEYQASSFVYDQLHVPYHFTGRT 841 PRAFTSKGGKVSFVLPWNSVSSVLPVRWGAASKLSSATRGLPAHADWGTIYAFVPRPNEK 901 KSTAVKHVAVYVRYKNARAWCPSMLPFRSYKQKMLMQSGDIETNPGPASDNPILEFLEAE 961 NDLVTLASLWKMVHSVQQTWRKYVKNDNFWPNLLSELVGEGSIALAATLSNQASVKALLG 1021 LHFLSRGLNYTDFYSLLIEKCSSFFTVEPPPPPAENLMTKPSVKSKFRKLFKMQGPMDKV 1081 KDWNQIAAGLKNFQFVRDLVKEVVDWLQAWINKEKASPVLQYQLEMKKLGPVALAHDAFM 1141 AGSGPPLSDDQIEYLQNLKSLALTLGKTNLAQSLTTMINAKQSSAQRVEPVVVVLRGKPG 1201 CGKSLASTLIAQAVSKRLYGSQSVYSLPPDPDFFDGYKGQFVTLMDDLGQNPDGQDFSTF 1261 CQMVSTAQFLPNMADLAEKGRPFTSNLIIATTNLPHFSPVTIADPSAVSRRINYDLTLEV 1321 SEAYKKHTRLNFDLAFRRTDAPPIYPFAAHVPFVDVAVRFKNGHQNFNLLELVDSICADI 1381 RAKQQGARNMQTLVLQSPNENDDTPVDEALGRVLTPAAVDEALVDLAPEADPVGRLAILA 1441 KLGLALAAVTPGLIILAVGLYRYFSGSDTDQDETECEESTKAPRSENAYDGPKKNSKPPG 1501 ALSLMEMQQPNVDMGFEAAVAKKVVVPITFMVPNRPSGLTQSALLVAGRTFLINEHTWSN 1561 PSWTSFTIRGEVHTRDEPFQTVHFTHHGVPTDLMMVRLGPGNSFPNNLDKFGLDQMPARN 1621 SRVVGVSSSYGNFFFSGNFLGFVDSITSEQGTYARLFRYRVTTYKGWCGSALVCEAGGVR 1681 RIIGLHSAGAAGIGAGTYISKLGLIKALKHLGEPLATMQGLMTELEPGITVHVPRKSKLR 1741 KTTAHAVYKPEFEPAVLSKFDPRLNKDVDLDEVIWSKHTANVPYQPPLFYTYMSEYAHRV 1801 FSFLGKDNDILTVKEAILGIPGLDPMDPHTAPGLPYAINGLRRTDLVDFVNGTVDAALAM 1861 QIQKFLDGDYSDHVFQTFLKDEIRPSEKVRAGKTRIVDVPSLAHCIVGRMLLGRFAAKFQ 1921 SHPGFLLGSAIGSDPDVFWTVIGAQLEGRKNTYDVDYSAFDSSHGTGSFEALISHFFTVD 1981 NGFSPALGPYLRSLAVSVHAYGERRIKITGGLPSGCAATSLLNTVLNNVIIRTALALTYK 2041 EFEYDMVDIIAYGDDLLVGTDYDLDFNEVARRAAKLGYKMTPANKGSVFPPTSSLSDAVF 2101 LKRKFVQNNDGLYKPVMDLKNLEAMLSYFKPGTLLEKLQSVSMLAQHSGKEEYDRLMHPF 2161 ADYGAVPSHEYLQARWRALFD