RECOMBINANT INFLUENZA VIRUS-LIKE PARTICLES (VLPS) PRODUCED IN TRANSGENIC PLANTS
20190177739 ยท 2019-06-13
Inventors
- Marc-Andre D'Aoust (Quebec, CA)
- Manon Couture (St. Augustin de Desmaures, CA)
- Frederic Ors (Quebec, CA)
- Sonia Trepanier (St. Nicolas, CA)
- Pierre-Olivier Lavoie (Quebec, CA)
- Michele Dargis (Quebec, CA)
- Louis-Philippe Vezina (Neuville, CA)
- Nathalie Landry (St.-Romuald, CA)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K2039/58
HUMAN NECESSITIES
C12N2760/16122
CHEMISTRY; METALLURGY
C12N15/8258
CHEMISTRY; METALLURGY
C12N2760/16022
CHEMISTRY; METALLURGY
C12N2760/16151
CHEMISTRY; METALLURGY
C12N2760/16134
CHEMISTRY; METALLURGY
C12N15/8257
CHEMISTRY; METALLURGY
C12N2760/16133
CHEMISTRY; METALLURGY
C12N2760/16222
CHEMISTRY; METALLURGY
C12Y503/04001
CHEMISTRY; METALLURGY
C12N2760/16234
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
G06F9/50
PHYSICS
C12N7/00
CHEMISTRY; METALLURGY
Abstract
A method for synthesizing influenza virus-like particles (VLPs) within a plant or a portion of a plant is provided. The method involves expression of influenza HA in plants and the purification by size exclusion chromatography. The invention is also directed towards a VLP comprising influenza HA protein and plant lipids. The invention is also directed to a nucleic acid encoding influenza HA as well as vectors. The VLPs may be used to formulate influenza vaccines, or may be used to enrich existing vaccines.
Claims
1-18. (canceled)
19. A composition comprising an effective dose of a mixture of influenza virus like particles (VLPs), the mixture comprising VLPs derived from two or more than two strains of influenza, wherein each of the VLPs comprise one or more than one lipid derived from a host.
20. The composition of claim 19, further comprising a pharmaceutically acceptable carrier.
21. The composition of claim 19, wherein the host is a plant, portion of a plant or plant cell.
22. The composition of claim 19, wherein the VLPs are derived from type A influenza strain, type B influenza strain or a combination thereof.
23. The composition of claim 22, wherein the type B influenza strain is from Yamagata lineage or Victoria lineage.
24. The composition of claim 22, wherein the type A influenza strain is from subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16.
25. The composition of claim 19, wherein the mixtures comprises VLPs derived from subtype H1 of influenza type A, subtype H3 of influenza type A, Yamagata lineage of influenza type B, or Victoria lineage of influenza type B.
26. The composition of claim 19, wherein the two or more than two strains of influenza comprise influenza hemagglutinin (HA), the HA having 70%-100% sequence identity with the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 74, SEQ ID NO: 75 or SEQ ID NO: 76.
27. The composition of claim 19, wherein the mixture of VLPs, comprises the VLPs derived from two or more than two strains of influenza in equivalent ratios.
28. A composition comprising an effective dose of a mixture of influenza virus like particles (VLPs), the mixture comprising VLPs derived from two or more than two strains of influenza, the VLPs produced in a host by a method comprising: a) introducing into the host one or more than one nucleic acid comprising one or more than one nucleotide sequence encoding influenza hemagglutinin (HA) from two or more than two strains of influenza, the HA being operatively linked to a regulatory element that is operative in the host, and b) incubating the host under conditions that permit the expression of the one or more than one nucleic acid, thereby producing the VLPs from the two or more than two strains of influenza, wherein each of the VLPs comprise one or more than one lipid derived from the host, and c) harvesting the host and purifying the VLPs to produce the composition comprising the effective dose of the mixture of influenza VLPs.
29. The composition of claim 28, further comprising a pharmaceutically acceptable carrier.
30. The composition of claim 28, wherein the host is a plant, portion of a plant or plant cell.
31. The composition of claim 28, wherein the VLPs are derived from type A influenza strain, type B influenza strain or a combination thereof.
32. The composition of claim 31, wherein the type B influenza strain is from Yamagata lineage or Victoria lineage.
33. The composition of claim 31, wherein the type A influenza strain is from subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16.
34. The composition of claim 28, wherein the mixtures comprises VLPs derived from subtype H1 of influenza type A, subtype H3 of influenza type A, Yamagata lineage of influenza type B, or Victoria lineage of influenza type B.
35. The composition of claim 28, wherein the two or more than two strains of influenza comprise influenza hemagglutinin (HA), the HA having 70%400% sequence identity with the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 74, SEQ ID NO: 75 or SEQ ID NO: 76.
36. The composition of claim 28, wherein the mixture of VLPs, comprises the VLPs derived from two or more than two strains of influenza in equivalent ratios.
37. A composition comprising an effective dose of a mixture of influenza virus like particle (VLPs), the mixture comprising VLPs derived from two or more than two strains of influenza, the VLPs produced in a host by a method comprising: a) providing the host, the host comprising one or more than one nucleic acid comprising one or more than one nucleotide sequence encoding influenza hemagglutinin (HA) from two or more than two strains of influenza, the HA being operatively linked to a regulatory element that is operative in the host, and b) incubating the host under conditions that permit the expression of the one or more than one nucleic acid, thereby producing the VLPs from two or more than two strains of influenza, wherein the VLPs comprise one or more than one lipid derived from the host, and c) harvesting the host and purifying the VLPs to produce the composition comprising the effective dose of the mixture of influenza VLPs.
38. The composition of claim 37, further comprising a pharmaceutically acceptable carrier.
39. The composition of claim 37, wherein the host is a plant, portion of a plant or plant cell.
40. The composition of claim 37, wherein the VLPs are derived from type A influenza strain, type B influenza strain or a combination thereof.
41. The composition of claim 40, wherein the type B influenza strain is from Yamagata lineage or Victoria lineage.
42. The composition of claim 40, wherein the type A influenza strain is from subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16.
43. The composition of claim 37, wherein the mixtures comprises VLPs derived from subtype H1 of influenza type A, subtype H3 of influenza type A, Yamagata lineage of influenza type B, or Victoria lineage of influenza type B.
44. The composition of claim 37, wherein the two or more than two strains of influenza comprise influenza hemagglutinin (HA), the HA having 70%-100% sequence identity with the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 74, SEQ ID NO: 75 or SEQ ID NO: 76.
45. The composition of claim 37, wherein the mixture of VLPs, comprises the VLPs derived from two or more than two strains of influenza in equivalent ratios.
46. A method for inducing immunity to an influenza virus in a subject comprising administering the composition of claim 19 and a pharmaceutically acceptable carrier to the subject.
47. The method of claim 46, wherein the composition is administered to the subject orally, intradermally, intranasally, intramuscularly, intraperitoneally, intravenously, or subcutaneously.
48. A method for inducing immunity to an influenza virus in a subject comprising administering the composition of claim 28 and a pharmaceutically acceptable carrier to the subject.
49. The method of claim 48, wherein the composition is administered to the subject orally, intradermally, intranasally, intramuscularly, intraperitoneally, intravenously, or subcutaneously.
50. A method for inducing immunity to an influenza virus in a subject comprising administering the composition of claim 37 and a pharmaceutically acceptable carrier to the subject.
51. The method of claim 50, wherein the composition is administered to the subject orally, intradermally, intranasally, intramuscularly, intraperitoneally, intravenously, or subcutaneously.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0067] These and other features of the invention will become more apparent from the following description in which reference is made to the appended drawings wherein:
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
[0215]
[0216]
[0217]
[0218]
[0219]
[0220]
[0221]
[0222]
[0223]
[0224]
[0225]
[0226]
[0227]
[0228]
[0229]
[0230]
[0231]
[0232]
[0233]
[0234]
DETAILED DESCRIPTION
[0235] The present invention relates to the production of virus-like particles. More specifically, the present invention is directed to the production of virus-like particles comprising influenza antigens.
[0236] The following description is of a preferred embodiment.
[0237] The present invention provides a nucleic acid comprising a nucleotide sequence encoding an antigen from an enveloped virus, for example, the influenza hemagglutinin (HA), operatively linked to a regulatory region active in a plant.
[0238] Furthermore, the present invention provides a method of producing virus like particles (VLPs) in a plant. The method involves introducing a nucleic acid encoding an antigen operatively linked to a regulatory region active in the plant, into the plant, or portion of the plant, and incubating the plant or a portion of the plant under conditions that permit the expression of the nucleic acid, thereby producing the VLPs.
[0239] VLPs may be produced from influenza virus, however, VLPs may also be produced from other plasma membrane derived virus including but not limited to Measles, Ebola, Marburg, and HIV.
[0240] The invention includes VLPs of all types of influenza virus which may infect humans, including for example, but not limited to the very prevalent A (H1N1) sub-type (e.g. A/New Caledonia/20/99 (H1N1)), the A/Indonesia/5/05 sub-type (H5N1) (SEQ ID NO: 60) and the less common B type (for example SEQ ID NO:26,
[0241] The present invention also pertains to influenza viruses which infect other mammals or host animals, for example humans, primates, horses, pigs, birds, avian water fowl, migratory birds, quail, duck, geese, poultry, chicken, camel, canine, dogs, feline, cats, tiger, leopard, civet, mink, stone marten, ferrets, house pets, livestock, mice, rats, seal, whale and the like.
[0242] Non limiting examples of other antigens that may be expressed in plasma membrane derived viruses include, the Capsid protein of HIV-p24; gp120, gp41-envelope proteins, the structural proteins VP30 and VP35; Gp/SGP (a glycosylated integral membrane protein) of Filoviruses, for example Ebola or Marburg, or the H protein, and F protein of Paramyxoviruses, for example, Measles.
[0243] The invention also includes, but is not limited to, influenza derived VLPs that obtain a lipid envelope from the plasma membrane of the cell in which the VLP proteins are expressed. For example, if the VLP is expressed in a plant-based system, the VLP may obtain a lipid envelope from the plasma membrane of the cell.
[0244] Generally, the term lipid refers to a fat-soluble (lipophilic), naturally-occurring molecules. The term is also used more specifically to refer to fatty-acids and their derivatives (including tri-, di-, and monoglycerides and phospholipids), as well as other fat-soluble sterol-containing metabolites or sterols. Phospholipids are a major component of all biological membranes, along with glycolipids, sterols and proteins. Examples of phospholipids include phosphatidylethanolamine, phosphatidylcholine, phosphatidylinositol, phosphatidylserine, phosphatidylglycerol and the like. Examples of sterols include zoosterols (for example, cholesterol) and phytosterols (for example, sitosterol) and steryl-glucoside. Over 200 phytosterols have been identified in various plant species, the most common being campesterol, stigmasterol, ergosterol, brassicasterol, delta-7-stigmasterol, delta-7-avenasterol, daunosterol, sitosterol, 24-methylcholesterol, cholesterol or beta-sitosterol. As one of skill in the art would understand, the lipid composition of the plasma membrane of a cell may vary with the culture or growth conditions of the cell or organism from which the cell is obtained.
[0245] Cell membranes generally comprise lipid bilayers, as well as proteins for various functions. Localized concentrations of particular lipids may be found in the lipid bilayer, referred to as lipid rafts. Without wishing to be bound by theory, lipid rafts may have significant roles in endo and exocytosis, entry or egress of viruses or other infectious agents, inter-cell signal transduction, interaction with other structural components of the cell or organism, such as intracellular and extracellular matrices.
[0246] With reference to influenza virus, the term hemagglutinin or HA as used herein refers to a glycoprotein found on the outside of influenza viral particles. HA is a homotrimeric membrane type I glycoprotein, generally comprising a signal peptide, an HA1 domain, and an HA2 domain comprising a membrane-spanning anchor site at the C-terminus and a small cytoplasmic tail (
[0247] The term homotrimer or homotrimeric indicates that an oligomer is formed by three HA protein molecules. Without wishing to be bound by theory, HA protein is synthesized as monomeric precursor protein (HA0) of about 75 kDa, which assembles at the surface into an elongated trimeric protein. Before trimerization occurs, the precursor protein is cleaved at a conserved activation cleavage site (also referred to as fusion peptide) into 2 polypeptide chains, HA1 and HA2 (comprising the transmembrane region), linked by a disulfide bond. The HA1 segment may be 328 amino acids in length, and the HA2 segment may be 221 amino acids in length. Although this cleavage may be important for virus infectivity, it may not be essential for the trimerization of the protein. Insertion of HA within the endoplasmic reticulum (ER) membrane of the host cell, signal peptide cleavage and protein glycosylation are co-translational events. Correct refolding of HA requires glycosylation of the protein and formation of 6 intra-chain disulfide bonds. The HA trimer assembles within the cis- and trans-Golgi complex, the transmembrane domain playing a role in the trimerization process. The crystal structures of bromelain-treated HA proteins, which lack the transmembrane domain, have shown a highly conserved structure amongst influenza strains. It has also been established that HA undergoes major conformational changes during the infection process, which requires the precursor HA0 to be cleaved into the 2 polypeptide chains HA1 and HA2. The HA protein may be processed (i.e., comprise HA1 and HA2 domains), or may be unprocessed (i.e. comprise the HA0 domain).
[0248] The present invention pertains to the use of an HA protein comprising the transmembrane domain and includes HA1 and HA2 domains, for example the HA protein may be HA0, or processed HA comprising HA1 and HA2. The HA protein may be used in the production or formation of VLPs using a plant, or plant cell, expression system.
[0249] The HA of the present invention may be obtained from any subtype. For example, the HA may be of subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15, H16 or of influenza type B. The recombinant HA of the present invention may also comprise an amino acid sequence based on the sequence any hemagglutinin known in the artsee, for example, the BioDefence Public Health base (Influenza Virus; see URL: biohealthbase.org) or National Center for Biotechnology Information (see URL: ncbi.nlm.nih.gov). Furthermore, the HA may be based on the sequence of a hemagglutinin that is isolated from one or more emerging or newly-identified influenza viruses.
[0250] The present invention also includes VLPs that comprise HAs obtained from one or more than one influenza subtype. For example, VLPs may comprise one or more than one HA from the subtype H1 (encoded by SEQ ID NO:28), H2 (encoded by SEQ ID NO:12), H3 (encoded by SEQ ID NO:13), H4 (encoded by SEQ ID NO:14), H5 (encoded by SEQ ID NO:15), H6 (encoded by SEQ ID NO:16), H7 (encoded by SEQ ID NO:11), H8 (encoded by SEQ ID NO:17), H9 (encoded by SEQ ID NO:18), H10 (encoded by SEQ ID NO:19), H11 (encoded by SEQ ID NO:20), H12 (encoded by SEQ ID NO:21), H13 (encoded by SEQ ID NO:27), H14 (encoded by SEQ ID NO:23), H15 (encoded by SEQ ID NO:24), H16 (encoded by SEQ ID NO:25), or influenza type B (encoded by SEQ ID NO: 26), or a combination thereof. One or more that one HA from the one or more than one influenza subtypes may be co-expressed within a plant or insect cell to ensure that the synthesis of the one or more than one HA results in the formation of VLPs comprising a combination of HAs obtained from one or more than one influenza subtype. Selection of the combination of HAs may be determined by the intended use of the vaccine prepared from the VLP. For example a vaccine for use in inoculating birds may comprise any combination of HA subtypes, while VLPs useful for inoculating humans may comprise subtypes one or more than one of subtypes H1, H2, H3, H5, H7, H9, H10, N1, N2, N3 and N7. However, other HA subtype combinations may be prepared depending upon the use of the inoculum.
[0251] Therefore, the present invention is directed to a VLP comprising one or more than one HA subtype, for example two, three, four, five, six, or more HA subtypes.
[0252] The present invention also provides for nucleic acids encoding hemagglutinins that form VLPs when expressed in plants.
[0253] Exemplary nucleic acids may comprise nucleotide sequences of hemagglutinin from selected strains of influenza subtypes. For example, an A (H1N1) sub-type such as A/New Caledonia/20/99 (H1N1) (SEQ ID NO: 33), the A/Indonesia/5/05 sub-type (H5N1) (comprising construct #660; SEQ ID NO: 60) and the less common B type (for example SEQ ID NO:26,
[0254] Correct folding of the hemagglutinins may be important for stability of the protein, formation of multimers, formation of VLPs and function of the HA (ability to hemagglutinate), among other characteristics of influenza hemagglutinins. Folding of a protein may be influenced by one or more factors, including, but not limited to, the sequence of the protein, the relative abundance of the protein, the degree of intracellular crowding, the availability of cofactors that may bind or be transiently associated with the folded, partially folded or unfolded protein, the presence of one or more chaperone proteins, or the like.
[0255] Heat shock proteins (Hsp) or stress proteins are examples of chaperone proteins, which may participate in various cellular processes including protein synthesis, intracellular trafficking, prevention of misfolding, prevention of protein aggregation, assembly and disassembly of protein complexes, protein folding, and protein disaggregation. Examples of such chaperone proteins include, but are not limited to, Hsp60, Hsp65, Hsp 70, Hsp90, Hsp100, Hsp20-30, Hsp10, Hsp100-200, Hsp100, Hsp90, Lon, TF55, FKBPs, cyclophilins, CIpP, GrpE, ubiquitin, calnexin, and protein disulfide isomerases. See, for example, Macario, A. J. L., Cold Spring Harbor Laboratory Res. 25:59-70. 1995; Parsell, D. A. & Lindquist, S. Ann. Rev. Genet. 27:437-496 (1993); U.S. Pat. No. 5,232,833. In some examples, a particular group of chaperone proteins includes Hsp40 and Hsp70.
[0256] Examples of Hsp70 include Hsp72 and Hsc73 from mammalian cells, DnaK from bacteria, particularly mycobacteria such as Mycobacterium leprae, Mycobacterium tuberculosis, and Mycobacterium bovis (such as Bacille-Calmette Guerin: referred to herein as Hsp71). DnaK from Escherichia coli, yeast. and other prokaryotes, and BiP and Grp78 from eukaryotes, such as A. thaliana (Lin et al. 2001 (Cell Stress and Chaperones 6:201-208). A particular example of an Hsp70 is A. thaliana Hsp70 (encoded by SEQ ID NO: 122, or SEQ ID NO: 123). Hsp70 is capable of specifically binding ATP as well as unfolded polypeptides and peptides, thereby participating in protein folding and unfolding as well as in the assembly and disassembly of protein complexes.
[0257] Examples of Hsp40 include DnaJ from prokaryotes such as E. coli and mycobacteria and HSJ1, HDJI and Hsp40 from eukaryotes, such as alfalfa (Frugis et al., 1999. Plant Molecular Biology 40:397-408). A particular example of an Hsp40 is M. sativa MsJ1 (encoded by SEQ ID NO: 121, 123 or 114). Hsp40 plays a role as a molecular chaperone in protein folding, thermotolerance and DNA replication, among other cellular activities.
[0258] Among Hsps, Hsp70 and its co-chaperone, Hsp40, are involved in the stabilization of translating and newly synthesized polypeptides before the synthesis is complete. Without wishing to be bound by theory, Hsp40 binds to the hydrophobic patches of unfolded (nascent or newly transferred) polypeptides, thus facilitating the interaction of Hsp70-ATP complex with the polypeptide. ATP hydrolysis leads to the formation of a stable complex between the polypeptide, Hsp70 and ADP, and release of Hsp40. The association of Hsp70-ADP complex with the hydrophobic patches of the polypeptide prevents their interaction with other hydrophobic patches, preventing the incorrect folding and the formation of aggregates with other proteins (reviewed in Hartl, F U. 1996. Nature 381:571-579).
[0259] Again, without wishing to be bound by theory, as protein production increases in a recombinant protein expression system, the effects of crowding on recombinant protein expression may result in aggregation and/or reduced accumulation of the recombinant protein resulting from degradation of misfolded polypeptide. Native chaperone proteins may be able to facilitate correct folding of low levels of recombinant protein, but as the expression levels increase, native chaperones may become a limiting factor. High levels of expression of hemagglutinin in the agroinfiltrated leaves may lead to the accumulation of hemagglutinin polypeptides in the cytosol, and co-expression of one or more than one chaperone proteins such as Hsp70, Hsp40 or both Hsp70 and Hsp40 may increase stability in the cytosol of the cells expressing the polypeptides cells, thus reducing the level of misfolded or aggregated hemagglutinin polypeptides, and increasing the number of polypeptides accumulate as stable hemagglutinin, exhibiting tertiary and quaternary structural characteristics that allow for hemagglutination and/or formation of virus-like particles.
[0260] Therefore, the present invention also provides for a method of producing influenza VLPs in a plant, wherein a first nucleic acid encoding an influenza HA is co-expressed with a second nucleic acid encoding a chaperone. The first and second nucleic acids may be introduced to the plant in the same step, or may be introduced to the plant sequentially. The present invention also provides for a method of producing influenza VLPs in a plant, where the plant comprises the first nucleic acid, and the second nucleic acid is subsequently introduced.
[0261] The present invention also provides for a plant comprising a nucleic acid encoding one, or more than one influenza hemagglutinin and a nucleic acid encoding one or more than one chaperones.
[0262] Processing of an N-terminal signal peptide (SP) sequence during expression and/or secretion of influenza hemagglutinins has been proposed to have a role in the folding process. The term signal peptide refers generally to a short (about 5-30 amino acids) sequence of amino acids, found generally at the N-terminus of a hemagglutinin polypeptide that may direct translocation of the newly-translated polypeptide to a particular organelle, or aid in positioning of specific domains of the polypeptide. The signal peptide of hemagglutinins target the translocation of the protein into the endoplasmic reticulum and have been proposed to aid in positioning of the N-terminus proximal domain relative to a membrane-anchor domain of the nascent hemagglutinin polypeptide to aid in cleavage and folding of the mature hemagglutinin. Removal of a signal peptide (for example, by a signal peptidase), may require precise cleavage and removal of the signal peptide to provide the mature hemagglutininthis precise cleavage may be dependent on any of several factors, including a portion or all of the signal peptide, amino acid sequence flanking the cleavage site, the length of the signal peptide, or a combination of these, and not all factors may apply to any given sequence.
[0263] A signal peptide may be native to the hemagglutinin being expressed, or a recombinant hemagglutinin comprising a signal peptide from a first influenza type, subtype or strain with the balance of the hemagglutinin from a second influenza type, subtype or strain. For example the native SP of HA subtypes H1, H2, H3, H5, H6, H7, H9 or influenza type B may be used to express the HA in a plant system.
[0264] A signal peptide may also be non-native, for example, from a structural protein or hemagglutinin of a virus other than influenza, or from a plant, animal or bacterial polypeptide. An exemplary signal peptide is that of alfalfa protein disulfide isomerase (PDISP) (nucleotides 32-103 of Accession No. Z11499; SEQ ID NO: 34;
[0265] The present invention also provides for an influenza hemagglutinin comprising a native, or a non-native signal peptide, and nucleic acids encoding such hemagglutinins.
[0266] Influenza HA proteins exhibit a range of similarities and differences with respect to molecular weight, isoelectric point, size, glycan complement and the like. The physico-chemical properties of the various hemagglutinins may be useful to allow for differentiation between the HAs expressed in a plant, insect cell or yeast system, and may be of particular use when more than one HA is co-expressed in a single system. Examples of such physico-chemical properties are provided in Table 1.
TABLE-US-00001 TABLE 1 Physico-chemical properties of influenza hemagglutinins Clone AA Glycans Molecular Weight (kDA) Isoelectric point No Type Influenza strains HA0 HA1 HA2 HA0 HA1 HA2 HA0 HA0.sup.1 HA1 HA1.sup.1 HA2 HA2.sup.1 HA0 HA1 HA2 774 H1 A/Brisbane/59/2007 548 326 222 9 7 2 61 75 36 47 25 28 6.4 7.5 5.3 775 H1 A/Solomon 548 326 222 9 7 2 61 75 36 47 25 28 6.1 6.7 5.3 Islands/3/2006 776 H3 A/Brisbane/10/2007 550 329 221 12 11 1 62 80 37 54 25 27 8.5 9.6 5.2 777 H3 A/Wisconsin/67/2005 550 329 221 11 10 1 62 79 37 52 25 27 8.8 9.6 5.3 778 B B/Malaysia/2506/2004 570 347 223 12 8 4 62 80 38 50 24 30 8.0 9.7 4.5 779 B B/Florida/4/2006 569 346 223 10 7 3 62 77 38 48 24 29 8.0 9.7 4.5 780 H2 A/Singapore/1/57 547 325 222 6 4 2 62 71 36 42 25 28 6.0 7.5 4.9 781 H5 A/Anhui/1/2005 551 329 222 7 5 2 62 73 37 45 25 28 6.2 8.9 4.7 782 H5 A/Vietnam/1194/2004 552 330 222 7 5 2 63 74 38 45 25 28 6.4 9.1 4.8 783 H6 A/Teal/Hong 550 328 222 8 5 3 62 75 37 45 25 30 5.7 5.9 5.6 Kong/W312/97 784 H7 A/Equine/Prague/56 552 331 221 6 4 2 62 71 37 43 25 28 8.9 9.7 4.9 785 H9 A/Hong Kong/1073/99 542 320 199 9 7 2 61 75 36 46 23 26 8.4 9.5 5.3
[0267] The present invention also includes nucleotide sequences SEQ ID NO:28; SEQ ID NO:3; SEQ ID NO:11, encoding HA from H1, H5 or H7, respectively. The present invention also includes a nucleotide sequence that hybridizes under stringent hybridisation conditions to SEQ ID NO:28; SEQ ID NO:3; SEQ ID NO:11. The present invention also includes a nucleotide sequence that hybridizes under stringent hybridisation conditions to a compliment of SEQ ID NO:28; SEQ ID NO:3; SEQ ID NO:1. These nucleotide sequences that hybridize to SEQ ID or a complement of SEQ ID encode a hemagglutinin protein that, when expressed forms a VLP, and the VLP induces production of an antibody when administered to a subject. For example, expression of the nucleotide sequence within a plant cell forms a VLP, and the VLP may be used to produce an antibody that is capable of binding HA, including mature HA, HA0, HA1, or HA2 of one or more influenza types or subtypes. The VLP, when administered to a subject, induces an immune response.
[0268] The present invention also includes nucleotide sequences SEQ ID NO:12 SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47. The present invention also includes a nucleotide sequence that hybridizes under stringent hybridisation conditions to SEQ ID NO:12 SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47. The present invention also includes a nucleotide sequence that hybridizes under stringent hybridisation conditions to a compliment of SEQ ID NO:12 SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47. These nucleotide sequences that hybridize to SEQ ID NO:12 SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47 or a complement of SEQ ID NO:12 SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47 encode a hemagglutinin protein that, when expressed forms a VLP, and the VLP induces production of an antibody when administered to a subject. For example, expression of the nucleotide sequence within a plant cell forms a VLP, and the VLP may be used to produce an antibody that is capable of binding HA, including mature HA, HA0, HA1, or HA2 of one or more influenza types or subtypes. The VLP, when administered to a subject, induces an immune response.
[0269] In some embodiments, the present invention also includes nucleotide sequences SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47, encoding HA from H1, H2, H3, H5, H7 or H9 subtypes of influenza A, or HA from type B influenza. The present invention also includes a nucleotide sequence that hybridizes under stringent hybridisation conditions to SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47. The present invention also includes a nucleotide sequence that hybridizes under stringent hybridisation conditions to a compliment of SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47. These nucleotide sequences that hybridize to SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47 or a complement of SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47 encode a hemagglutinin protein that, when expressed forms a VLP, and the VLP induces production of an antibody when administered to a subject. For example, expression of the nucleotide sequence within a plant cell forms a VLP, and the VLP may be used to produce an antibody that is capable of binding HA, including mature HA, HA0, HA1, or HA2 of one or more influenza types or subtypes. The VLP, when administered to a subject, induces an immune response.
[0270] Hybridization under stringent hybridization conditions is known in the art (see for example Current Protocols in Molecular Biology, Ausubel et al., eds. 1995 and supplements; Maniatis et al., in Molecular Cloning (A Laboratory Manual), Cold Spring Harbor Laboratory, 1982; Sambrook and Russell, in Molecular Cloning: A Laboratory Manual, 3.sup.rd edition 2001; each of which is incorporated herein by reference). An example of one such stringent hybridization conditions may be about 16-20 hours hybridization in 4SSC at 65 C., followed by washing in 0.1SSC at 65 C. for an hour, or 2 washes in 0.1SSC at 65 C. each for 20 or 30 minutes. Alternatively, an exemplary stringent hybridization condition could be overnight (16-20 hours) in 50% formamide, 4SSC at 42 C., followed by washing in 0.1SSC at 65 C. for an hour, or 2 washes in 0.1SSC at 65 C. each for 20 or 30 minutes, or overnight (16-20 hours), or hybridization in Church aqueous phosphate buffer (7% SDS; 0.5M NaPO.sub.4 buffer pH 7.2; 10 mM EDTA) at 65 C., with 2 washes either at 50 C. in 0.1SSC, 0.1% SDS for 20 or 30 minutes each, or 2 washes at 65 C. in 2SSC, 0.1% SDS for 20 or 30 minutes each.
[0271] Additionally, the present invention includes nucleotide sequences that are characterized as having about 70, 75, 80, 85, 87, 90, 91, 92, 93 94, 95, 96, 97, 98, 99, 100% or any amount therebetween, sequence identity, or sequence similarity, with the nucleotide sequence encoding HA from H1 (SEQ ID NO:28), H5 (SEQ ID NO:3) or H7 (SEQ ID NO:11), wherein the nucleotide sequence encodes a hemagglutinin protein that when expressed forms a VLP, and that the VLP induces the production of an antibody. For example, expression of the nucleotide sequence within a plant cell forms a VLP, and the VLP may be used to produce an antibody that is capable of binding HA, including mature HA, HA0, HA1, or HA2. The VLP, when administered to a subject, induces an immune response.
[0272] Additionally, the present invention includes nucleotide sequences that are characterized as having about 70, 75, 80, 85, 87, 90, 91, 92, 93 94, 95, 96, 97, 98, 99, 100% or any amount therebetween, sequence identity, or sequence similarity, with the nucleotide sequence of SEQ ID NO:12 SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO:27, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47, wherein the nucleotide sequence encodes a hemagglutinin protein that when expressed forms a VLP, and that the VLP induces the production of an antibody. For example, expression of the nucleotide sequence within a plant cell forms a VLP, and the VLP may be used to produce an antibody that is capable of binding HA, including mature HA, HA0, HA1, or HA2. The VLP, when administered to a subject, induces an immune response.
[0273] Additionally, the present invention includes nucleotide sequences that are characterized as having about 70, 75, 80, 85, 87, 90, 91, 92, 93 94, 95, 96, 97, 98, 99, 100% or any amount therebetween, sequence identity, or sequence similarity, with the nucleotide sequence of SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46 or SEQ ID NO:47, wherein the nucleotide sequence encodes a hemagglutinin protein that when expressed forms a VLP, and that the VLP induces the production of an antibody. For example, expression of the nucleotide sequence within a plant cell forms a VLP, and the VLP may be used to produce an antibody that is capable of binding HA, including mature HA, HA0, HA1, or HA2. The VLP, when administered to a subject, induces an immune response.
[0274] Similarly, the present invention includes HAs associated with the following subtypes H1 (encoded by SEQ ID NO:28), H2 (encoded by SEQ ID NO:12), H3 (encoded by SEQ ID NO:13), H4 (encoded by SEQ ID NO:14), H5 (encoded by SEQ ID NO:15), H6 (encoded by SEQ ID NO:16), H7 (encoded by SEQ ID NO:11), H8 (encoded by SEQ ID NO:17), H9 (encoded by SEQ ID NO:18), H10 (encoded by SEQ ID NO:19), H11 (encoded by SEQ ID NO:20), H12 (encoded by SEQ ID NO:21), H13 (encoded by SEQ ID NO:27), H14 (encoded by SEQ ID NO:23), H15 (encoded by SEQ ID NO:24), H16 (encoded by SEQ ID NO:25), or influenza type B (encoded by SEQ ID NO: 26); see
[0275] An immune response generally refers to a response of the adaptive immune system. The adaptive immune system generally comprises a humoral response, and a cell-mediated response. The humoral response is the aspect of immunity that is mediated by secreted antibodies, produced in the cells of the B lymphocyte lineage (B cell). Secreted antibodies bind to antigens on the surfaces of invading microbes (such as viruses or bacteria), which flags them for destruction. Humoral immunity is used generally to refer to antibody production and the processes that accompany it, as well as the effector functions of antibodies, including Th2 cell activation and cytokine production, memory cell generation, opsonin promotion of phagocytosis, pathogen elimination and the like. The terms modulate or modulation or the like refer to an increase or decrease in a particular response or parameter, as determined by any of several assays generally known or used, some of which are exemplified herein.
[0276] A cell-mediated response is an immune response that does not involve antibodies but rather involves the activation of macrophages, natural killer cells (NK), antigen-specific cytotoxic T-lymphocytes, and the release of various cytokines in response to an antigen. Cell-mediated immunity is used generally to refer to some Th cell activation, Tc cell activation and T-cell mediated responses. Cell mediated immunity is of particular importance in responding to viral infections.
[0277] For example, the induction of antigen specific CD8 positive T lymphocytes may be measured using an ELISPOT assay; stimulation of CD4 positive T-lymphocytes may be measured using a proliferation assay. Anti-influenza antibody titres may be quantified using an ELISA assay; isotypes of antigen-specific or cross reactive antibodies may also be measured using anti-isotype antibodies (e.g. anti-IgG, IgA, IgE or IgM). Methods and techniques for performing such assays are well-known in the art.
[0278] A hemagglutination inhibition (HI, or HAI) assay may also be used to demonstrate the efficacy of antibodies induced by a vaccine, or vaccine composition can inhibit the agglutination of red blood cells (RBC) by recombinant HA. Hemagglutination inhibitory antibody titers of serum samples may be evaluated by microtiter HAI (Aymard et al 1973). Erythrocytes from any of several species may be usede.g. horse, turkey, chicken or the like. This assay gives indirect information on assembly of the HA trimer on the surface of VLP, confirming the proper presentation of antigenic sites on HAs.
[0279] Cross-reactivity HAI titres may also be used to demonstrate the efficacy of an immune response to other strains of virus related to the vaccine subtype. For example, serum from a subject immunized with a vaccine composition of a first strain (e.g. VLPs of A/Indonesia 5/05) may be used in an HAI assay with a second strain of whole virus or virus particles (e.g. A/Vietnam/1194/2004), and the HAI titer determined.
[0280] Cytokine presence or levels may also be quantified. For example a T-helper cell response (Th1/Th2) will be characterized by the measurement of IFN- and IL-4 secreting cells using by ELISA (e.g. BD Biosciences OptEIA kits). Peripheral blood mononuclear cells (PBMC) or splenocytes obtained from a subject may be cultured, and the supernatant analyzed. T lymphocytes may also be quantified by fluorescence-activated cell sorting (FACS), using marker specific fluorescent labels and methods as are known in the art.
[0281] A microneutralization assay may also be conducted to characterize an immune response in a subject, see for example the methods of Rowe et al., 1973. Virus neutralization titers may be obtained several ways, including: 1) enumeration of lysis plaques (plaque assay) following crystal violet fixation/coloration of cells; 2) microscopic observation of cell lysis in culture; 3) ELISA and spectrophotometric detection of NP virus protein (correlate with virus infection of host cells)
[0282] Sequence identity or sequence similarity may be determined using a nucleotide sequence comparison program, such as that provided within DNASIS (for example, using, but not limited to, the following parameters: GAP penalty 5, # of top diagonals 5, fixed GAP penalty 10, k-tuple 2, floating gap 10, and window size 5). However, other methods of alignment of sequences for comparison are well-known in the art for example the algorithms of Smith & Waterman (1981, Adv. Appl. Math. 2:482), Needleman & Wunsch (J. Mol. Biol. 48:443, 1970), Pearson & Lipman (1988, Proc. Nat'l. Acad. Sci. USA 85:2444), and by computerized implementations of these algorithms (e.g. GAP, BESTFIT, FASTA, and BLAST), or by manual alignment and visual inspection.
[0283] The term hemagglutinin domain refers to a peptide comprising either the HA0 domain, or the HA1 and HA2 domains (alternately referred to as HA1 and HA2 fragments). HA0 is a precursor of the HA1 and HA2 fragments. The HA monomer may be generally subdivided in 2 functional domainsthe stem domain and the globular head, or head domain. The stem domain is involved in infectivity and pathogenicity of the virus via the conformational change it may undergo when exposed to acidic pH. The stem domain may be further subdivided into 4 subdomains or fragmentsthe fusion sub-domain or peptide (a hydrophobic stretch of amino acids involved in fusion with the host membrane in the acidic pH conformational state); the stem sub-domain (may accommodate the two or more conformations), the transmembrane domain or sub-domain (TmD) (involved in the affinity of the HA for lipid rafts), and the cytoplasmic tail (cytoplasmic tail sub-domain) (Ctail) (involved in secretion of HA). The globular head is divided in 2 subdomains, the RB subdomain and the vestigial esterase domain (E). The E subdomain may be partially or fully buried and not exposed at the surface of the globular head, thus some antibodies raised against HA bind to the RB subdomain.
[0284] The term virus like particle (VLP), or virus-like particles or VLPs refers to structures that self-assemble and comprise structural proteins such as influenza HA protein. VLPs are generally morphologically and antigenically similar to virions produced in an infection, but lack genetic information sufficient to replicate and thus are non-infectious. In some examples, VLPs may comprise a single protein species, or more than one protein species. For VLPs comprising more than one protein species, the protein species may be from the same species of virus, or may comprise a protein from a different species, genus, subfamily or family of virus (as designated by the ICTV nomenclature). In other examples, one or more of the protein species comprising a VLP may be modified from the naturally occurring sequence. VLPs may be produced in suitable host cells including plant and insect host cells. Following extraction from the host cell and upon isolation and further purification under suitable conditions, VLPs may be purified as intact structures.
[0285] The VLPs produced from influenza derived proteins, in accordance with the present invention do not comprise M1 protein. The M1 protein is known to bind RNA (Wakefield and Brownlee, 1989) which is a contaminant of the VLP preparation. The presence of RNA is undesired when obtaining regulatory approval for the VLP product, therefore a VLP preparation lacking RNA may be advantageous.
[0286] The VLPs of the present invention may be produced in a host cell that is characterized by lacking the ability to sialylate proteins, for example a plant cell, an insect cell, fungi, and other organisms including sponge, coelenterara, annelida, arthoropoda, mollusca, nemathelminthea, trochelmintes, plathelminthes, chaetognatha, tentaculate, chlamydia, spirochetes, gram-positive bacteria, cyanobacteria, archaebacteria, or the like. See, for example Glycoforum (URL: glycoforum.gr.jp/science/word/evolution/ES-A03E.html) or Gupta et al., 1999. Nucleic Acids Research 27:370-372; or Toukach et al., 2007. Nucleic Acids Research 35:D280-D286; or URL:glycostructures.jp (Nakahara et al., 2008. Nucleic Acids Research 36:D368-D371; published online Oct. 11, 2007 doi:10.1093/NAR/gkm833). The VLPs produced as described herein do not typically comprise neuramindase (NA). However, NA may be co-expressed with HA should VLPs comprising HA and NA be desired.
[0287] A VLP produced in a plant according to some aspects of the invention may be complexed with plant-derived lipids. The VLP may comprise an HA0, HA1 or HA2 peptide. The plant-derived lipids may be in the form of a lipid bilayer, and may further comprise an envelope surrounding the VLP. The plant derived lipids may comprise lipid components of the plasma membrane of the plant where the VLP is produced, including, but not limited to, phosphatidylcholine (PC), phosphatidylethanolamine (PE), glycosphingolipids, phytosterols or a combination thereof. A plant-derived lipid may alternately be referred to as a plant lipid. Examples of phytosterols are known in the art, and include, for example, stigmasterol, sitosterol, 24-methylcholesterol and cholesterolsee, for example, Mongrand et al., 2004.
[0288] VLPs may be assessed for structure and size by, for example, hemagglutination assay, electron microscopy, or by size exclusion chromatography.
[0289] For size exclusion chromatography, total soluble proteins may be extracted from plant tissue by homogenizing (Polytron) sample of frozen-crushed plant material in extraction buffer, and insoluble material removed by centrifugation. Precipitation with PEG may also be of benefit. The soluble protein is quantified, and the extract passed through a Sephacryl column. Blue Dextran 2000 may be used as a calibration standard. Following chromatography, fractions may be further analyzed by immunoblot to determine the protein complement of the fraction.
[0290] Without wishing to be bound by theory, the capacity of HA to bind to RBC from different animals is driven by the affinity of HA for sialic acids 2,3 or 2,3 and the presence of these sialic acids on the surface of RBC. Equine and avian HA from influenza viruses agglutinate erythrocytes from all several species, including turkeys, chickens, ducks, guinea pigs, humans, sheep, horses and cows; whereas human HAs will bind to erythrocytes of turkey, chickens, ducks, guinea pigs, humans and sheep (see also Ito T. et al, 1997, Virology, vol 227, p493-499; and Medeiros R et al, 2001, Virology, vol 289 p. 74-85). Examples of the species reactivity of HAs of different influenza strains is shown in Tables 2A and 2B.
TABLE-US-00002 TABLE 2A Species of RBC bound by HAs of selected seasonal influenza strains. Seasonal Strain No Origin Horse Turkey H1 A/Brisbane/59/2007 (H1N1) 774 Human + ++ A/Solomon Islands/3/2006 (H1N1) 775 Human + ++ H3 A/Brisbane/10/2007 (H3N2) 776 Human + ++ A/Wisconsin/67/2005 (H3N2) 777 Human + ++ B B/Malaysia/2506/2004 778 Human + ++ B/Florida/4/2006 779 Human + ++
TABLE-US-00003 TABLE 2B Species of RBC bound by HAs of selected pandemic influenza strains Pandemic Strain No Origin Horse Turkey H2 A/Singapore/1/57 (H2N2) 780 Human + ++ H5 A/Anhui/1/2005 (H5N1) 781 Hu-Av ++ + A/Vietnam/1194/2004 (H5N1) 782 Hu-Av ++ + H6 A/Teal/Hong Kong/W312/97 783 Avian ++ + (H6N1) H7 A/Equine/Prague/56 (H7N7) 784 Equine ++ ++ H9 A/Hong Kong/1073/99 (H9N2) 785 Human ++ +
[0291] A fragment or portion of a protein, fusion protein or polypeptide includes a peptide or polypeptide comprising a subset of the amino acid complement of a particular protein or polypeptide, provided that the fragment can form a VLP when expressed. The fragment may, for example, comprise an antigenic region, a stress-response-inducing region, or a region comprising a functional domain of the protein or polypeptide. The fragment may also comprise a region or domain common to proteins of the same general family, or the fragment may include sufficient amino acid sequence to specifically identify the full-length protein from which it is derived.
[0292] For example, a fragment or portion may comprise from about 60% to about 100%, of the length of the full length of the protein, or any amount therebetween, provided that the fragment can form a VLP when expressed. For example, from about 60% to about 100%, from about 70% to about 100%, from about 80% to about 100%, from about 90% to about 100%, from about 95% to about 100%, of the length of the full length of the protein, or any amount therebetween. Alternately, a fragment or portion may be from about 150 to about 500 amino acids, or any amount therebetween, depending upon the HA, and provided that the fragment can form a VLP when expressed. For example, a fragment may be from 150 to about 500 amino acids, or any amount therebetween, from about 200 to about 500 amino acids, or any amount therebetween, from about 250 to about 500 amino acids, or any amount therebetween, from about 300 to about 500 or any amount therebetween, from about 350 to about 500 amino acids, or any amount therebetween, from about 400 to about 500 or any amount therebetween, from about 450 to about 500 or any amount therebetween, depending upon the HA, and provided that the fragment can form a VLP when expressed. For example, about 5, 10, 20, 30, 40 or 50 amino acids, or any amount therebetween may be removed from the C terminus, the N terminus or both the N and C terminus of an HA protein, provided that the fragment can form a VLP when expressed.
[0293] Numbering of amino acids in any given sequence are relative to the particular sequence, however one of skill can readily determine the equivalency of a particular amino acid in a sequence based on structure and/or sequence. For example, if 6 N terminal amino acids were removed when constructing a clone for crystallography, this would change the specific numerical identity of the amino acid (e.g. relative to the full length of the protein), but would not alter the relative position of the amino acid in the structure.
[0294] Comparisons of a sequence or sequences may be done using a BLAST algorithm (Altschul et al., 1990. J. Mol Biol 215:403-410). A BLAST search allows for comparison of a query sequence with a specific sequence or group of sequences, or with a larger library or database (e.g. GenBank or GenPept) of sequences, and identify not only sequences that exhibit 100% identity, but also those with lesser degrees of identity. Nucleic acid or amino acid sequences may be compared using a BLAST algorithm. Furthermore the identity between two or more sequences may be determined by aligning the sequences together and determining the % identity between the sequences. Alignment may be carried out using the BLAST Algorithm (for example as available through GenBank; URL: ncbi.nlm.nih.gov/cgi-bin/BLAST/ using default parameters: Program: blastn; Database: nr; Expect 10; filter: default; Alignment: pairwise; Query genetic Codes: Standard(1)), or BLAST2 through EMBL URL: embl-heidelberg.de/Services/index.html using default parameters: Matrix BLOSUM62; Filter: default, echofilter: on, Expect:10, cutoff: default; Strand: both; Descriptions: 50, Alignments: 50; or FASTA, using default parameters), or by manually comparing the sequences and calculating the % identity.
[0295] The present invention describes, but is not limited to, the cloning of a nucleic acid encoding HA into a plant expression vector, and the production of influenza VLPs from the plant, suitable for vaccine production. Examples of such nucleic acids include, for example, but are not limited to, an influenza A/New Caledonia/20/99 (H1N1) virus HA (e.g. SEQ ID NO: 61), an HA from A/Indonesia/5/05 sub-type (H5N1) (e.g. SEQ ID NO: 60), A/Brisbane/59/2007 (H1N1) (e.g. SEQ ID NO: 36, 48, 62), A/Solomon Islands/3/2006 (H1N1) (e.g. SEQ ID NO: 37, 49, 63), A/Singapore/1/57 (H2N2) (e.g. SEQ ID NO: 42, 54, 64), A/Anhui/1/2005 (H5N1) (e.g. SEQ ID NO: 43, 55, 65), A/Vietnam/1194/2004 (H5N1) (e.g. SEQ ID NO: 44, 56, 66), A/Teal/Hong Kong/W312/97 (H6N1) (e.g. SEQ ID NO: 45, 57, 67), A/Hong Kong/1073/99 (H9N2) (e.g. SEQ ID NO: 47, 59, 68), A/Brisbane/10/2007 (H3N2) (e.g. SEQ ID NO: 38, 50, 69), A/Wisconsin/67/2005 (H3N2) (e.g. SEQ ID NO: 39, 51, 70), A/Equine/Prague/56 (H7N7) (e.g. SEQ ID NO: 46, 58, 71), B/Malaysia/2506/2004 (e.g. SEQ ID NO: 40, 52, 72), B/Florida/4/2006 (e.g. SEQ ID NO: 41, 53, 73). The corresponding clone or construct numbers for these strains is provided in Table 1. Nucleic acid sequences corresponding to SEQ ID NOs: 36-47 comprise a plastocyanin upstream and operatively linked to the coding sequence of the HA for each of the types or subtypes, as illustrated in
[0296] The VLPs may also be used to produce reagents comprised of recombinant influenza structural proteins that self-assemble into functional and immunogenic homotypic macromolecular protein structures, including subviral influenza particles and influenza VLP, in transformed hosts cells, for example plant cells or insect cells.
[0297] Therefore, the invention provides for VLPs, and a method for producing viral VLPs in a plant expression system, from the expression of a single envelope protein. The VLPs may be influenza VLPs, or VLPs produced from other plasma membrane-derived virus including, but not limited to, Measles, Ebola, Marburg, and HIV.
[0298] Proteins from other enveloped viruses, for example but not limited to Filoviridae (e.g. Ebola virus, Marburg virus, or the like), Paramyxoviridae (e.g. Measles virus, Mumps virus, Respiratory syncytial virus, pneumoviruses, or the like), Retroviridae (e.g. Human Immunodeficiency Virus-1, Human Immunodeficiency Virus-2, Human T-Cell Leukemia Virus-1, or the like), Flaviviridae (e.g. West Nile Encephalitis, Dengue virus, Hepatitis C virus, yellow fever virus, or the like), Bunyaviridae (e.g. Hantavirus or the like), Coronaviridae (e.g. coronavirus, SARS, or the like), as would be known to those of skill in the art, may also be used. Non limiting examples of antigens that may be expressed in plasma membrane derived viruses include, the capsid protein of HIV-p24; HIV glycoproteins gp120 or gp41, Filovirus proteins including VP30 or VP35 of Ebolavirus or Gp/SGP of Marburg virus or the H protein or F protein of the Measles paramyxovirus. For example, P24 of HIV (e.g. GenBank reference gi:19172948) is the protein obtained by translation and cleavage of the gag sequence of the HIV virus genome (e.g. GenBank reference gi:9629357); gp 120 and gp41 of HIV are glycoproteins obtained by translation and cleavage of the gp160 protein (e.g. GenBank reference gi:9629363), encoded by env of the HIV virus genome. VP30 of Ebolavirus (GenPept Reference gi: 55770813) is the protein obtained by translation of the vp30 sequence of the Ebolavirus genome (e.g. GenBank Reference gi:55770807); VP35 of Ebolavirus (GenPept Reference gi:55770809) is the protein obtained by translation of the vp35 sequence of the Ebolavirus genome. Gp/SGP of Marburg virus (GenPept Reference gi:296965) is the protein obtained by translation of the (sequence) of the Marburg virus genome (GenBank Reference gi:158539108). H protein (GenPept Reference gi: 9626951) is the protein of the H sequence of the Measles virus genome (GenBank Reference gi: 9626945); F protein (GenPept reference gi: 9626950) is the protein of the F sequence of the Measles virus genome.
[0299] However, other envelope proteins may be used within the methods of the present invention as would be know to one of skill in the art.
[0300] The invention, therefore, provides for a nucleic acid molecule comprising a sequence encoding HIV-p24, HIV-gp120, HIV-gp41, Ebolavirus-VP30, Ebolavirus-VP35, Marburg virus Gp/SGP, Measles virus-H protein or -F protein. The nucleic acid molecule may be operatively linked to a regulatory region active in an insect, yeast or plant cell, or in a particular plant tissue.
[0301] The present invention further provides the cloning of a nucleic acid encoding an HA, for example but not limited to, human influenza A/Indonesia/5/05 virus HA (H5N1) into a plant or insect expression vector (e.g. baculovirus expression vector) and production of influenza vaccine candidates or reagents comprised of recombinant influenza structural proteins that self-assemble into functional and immunogenic homotypic macromolecular protein structures, including subviral influenza particles and influenza VLP, in transformed plant cells or transformed insect cells.
[0302] The nucleic acid encoding the HA of influenza subtypes, for example but not limited to, A/New Caledonia/20/99 (H1N1), A/Indonesia/5/05 sub-type (H5N1), A/Brisbane/59/2007 (H1N1), A/Solomon Islands/3/2006 (H1N1), A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/Hong Kong/W312/97 (H6N1), A/Hong Kong/1073/99 (H9N2), A/Brisbane/10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), A/Equine/Prague/56 (H7N7), B/Malaysia/2506/2004, B/Florida/4/2006 may be expressed, for example, using a Baculovirus Expression System in an appropriate cell line, for example, Spodoptera frugiperda cells (e.g. Sf-9 cell line; ATCC PTA-4047). Other insect cell lines may also be used.
[0303] The nucleic acid encoding the HA may, alternately, be expressed in a plant cell, or in a plant. The nucleic acid encoding HA may be synthesized by reverse transcription and polymerase chain reaction (PCR) using HA RNA. As an example, the RNA may be isolated from human influenza A/New Caledonia/20/99 (H1N1) virus or human influenza A/Indonesia/5/05 (H5N1) virus, or other influenza viruses e.g. A/Brisbane/59/2007 (H1N1), A/Solomon Islands/3/2006 (H1N1), A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/Hong Kong/W312/97 (H6N1), A/Hong Kong/1073/99 (H9N2), A/Brisbane/10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), A/Equine/Prague/56 (H7N7), B/Malaysia/2506/2004, B/Florida/4/2006, or from cells infected with an influenza virus. For reverse transcription and PCR, oligonucleotide primers specific for HA RNA, for example but not limited to, human influenza A/New Caledonia/20/99 (H1N1) virus HA sequences or human influenza A/Indonesia/5/05 (H5N1) virus HA0 sequences, or HA sequences from influenza subtypes A/Brisbane/59/2007 (H1N1), A/Solomon Islands/3/2006 (H1N1), A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/Hong Kong/W312/97 (H6N1), A/Hong Kong/1073/99 (H9N2), A/Brisbane/10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), A/Equine/Prague/56 (H7N7), B/Malaysia/2506/2004, B/Florida/4/2006 may be used. Additionally, a nucleic acid encoding HA may be chemically synthesized using methods as would known to one of skill in the art.
[0304] The resulting cDNA copies of these genes may be cloned in a suitable expression vector as required by the host expression system. Examples of appropriate expression vectors for plants are described below, alternatively, baculovirus expression vector, for example, pFastBacI (InVitrogen), resulting in pFastBacI-based plasmids, using known methods, and information provided by the manufacturer's instructions nay be used.
[0305] The present invention is further directed to a gene construct comprising a nucleic acid encoding HA, as described above, operatively linked to a regulatory element that is operative in a plant. Examples of regulatory elements operative in a plant cell and that may be used in accordance with the present invention include but are not limited to a plastocyanin regulatory region (U.S. Pat. No. 7,125,978; which is incorporated herein by reference), or a regulatory region of Ribulose 1,5-bisphosphate carboxylase/oxygenase (RuBisCO; U.S. Pat. No. 4,962,028; which is incorporated herein by reference), chlorophyll a/b binding protein (CAB; Leutwiler et al; 1986; which is incorporated herein by reference), ST-LS1 (associated with the oxygen-evolving complex of photosystem II and described by Stockhaus et al. 1987, 1989; which is incorporated herein by reference). An example of a plastocyanin regulatory region is a sequence comprising nucleotides 10-85 of SEQ ID NO: 36, or a similar region of any one of SEQ ID NOS: 37-47. A regulatory element or regulatory region may enhance translation of a nucleotide sequence to which is it operatively linkedthe nucleotide sequence may encode a protein or polypeptide. Another example of a regulatory region is that derived from the untranslated regions of the Cowpea Mosaic Virus (CPMV), which may be used to preferentially translate the nucleotide sequence to which it is operatively linked. This CPMV regulatory region comprises a CMPV-HT systemsee, for example, Sainsbury et al, 2008, Plant Physiology 148: 1212-1218.
[0306] If the construct is expressed in an insect cell, examples of regulatory elements operative in an insect cell include but are not limited to the polyhedrin promoter (Possee and Howard 1987. Nucleic Acids Research 15:10233-10248), the gp64 promoter (Kogan et al, 1995. J Virology 69:1452-1461) and the like.
[0307] Therefore, an aspect of the invention provides for a nucleic acid comprising a regulatory region and a sequence encoding an influenza HA. The regulatory region may be a plastocyanin regulatory element, and the influenza HA may be selected from a group of influenza strains or subtypes, comprising A/New Caledonia/20/99 (H1N1), A/Indonesia/5/05 sub-type (H5N1), A/Brisbane/59/2007 (H1N1), A/Solomon Islands/3/2006 (H1N1), A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/Hong Kong/W312/97 (H6N1), A/Hong Kong/1073/99 (H9N2), A/Brisbane/10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), A/Equine/Prague/56 (H7N7), B/Malaysia/2506/2004, B/Florida/4/2006. Nucleic acid sequences comprising a plastocyanin regulatory element and an influenza HA are exemplified herein by SEQ ID NOs: 36-47.
[0308] It is known that there may be sequence differences in the sequence of influenza hemagglutinin amino acids sequences, or the nucleic acids encoding them, when influenza virus is cultured in eggs, or mammalian cells, (e.g. MDCK cells) or when isolated from an infected subject. Non-limiting examples of such differences are illustrated herein, including Example 18. Furthermore, as one of skill in the art would realize, additional variation may be observed within influenza hemagglutinins obtained from new strains as additional mutations continue to occur. Due to the known sequence variability between different influenza hemagglutinins, the present invention includes VLPs that may be made using any influenza hemagglutin provided that when expressed in a host as described herein, the influenza hemagglutin forms a VLP.
[0309] Sequence alignments and consensus sequences may be determined using any of several software packages known in the art, for example MULTALIN (F. CORPET, 1988, Nucl. Acids Res., 16 (22), 10881-10890), or sequences may be aligned manually and similarities and differences between the sequences determined.
[0310] The structure of hemagglutinins is well-studied and the structures are known to be highly conserved. When hemagglutinin structures are superimposed, a high degree of structural conservation is observed (rmsd <2A). This structural conservation is observed even though the amino acid sequence may vary in some positions (see, for example, Skehel and Wiley, 2000 Ann Rev Biochem 69:531-69; Vaccaro et al 2005). Regions of hemagglutinins are also well-conserved, for example: [0311] Structural domains: The HA0 polyprotein is cleaved to provide mature HA. HA is a homotrimer with each monomer comprising a receptor binding domain (HA1) and a membrane-anchoring domain (HA2) linked by a single disulphide bond; the N-terminal 20 residues of the HA2 subunit may also be referred to as the HA fusion domain or sequence. A tail region (internal to the membrane envelope) is also present. Each hemagglutinin comprises these regions or domains. Individual regions or domains are typically conserved in length. [0312] All hemagglutinins contain the same number and position of intra- and inter-molecular disulfide bridges. The quantity and position on the amino acid sequence of the cysteines that participate in disulfide bridge network is conserved among the HAs. Examples of structures illustrating the characteristic intra- and intermolecular disulfide bridges and other conserved amino acids and their relative positions are described in, for example, Gamblin et al 2004 (Science 303:1838-1842). Exemplary structures and sequences include 1RVZ, 1RVX, 1RVT, 1RV0, 1RUY, 1RU7, available from the Protein Data Bank (Berman et al. 2003. Nature Structural Biology 10:980; URL: rcsb.org) [0313] Cytoplasmic tailthe majority of hemagglutinins comprise 3 cysteines at conserved positions. One or more of these cysteines may be palmitoylated as a post-translational modification.
[0314] Amino acid variation is tolerated in hemagglutinins of influenza viruses. This variation provides for new strains that are continually identified. Infectivity between the new strains may vary. However, formation of hemagglutinin trimers, which subsequently form VLPs is maintained. The present invention, therefore, provides for a hemagglutinin amino acid sequence, or a nucleic acid encoding a hemagglutinin amino acid sequence, that forms VLPs in a plant, and includes known sequences and variant sequences that may develop.
[0315]
[0316] A/New Caledonia/20/99 (H1N1) (encoded by SEQ ID NO: 33),
[0317] A/Brisbane/59/2007 (H1N1) (SEQ ID NO: 48),
[0318] A/Solomon Islands/3/2006 (H1N1) (SEQ ID NO: 49) and
[0319] SEQ ID NO: 9. X1 (position 3) is A or V; X2 (position 52) is D or N; X3 (position 90) is K or R; X4 (position 99) is K or T; X5 (position 111) is Y or H; X6 (position 145) is V or T; X7 (position 154) is E or K; X8 (position 161) is R or K; X9 (position 181) is V or A; X10 (position 203) is D or N; X11 (position 205) is R or K; X12 (position 210) is T or K; X13 (position 225) is R or K; X14 (position 268) is W or R; X15 (position 283) is T or N; X16 (position 290) is E or K; X17 (position 432) is I or L; X18 (position 489) is N or D.
[0320] As another example of such variation, a sequence alignment and consensus sequence for HA of A/New Caledonia/20/99 (H1N1) (encoded by SEQ ID NO: 33), A/Brisbane/59/2007 (H1N1) (SEQ ID NO: 48), A/Solomon Islands/3/2006 (H1N1) (SEQ ID NO: 49), A/PuertoRico/8/34 (H1N1) and SEQ ID NO: 9 is shown below in Table 3.
TABLE-US-00004 TABLE3 Sequencealignmentandconsensussequence forHAofselectedH1N1strains SEQIDNO. Sequence 150 75 MKAKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL 9 MKAKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL 48 MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL 49 MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL 76 .................................................. Consensus mkxkllvllctftatyadticigyhannstdtvdtvleknvtvthsvnll 51100 75 EDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVETP 9 EDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVETP 48 ENSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVEKP 49 EDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISRESWSYIVEKP 76 .................................................. Consensus exshngklcllkgiaplqlgncsvagwilgnpecellis.eswsyive.p 101150 75 NPENGTCYPGYFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA 9 NPENGTCYPGYFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA 48 NPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA 49 NPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTTTGVSA 76 .................................................. Consensus npengtcypgxfadyeelreqlssyssferfeifpkesswpnhtxtgvsa 151200 75 SCSHNGKSSFYRNLLWLTGKNGLYPNLSKSYVNNKEKEVLVLWGVHHPPN 9 SCSHNGKSSFYRNLLWLTGKNGLYPNLSKSYVNNKEKEVLVLWGVHHPPN 48 SCSHNGESSFYRNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPN 49 SCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPN 76 .................................................. Consensus scshngxssfyxnllwltgknglypnlsksyxnnkekevlvlwgvhhppn 201250 75 IGNQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLL 9 IGNQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLL 48 IGDQKALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLL 49 IGDQRALYHKENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLL 76 ...............MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGK Consensus igxqxalyhxenayvsvvsshysrxftpeIakrPkvr#qegRi#yywtll 251300 75 EPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNAPMDECDAKCQTPQG 9 EPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNAPMDECDAKCQTPQG 48 EPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDKCDAKCQTPQG 49 EPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDECDAKCQTPQG 76 NTDLEVLMEW...LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQN Consensus #pgdt!ifEangnLiapxyafaLsrGfgsg!itsnaPm#xcdakcqtpQg 301350 75 AINSSLPFQNVHPVTIGECPKYVRSAKLRMVT.GLRNIPSIQSRGLFGAI 9 AINSSLPFQNVHPVTIGECPKYVRSAKLRMVT.GLRNIPSIQSRGLFGAI 48 AINSSLPFQNVHPVTIGECPKYVRSAKLRMVT.GLRNIPSIQSRGLFGAI 49 AINSSLPFQNVHPVTIGECPKYVRSAKLRMVT.GLRNIPSIQSRGLFGAI 76 ALNG.....NGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASC Consensus AiNsslpfqNvhPvtigecpKyvRsaKlrmvtxGlr#IpsigSrGlfgai 351400 75 AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVI 9 AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVI 48 AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVI 49 AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVI 76 MGLIYNRM.GAVTTEVAFGLVCATCEQIADSQHRSHRQMVITTNPLIRHE Consensus aGfIeggwtGmVdgwyg%hhqneqgsgyAadQkstqnaingiTNkvnsvi 401450 75 EKMNTQFTAVGKEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLENER 9 EKMNTQFTAVGKEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLENER 48 EKMNTQFTAVGKEFNKLERRMENLNKKVDDGFIDIWTYNAELLVLLENER 49 EKMNTQFTAVGKEFNKLERRMENLNKKVDDGFIDIWTYNAELLVLLENER 76 NRMVLASTTA.KAMEQMAGSSEQAAEAMEVA........SQARQMVQAMR Consensus #kMntqfTavgKef#k$errmE#lnkkv#dgfxdiwtyna#llv$l#neR 451500 75 TLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNECMESVKNGT 9 TLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNECMESVKNGT 48 TLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGT 49 TLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGT 76 TIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK............... Consensus TldfHdSnvknLy#kvks#LknnaKeiGngcfeFyhkcnxecmesvkngt 501550 75 YDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAI 9 YDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAI 48 YDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAI 49 YDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAI 76 .................................................. Consensus ydypkyseesklnrekidgvklesmgvyqilaiystvasslvllvslgai 551566 75 SFWMCSNGSLQCRICI 9 SFWMCSNGSLQCRICI 48 SFWMCSNGSLQCRICI 49 SFWMCSNGSLQCRICI 76 ................ Consensus sfwmcsngslqcrici
The consensus sequence indicates in upper case letters amino acids common to all sequences at a designated position; lower case letters indicate amino acids common to at least half, or a majority of the sequences; the symbol ! is any one of I or V; the symbol $ is any one of L or M; the symbol % is any one of F or Y; the symbol # is any one of N, D, Q, E, B or Z; the symbol . is no amino acid (e.g. a deletion); X at position 3 is any one of A or V; X at position 52 is any one of E or N; X at position 90 is K or R; X at position 99 is T or K; X at position 111 is any one of Y or H; X at position 145 is any one of V or T; X at position 157 is K or E; X at position 162 is R or K; X at position 182 is V or A; X at position 203 is N or D; X at position 205 is R or K; X at position 210 is T or K; X at position 225 is K or Y; X at position 333 is H or a deletion; X at position 433 is I or L; X at position 49) is N or D.
[0321] As another example of such variation, a sequence alignment and consensus sequence for HA of A/Anhui/1/2005 (H5N1) (SEQ ID NO: 55), A/Vietnam/1194/2004 (H5N1) and A/Indonesia/5/2006 (H5N1) (SEQ ID NO: 10) is shown below in Table 4.
TABLE-US-00005 TABLE4 Sequencealignmentandconsensussequence forHAofselectedH1N1strains SEQIDNO. Sequence 150 10 MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE 56 MEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE 55 MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE Consensus MEKIVLLlAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE 51100 10 KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAN 56 KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAN 55 KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAN Consensus KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAN 101150 10 PTNDLCYPGSFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSA 56 PVNDLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSSWSSHEASLGVSSA 55 RANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSA Consensus PxNDLCYPGxFNDYEELKHLLSRINHFEKIQIIPKSSWSdHEASsGVSSA 151200 10 CPYLGSPSFFRNVVWLIKKNSTYPTIKKSYNNTNQEDLLVLWGIHHPNDA 56 CPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDA 55 CPYQGTPSFFRNVVWLIKKNNTYPTIKRSYNNTNQEDLLILWGIHHSNDA Consensus CPYqGxpSFFRNVVWLIKKNsTYPTIKrSYNNTNQEDLL! LWGIHHpNDA 201250 10 AEQTRLYQNPTTYISIGISTLNQRLVPKIATRSKVNGQSGRMEFFWTILK 56 AEQTKLYQNPTTYISVGISTLNQRLVPRIATRSKVNGQSGRMEFFWTILK 55 AEQTKLYQNPTTYISVGISTLNQRLVPKIATRSKVNGQSGRMDFFWTILK Consensus AEQTkLYQNPTTYIS!GTSTLNQRLVPkIATRSKVNGQSGRM#FFWTILK 251300 10 PNDAINFESNGNFIAPEYAYKIVKKGDSAIMKSELEYGNCNTKCQTPMGA 56 PNDAINFESNGNFIAPEYAYKIVKKGDSTIMKSELEYGNCNTKCQTPMGA 55 PNDAINFESNGNFIAPEYAYKIVKKGDSAIVKSEVEYGNCNTKCQTPIGA Consensus PNDAINFESNGNFIAPEYAYKIVKKGDSaImKSElEYGNCNTKCQTPmGA 301350 10 INSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRESRRKKRGLFG 56 INSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRGLFG 55 INSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLRERRRK.RGLFG Consensus INSSMPFHNIHPLTIGECPKYVKSNrLVLATGLRNSPqRErRRKkRGLFG 351400 10 AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNS 56 AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNS 55 AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNS Consensus AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNS 401450 10 IIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN 56 IIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN 55 IIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN Consensus IIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN 451500 10 ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESIRN 56 ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRN 55 ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRN Consensus ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMES!RN 501550 10 GTYNYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMMA 56 GTYDYPQYSEEARLKREEISGVKLESIGIYQILSIYSTVASSLALAIMVA 55 GTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVA Consensus GTY#YPQYSEEARLKREEISGVKLESIGtYQILSIYSTVASSLALAIMvA 551568 10 GLSLWMCSNGSLQCRICI 56 GLSLWMCSNGSLQCRICI 55 GLSLWMCSNGSLQCRICI Consensus GLSLWMCSNGSLQCRICI
The consensus sequence indicates in upper case letters amino acids common to all sequences at a designated position; lower case letters indicate amino acids common to at least half, or a majority of the sequences; the symbol ! is any one of I or V; the symbol $ is any one of L or M; the symbol % is any one of F or Y; the symbol # is any one of N, D, Q, E, B or Z; X at position 102 is any of T, V or A; X t position 110 is any of S, D or N; X at position 156 is any of S, K or T.
[0322] The above-illustrated and described alignments and consensus sequences are non-limiting examples of variants in hemagglutinin amino acid sequences that may be used in various embodiments of the invention for the production of VLPs in a plant.
[0323] A nucleic acid encoding an amino acid sequence may be easily determined, as the codons for each amino acid are known in the art. Provision of an amino acid sequence, therefore, teaches the degenerate nucleic acid sequences that encode it. The present invention, therefore, provides for a nucleic acid sequence encoding the hemagglutinin of those influenza strains and subtypes disclosed herein (e.g. A/New Caledonia/20/99 (H1N1)A/Indonesia/5/2006 (H5N1), A/chicken/New York/1995, A/herring gull/DE/677/88 (H2N8), A/Texas/32/2003, A/mallard/MN/33/00, A/duck/Shanghai/1/2000, A/northern pintail/TX/828189/02, A/Turkey/Ontario/6118/68(H8N4), A/shoveler/Iran/G54/03, A/chicken/Germany/N/1949(H10N7), A/duck/England/56(H11N6), A/duck/Alberta/60/76(H12N5), A/Gull/Maryland/704/77(H13N6), A/Mallard/Gurjev/263/82, A/duck/Australia/341/83 (H15N8), A/black-headed gull/Sweden/5/99(H16N3), B/Lee/40, C/Johannesburg/66, A/PuertoRico/8/34 (H1N1), A/Brisbane/59/2007 (H1N1), A/Solomon Islands 3/2006 (H1N1), A/Brisbane 10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), B/Malaysia/2506/2004, B/Florida/4/2006, A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/HongKong/W312/97 (H6N1), A/Equine/Prague/56 (H7N7), A/HongKong/1073/99 (H9N2)), as well as the degenerate sequences that encode the above hemagglutinins.
[0324] Further, an amino acid sequence encoded by a nucleic acid may be easily determined, as the codon or codons for each amino acid are known. Provision of a nucleic acid, therefore, teaches an amino acid sequence encoded by it. The invention, therefore, provides for amino acid sequences of the hemagglutinin of those influenza strains and subtypes disclosed herein those disclosed herein (e.g. A/New Caledonia/20/99 (H1N1)A/Indonesia/5/2006 (H5N1), A/chicken/New York/1995, A/herring gull/DE/677/88 (H2N8), A/Texas/32/2003, A/mallard/MN/33/00, A/duck/Shanghai/1/2000, A/northern pintail/TX/828189/02, A/Turkey/Ontario/6118/68(H8N4), A/shoveler/Iran/G54/03, A/chicken/Germany/N/1949(H10N7), A/duck/England/56(H11N6), A/duck/Alberta/60/76(H12N5), A/Gull/Maryland/704/77(H13N6), A/Mallard/Gurjev/263/82, A/duck/Australia/341/83 (H15N8), A/black-headed gull/Sweden/5/99(H16N3), B/Lee/40, C/Johannesburg/66, A/PuertoRico/8/34 (H1N1), A/Brisbane/59/2007 (H1N1), A/Solomon Islands 3/2006 (H1N1), A/Brisbane 10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), B/Malaysia/2506/2004, B/Florida/4/2006, A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/HongKong/W312/97 (H6N1), A/Equine/Prague/56 (H7N7), A/HongKong/1073/99 (H9N2)).
[0325] In plants, influenza VLPs bud from the plasma membrane (see Example 5, and
[0326] PC and PE, as well as glycosphingolipids can bind to CD1 molecules expressed by mammalian immune cells such as antigen-presenting cells (APCs) like dendritic cells and macrophages and other cells including B and T lymphocytes in the thymus and liver (Tsuji M. 2006). CD1 molecules are structurally similar to major histocompatibility complex (MHC) molecules of class I and their role is to present glycolipid antigens to NKT cells (Natural Killer T cells). Upon activation, NKT cells activate innate immune cells such as NK cells and dendritic cells and also activate adaptive immune cells like the antibody-producing B cells and T-cells.
[0327] A variety of phytosterols may be found in a plasma membranethe specific complement may vary depending on the species, growth conditions, nutrient resources or pathogen state, to name a few factors. Generally, beta-sitosterol is the most abundant phytosterol.
[0328] The phytosterols present in an influenza VLP complexed with a lipid bilayer, such as an plasma-membrane derived envelope may provide for an advantageous vaccine composition. Without wishing to be bound by theory, plant-made VLPs complexed with a lipid bilayer, such as a plasma-membrane derived envelope, may induce a stronger immune reaction than VLPs made in other expression systems, and may be similar to the immune reaction induced by live or attenuated whole virus vaccines.
[0329] Therefore, in some embodiments, the invention provides for a VLP complexed with a plant-derived lipid bilayer. In some embodiments the plant-derived lipid bilayer may comprise the envelope of the VLP.
[0330] The VLP produced within a plant may include an HA comprising plant-specific N-glycans. Therefore, this invention also provides for a VLP comprising HA having plant specific N-glycans.
[0331] Furthermore, modification of N-glycan in plants is known (see for example U.S. 60/944,344; which is incorporated herein by reference) and HA having modified N-glycans may be produced. HA comprising a modified glycosylation pattern, for example with reduced fucosylated, xylosylated, or both, fucosylated and xylosylated, N-glycans may be obtained, or HA having a modified glycosylation pattern may be obtained, wherein the protein lacks fucosylation, xylosylation, or both, and comprises increased galatosylation. Furthermore, modulation of post-translational modifications, for example, the addition of terminal galactose may result in a reduction of fucosylation and xylosylation of the expressed HA when compared to a wild-type plant expressing HA.
[0332] For example, which is not to be considered limiting, the synthesis of HA having a modified glycosylation pattern may be achieved by co-expressing the protein of interest along with a nucleotide sequence encoding beta-1.4galactosyltransferase (GalT), for example, but not limited to mammalian GalT, or human GalT however GalT from another sources may also be used. The catalytic domain of GalT may also be fused to a CTS domain (i.e. the cytoplasmic tail, transmembrane domain, stem region) of N-acetylglucosaminyl transferase (GNT1), to produce a GNT1-GalT hybrid enzyme, and the hybrid enzyme may be co-expressed with HA. The HA may also be co-expressed along with a nucleotide sequence encoding N-acetylglucosaminyltrasnferase III (GnT-III), for example but not limited to mammalian GnT-III or human GnT-III, GnT-III from other sources may also be used. Additionally, a GNT1-GnT-III hybrid enzyme, comprising the CTS of GNT1 fused to GnT-III may also be used.
[0333] Therefore the present invention also includes VLP's comprising HA having modified N-glycans.
[0334] Without wishing to be bound by theory, the presence of plant N-glycans on HA may stimulate the immune response by promoting the binding of HA by antigen presenting cells. Stimulation of the immune response using plant N glycan has been proposed by Saint-Jore-Dupas et al. (2007). Furthermore, the conformation of the VLP may be advantageous for the presentation of the antigen, and enhance the adjuvant effect of VLP when complexed with a plant derived lipid layer.
[0335] By regulatory region, regulatory element or promoter it is meant a portion of nucleic acid typically, but not always, upstream of the protein coding region of a gene, which may be comprised of either DNA or RNA, or both DNA and RNA. When a regulatory region is active, and in operative association, or operatively linked, with a gene of interest, this may result in expression of the gene of interest. A regulatory element may be capable of mediating organ specificity, or controlling developmental or temporal gene activation. A regulatory region includes promoter elements, core promoter elements exhibiting a basal promoter activity, elements that are inducible in response to an external stimulus, elements that mediate promoter activity such as negative regulatory elements or transcriptional enhancers. Regulatory region, as used herein, also includes elements that are active following transcription, for example, regulatory elements that modulate gene expression such as translational and transcriptional enhancers, translational and transcriptional repressors, upstream activating sequences, and mRNA instability determinants. Several of these latter elements may be located proximal to the coding region.
[0336] In the context of this disclosure, the term regulatory element or regulatory region typically refers to a sequence of DNA, usually, but not always, upstream (5) to the coding sequence of a structural gene, which controls the expression of the coding region by providing the recognition for RNA polymerase and/or other factors required for transcription to start at a particular site. However, it is to be understood that other nucleotide sequences, located within introns, or 3 of the sequence may also contribute to the regulation of expression of a coding region of interest. An example of a regulatory element that provides for the recognition for RNA polymerase or other transcriptional factors to ensure initiation at a particular site is a promoter element. Most, but not all, eukaryotic promoter elements contain a TATA box, a conserved nucleic acid sequence comprised of adenosine and thymidine nucleotide base pairs usually situated approximately 25 base pairs upstream of a transcriptional start site. A promoter element comprises a basal promoter element, responsible for the initiation of transcription, as well as other regulatory elements (as listed above) that modify gene expression.
[0337] There are several types of regulatory regions, including those that are developmentally regulated, inducible or constitutive. A regulatory region that is developmentally regulated, or controls the differential expression of a gene under its control, is activated within certain organs or tissues of an organ at specific times during the development of that organ or tissue. However, some regulatory regions that are developmentally regulated may preferentially be active within certain organs or tissues at specific developmental stages, they may also be active in a developmentally regulated manner, or at a basal level in other organs or tissues within the plant as well. Examples of tissue-specific regulatory regions, for example see-specific a regulatory region, include the napin promoter, and the cruciferin promoter (Rask et al., 1998, J. Plant Physiol. 152: 595-599; Bilodeau et al., 1994, Plant Cell 14: 125-130). An example of a leaf-specific promoter includes the plastocyanin promoter (
[0338] An inducible regulatory region is one that is capable of directly or indirectly activating transcription of one or more DNA sequences or genes in response to an inducer. In the absence of an inducer the DNA sequences or genes will not be transcribed. Typically the protein factor that binds specifically to an inducible regulatory region to activate transcription may be present in an inactive form, which is then directly or indirectly converted to the active form by the inducer. However, the protein factor may also be absent. The inducer can be a chemical agent such as a protein, metabolite, growth regulator, herbicide or phenolic compound or a physiological stress imposed directly by heat, cold, salt, or toxic elements or indirectly through the action of a pathogen or disease agent such as a virus. A plant cell containing an inducible regulatory region may be exposed to an inducer by externally applying the inducer to the cell or plant such as by spraying, watering, heating or similar methods. Inducible regulatory elements may be derived from either plant or non-plant genes (e.g. Gatz, C. and Lenk, I. R. P., 1998, Trends Plant Sci. 3, 352-358; which is incorporated by reference). Examples, of potential inducible promoters include, but not limited to, tetracycline-inducible promoter (Gatz, C., 1997, Ann. Rev. Plant Physiol. Plant Mol. Biol. 48, 89-108; which is incorporated by reference), steroid inducible promoter (Aoyama, T. and Chua, N. H., 1997, Plant J. 2, 397-404; which is incorporated by reference) and ethanol-inducible promoter (Salter, M. G., et al, 1998, Plant Journal 16, 127-132; Caddick, M. X., et al, 1998, Nature Biotech. 16, 177-180, which are incorporated by reference) cytokinin inducible IB6 and CKI1 genes (Brandstatter, I. and Kieber, J. J., 1998, Plant Cell 10, 1009-1019; Kakimoto, T., 1996, Science 274, 982-985; which are incorporated by reference) and the auxin inducible element, DR5 (Ulmasov, T., et al., 1997, Plant Cell 9, 1963-1971; which is incorporated by reference).
[0339] A constitutive regulatory region directs the expression of a gene throughout the various parts of a plant and continuously throughout plant development. Examples of known constitutive regulatory elements include promoters associated with the CaMV 35S transcript. (Odell et al., 1985, Nature, 313: 810-812), the rice actin 1 (Zhang et al, 1991, Plant Cell, 3: 1155-1165), actin 2 (An et al., 1996, Plant J., 10: 107-121), or tms 2 (U.S. Pat. No. 5,428,147, which is incorporated herein by reference), and triosephosphate isomerase 1 (Xu et. al., 1994, Plant Physiol. 106: 459-467) genes, the maize ubiquitin 1 gene (Cornejo et al, 1993, Plant Mol. Biol. 29: 637-646), the Arabidopsis ubiquitin 1 and 6 genes (Holtorf et al, 1995, Plant Mol. Biol. 29: 637-646), and the tobacco translational initiation factor 4A gene (Mandel et al, 1995 Plant Mol. Biol. 29: 995-1004). The term constitutive as used herein does not necessarily indicate that a gene under control of the constitutive regulatory region is expressed at the same level in all cell types, but that the gene is expressed in a wide range of cell types even though variation in abundance is often observed. Constitutive regulatory elements may be coupled with other sequences to further enhance the transcription and/or translation of the nucleotide sequence to which they are operatively linked. For example, the CMPV-HT system (Sainsbury et al, 2008, Plant Physiology 148: 1212-1218) is derived from the untranslated regions of the Cowpea mosaic virus (COMV) and demonstrates enhanced translation of the associated coding sequence.
[0340] By native it is meant that the nucleic acid or amino acid sequence is naturally occurring, or wild type.
[0341] By operatively linked it is meant that the particular sequences, for example a regulatory element and a coding region of interest, interact either directly or indirectly to carry out an intended function, such as mediation or modulation of gene expression. The interaction of operatively linked sequences may, for example, be mediated by proteins that interact with the operatively linked sequences.
[0342] The one or more than one nucleotide sequence of the present invention may be expressed in any suitable plant host that is transformed by the nucleotide sequence, or constructs, or vectors of the present invention. Examples of suitable hosts include, but are not limited to, agricultural crops including alfalfa, canola, Brassica spp., maize, Nicotiana spp., alfalfa, potato, ginseng, pea, oat, rice, soybean, wheat, barley, sunflower, cotton and the like.
[0343] The one or more chimeric genetic constructs of the present invention can further comprise a 3 untranslated region. A 3 untranslated region refers to that portion of a gene comprising a DNA segment that contains a polyadenylation signal and any other regulatory signals capable of effecting mRNA processing or gene expression. The polyadenylation signal is usually characterized by effecting the addition of polyadenylic acid tracks to the 3 end of the mRNA precursor. Polyadenylation signals are commonly recognized by the presence of homology to the canonical form 5 AATAAA-3 although variations are not uncommon. One or more of the chimeric genetic constructs of the present invention can also include further enhancers, either translation or transcription enhancers, as may be required. These enhancer regions are well known to persons skilled in the art, and can include the ATG initiation codon and adjacent sequences. The initiation codon must be in phase with the reading frame of the coding sequence to ensure translation of the entire sequence.
[0344] Non-limiting examples of suitable 3 regions are the 3 transcribed non-translated regions containing a polyadenylation signal of Agrobacterium tumor inducing (Ti) plasmid genes, such as the nopaline synthase (Nos gene) and plant genes such as the soybean storage protein genes, the small subunit of the ribulose-1, 5-bisphosphate carboxylase (ssRUBISCO; U.S. Pat. No. 4,962,028; which is incorporated herein by reference) gene, the promoter used in regulating plastocyanin expression (Pwee and Gray 1993; which is incorporated herein by reference). An example of a plastocyanin promoter is described in U.S. Pat. No. 7,125,978 (which is incorporated herein by reference)
[0345] As described herein, promoters comprising enhancer sequences with demonstrated efficiency in leaf expression, have been found to be effective in transient expression. Without wishing to be bound by theory, attachment of upstream regulatory elements of a photosynthetic gene by attachment to the nuclear matrix may mediate strong expression. For example up to 784 from the translation start site of the pea plastocyanin gene may be used mediate strong reporter gene expression.
[0346] To aid in identification of transformed plant cells, the constructs of this invention may be further manipulated to include plant selectable markers. Useful selectable markers include enzymes that provide for resistance to chemicals such as an antibiotic for example, gentamycin, hygromycin, kanamycin, or herbicides such as phosphinothrycin, glyphosate, chlorosulfuron, and the like. Similarly, enzymes providing for production of a compound identifiable by colour change such as GUS (beta-glucuronidase), or luminescence, such as luciferase or GFP, may be used.
[0347] Also considered part of this invention are transgenic plants, plant cells or seeds containing the chimeric gene construct of the present invention. Methods of regenerating whole plants from plant cells are also known in the art. In general, transformed plant cells are cultured in an appropriate medium, which may contain selective agents such as antibiotics, where selectable markers are used to facilitate identification of transformed plant cells. Once callus forms, shoot formation can be encouraged by employing the appropriate plant hormones in accordance with known methods and the shoots transferred to rooting medium for regeneration of plants. The plants may then be used to establish repetitive generations, either from seeds or using vegetative propagation techniques. Transgenic plants can also be generated without using tissue cultures.
[0348] Also considered part of this invention are transgenic plants, trees, yeast, bacteria, fungi, insect and animal cells containing the chimeric gene construct comprising a nucleic acid encoding recombinant HA0 for VLP production, in accordance with the present invention.
[0349] The regulatory elements of the present invention may also be combined with coding region of interest for expression within a range of host organisms that are amenable to transformation, or transient expression. Such organisms include, but are not limited to plants, both monocots and dicots, for example but not limited to corn, cereal plants, wheat, barley, oat, Nicotiana spp, Brassica spp, soybean, bean, pea, alfalfa, potato, tomato, ginseng, and Arabidopsis.
[0350] Methods for stable transformation, and regeneration of these organisms are established in the art and known to one of skill in the art. The method of obtaining transformed and regenerated plants is not critical to the present invention.
[0351] By transformation it is meant the stable interspecific transfer of genetic information (nucleotide sequence) that is manifested genotypically, phenotypically or both. The interspecific transfer of genetic information from a chimeric construct to a host may be heritable and the transfer of genetic information considered stable, or the transfer may be transient and the transfer of genetic information is not inheritable.
[0352] By the term plant matter, it is meant any material derived from a plant. Plant matter may comprise an entire plant, tissue, cells, or any fraction thereof. Further, plant matter may comprise intracellular plant components, extracellular plant components, liquid or solid extracts of plants, or a combination thereof. Further, plant matter may comprise plants, plant cells, tissue, a liquid extract, or a combination thereof, from plant leaves, stems, fruit, roots or a combination thereof. Plant matter may comprise a plant or portion thereof which has not been subjected to any processing steps. A portion of a plant may comprise plant matter. However, it is also contemplated that the plant material may be subjected to minimal processing steps as defined below, or more rigorous processing, including partial or substantial protein purification using techniques commonly known within the art including, but not limited to chromatography, electrophoresis and the like.
[0353] By the term minimal processing it is meant plant matter, for example, a plant or portion thereof comprising a protein of interest which is partially purified to yield a plant extract, homogenate, fraction of plant homogenate or the like (i.e. minimally processed). Partial purification may comprise, but is not limited to disrupting plant cellular structures thereby creating a composition comprising soluble plant components, and insoluble plant components which may be separated for example, but not limited to, by centrifugation, filtration or a combination thereof. In this regard, proteins secreted within the extracellular space of leaf or other tissues could be readily obtained using vacuum or centrifugal extraction, or tissues could be extracted under pressure by passage through rollers or grinding or the like to squeeze or liberate the protein free from within the extracellular space. Minimal processing could also involve preparation of crude extracts of soluble proteins, since these preparations would have negligible contamination from secondary plant products. Further, minimal processing may involve aqueous extraction of soluble protein from leaves, followed by precipitation with any suitable salt. Other methods may include large scale maceration and juice extraction in order to permit the direct use of the extract.
[0354] The plant matter, in the form of plant material or tissue may be orally delivered to a subject. The plant matter may be administered as part of a dietary supplement, along with other foods, or encapsulated. The plant matter or tissue may also be concentrated to improve or increase palatability, or provided along with other materials, ingredients, or pharmaceutical excipients, as required.
[0355] Examples of a subject or target organism that the VLPs of the present invention may be administered to include, but are not limited to, humans, primates, birds, water fowl, migratory birds, quail, duck, geese, poultry, chicken, swine, sheep, equine, horse, camel, canine, dogs, feline, cats, tiger, leopard, civet, mink, stone marten, ferrets, house pets, livestock, rabbits, mice, rats, guinea pigs or other rodents, seal, whale and the like. Such target organisms are exemplary, and are not to be considered limiting to the applications and uses of the present invention.
[0356] It is contemplated that a plant comprising the protein of interest, or expressing the VLP comprising the protein of interest may be administered to a subject or target organism, in a variety of ways depending upon the need and the situation. For example, the protein of interest obtained from the plant may be extracted prior to its use in either a crude, partially purified, or purified form. If the protein is to be purified, then it may be produced in either edible or non-edible plants. Furthermore, if the protein is orally administered, the plant tissue may be harvested and directly feed to the subject, or the harvested tissue may be dried prior to feeding, or an animal may be permitted to graze on the plant with no prior harvest taking place. It is also considered within the scope of this invention for the harvested plant tissues to be provided as a food supplement within animal feed. If the plant tissue is being feed to an animal with little or not further processing it is preferred that the plant tissue being administered is edible.
[0357] Post-transcriptional gene silencing (PTGS) may be involved in limiting expression of transgenes in plants, and co-expression of a suppressor of silencing from the potato virus Y (HcPro) may be used to counteract the specific degradation of transgene mRNAs (Brigneti et al., 1998). Alternate suppressors of silencing are well known in the art and may be used as described herein (Chiba et al., 2006, Virology 346:7-14; which is incorporated herein by reference), for example but not limited to, TEV-p1/HC-Pro (Tobacco etch virus-p1/HC-Pro), BYV-p21, p19 of Tomato bushy stunt virus (TBSV p19), capsid protein of Tomato crinkle virus (TCV-CP), 2b of Cucumber mosaic virus; CMV-2b), p25 of Potato virus X (PVX-p25), p11 of Potato virus M (PVM-p11), p11 of Potato virus S (PVS-p11), p16 of Blueberry scorch virus, (BScV-p16), p23 of Citrus tristeza virus (CTV-p23), p24 of Grapevine leafroll-associated virus-2, (GLRaV-2 p24), p10 of Grapevine virus A, (GVA-p10), p14 of Grapevine virus B (GVB-p14), p10 of Heracleum latent virus (HLV-p10), or p16 of Garlic common latent virus (GCLV-p16). Therefore, a suppressor of silencing, for example, but not limited to, HcPro, TEV-p1/HC-Pro, BYV-p21, TBSV p19, TCV-CP, CMV-2b, PVX-p25, PVM-p11, PVS-p11, BScV-p16, CTV-p23, GLRaV-2 p24, GBV-p14, HLV-p10, GCLV-p16 or GVA-p10, may be co-expressed along with the nucleic acid sequence encoding the protein of interest to further ensure high levels of protein production within a plant.
[0358] Furthermore, VLPs may be produced that comprise a combination of HA subtypes. For example, VLPs may comprise one or more than one HA from the subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15, H16, type B, or a combination thereof. Selection of the combination of HAs may be determined by the intended use of the vaccine prepared from the VLP. For example a vaccine for use in inoculating birds may comprise any combination of HA subtypes, while VLPs useful for inoculating humans may comprise subtypes one or more than one of subtypes H1, H2, H3, H5, H6, H7, H9 or B. However, other HA subtype combinations may be prepared depending upon the use of the VLP. In order to produce VLPs comprising combinations of HA subtypes, the desired HA subtype may be co-expressed within the same cell, for example a plant cell.
[0359] Furthermore, VLPs produced as described herein do not comprise neuraminidase (NA). However, NA may be co-expressed with HA should VLPs comprising HA and NA be desired.
[0360] Therefore, the present invention further includes a suitable vector comprising the chimeric construct suitable for use with either stable or transient expression systems. The genetic information may be also provided within one or more than one construct. For example, a nucleotide sequence encoding a protein of interest may be introduced in one construct, and a second nucleotide sequence encoding a protein that modifies glycosylation of the protein of interest may be introduced using a separate construct. These nucleotide sequences may then be co-expressed within a plant. However, a construct comprising a nucleotide sequence encoding both the protein of interest and the protein that modifies glycosylation profile of the protein of interest may also be used. In this case the nucleotide sequence would comprise a first sequence comprising a first nucleic acid sequence encoding the protein of interest operatively linked to a promoter or regulatory region, and a second sequence comprising a second nucleic acid sequence encoding the protein that modifies the glycosylation profile of the protein of interest, the second sequence operatively linked to a promoter or regulatory region.
[0361] By co-expressed it is meant that two, or more than two, nucleotide sequences are expressed at about the same time within the plant, and within the same tissue of the plant. However, the nucleotide sequences need not be expressed at exactly the same time. Rather, the two or more nucleotide sequences are expressed in a manner such that the encoded products have a chance to interact. For example, the protein that modifies glycosylation of the protein of interest may be expressed either before or during the period when the protein of interest is expressed so that modification of the glycosylation of the protein of interest takes place. The two or more than two nucleotide sequences can be co-expressed using a transient expression system, where the two or more sequences are introduced within the plant at about the same time under conditions that both sequences are expressed. Alternatively, a platform plant comprising one of the nucleotide sequences, for example the sequence encoding the protein that modifies the glycosylation profile of the protein of interest, may be transformed, either transiently or in a stable manner, with an additional sequence encoding the protein of interest. In this case, the sequence encoding the protein that modifies the glycosylation profile of the protein of interest may be expressed within a desired tissue, during a desired stage of development, or its expression may be induced using an inducible promoter, and the additional sequence encoding the protein of interest may be expressed under similar conditions and in the same tissue, to ensure that the nucleotide sequences are co-expressed.
[0362] The constructs of the present invention can be introduced into plant cells using Ti plasmids, Ri plasmids, plant virus vectors, direct DNA transformation, micro-injection, electroporation, infiltration, and the like. For reviews of such techniques see for example Weissbach and Weissbach, Methods for Plant Molecular Biology, Academy Press, New York VIII, pp. 421-463 (1988); Geierson and Corey, Plant Molecular Biology, 2d Ed. (1988); and Miki and Iyer, Fundamentals of Gene Transfer in Plants. In Plant Metabolism, 2d Ed. D T. Dennis, D H Turpin, D D Lefebrve, D B Layzell (eds), Addison-Wesley, Langmans Ltd. London, pp. 561-579 (1997). Other methods include direct DNA uptake, the use of liposomes, electroporation, for example using protoplasts, micro-injection, microprojectiles or whiskers, and vacuum infiltration. See, for example, Bilang, et al. (Gene 100: 247-250 (1991), Scheid et al. (Mol. Gen. Genet. 228: 104-112, 1991), Guerche et al. (Plant Science 52: 111-116, 1987), Neuhause et al. (Theor. Appl Genet. 75: 30-36, 1987), Klein et al., Nature 327: 70-73 (1987); Howell et al. (Science 208: 1265, 1980), Horsch et al. (Science 227: 1229-1231, 1985), DeBlock et al., Plant Physiology 91: 694-701, 1989), Methods for Plant Molecular Biology (Weissbach and Weissbach, eds., Academic Press Inc., 1988), Methods in Plant Molecular Biology (Schuler and Zielinski, eds., Academic Press Inc., 1989), Liu and Lomonossoff (J. Virol Meth, 105:343-348, 2002), U.S. Pat. Nos. 4,945,050; 5,036,006; 5,100,792; 6,403,865; 5,625,136, (all of which are hereby incorporated by reference).
[0363] Transient expression methods may be used to express the constructs of the present invention (see Liu and Lomonossoff, 2002, Journal of Virological Methods, 105:343-348; which is incorporated herein by reference). Alternatively, a vacuum-based transient expression method, as described by Kapila et al. 1997 (incorporated herein by reference) may be used. These methods may include, for example, but are not limited to, a method of Agro-inoculation or Agro-infiltration, however, other transient methods may also be used as noted above. With either Agro-inoculation or Agro-infiltration, a mixture of Agrobacteria comprising the desired nucleic acid enter the intercellular spaces of a tissue, for example the leaves, aerial portion of the plant (including stem, leaves and flower), other portion of the plant (stem, root, flower), or the whole plant. After crossing the epidermis the Agrobacterium infect and transfer t-DNA copies into the cells. The t-DNA is episomally transcribed and the mRNA translated, leading to the production of the protein of interest in infected cells, however, the passage of t-DNA inside the nucleus is transient.
[0364] If the nucleotide sequence of interest encodes a product that is directly or indirectly toxic to the plant, then by using the method of the present invention, such toxicity may be reduced throughout the plant by selectively expressing the nucleotide sequence of interest within a desired tissue or at a desired stage of plant development. In addition, the limited period of expression resulting from transient expression may reduce the effect when producing a toxic product in the plant. An inducible promoter, a tissue-specific promoter, or a cell specific promoter, may be used to selectively direct expression of the sequence of interest.
[0365] The recombinant HA VLPs of the present invention can be used in conjunction with existing influenza vaccines, to supplement the vaccines, render them more efficacious, and to reduce the administration dosages necessary. As would be known to a person of skill in the art, the vaccine may be directed against one or more than one influenza virus. Examples of suitable vaccines include, but are not limited to, those commercially available from Sanofi-Pasteur, ID Biomedical, Merial, Sinovac, Chiron, Roche, MedImmune, GlaxoSmithKline, Novartis, Sanofi-Aventis, Serono, Shire Pharmaceuticals and the like.
[0366] If desired, the VLPs of the present invention may be admixed with a suitable adjuvant as would be known to one of skill in the art. Furthermore, the VLP may be used in a vaccine composition comprising an effective dose of the VLP for the treatment of a target organism, as defined above. Furthermore, the VLP produced according to the present invention may be combined with VLPs obtained using different influenza proteins, for example, neuraminidase (NA).
[0367] Therefore, the present invention provides a method for inducing immunity to influenza virus infection in an animal or target organism comprising administering an effective dose of a vaccine comprising one or more than one VLP. The vaccine may be administered orally, intradermally, intranasally, intramuscularly, intraperitoneally, intravenously, or subcutaneously.
[0368] Administration of VLPs produced according to the present invention is described in Example 6. Administration of plant-made H5 VLP resulted in a significantly higher response when compared to administration of soluble HA (see
[0369] As shown in
[0370] These data, therefore, demonstrate that plant-made influenza VLPs comprising the H5 hemagglutinin viral protein induce an immune response specific for pathogenic influenza strains, and that virus-like particles may bud from a plant plasma membrane.
[0371] Therefore, the present invention provides a composition comprising an effective dose of a VLP comprising an influenza virus HA protein, one or more than one plant lipid, and a pharmaceutically acceptable carrier. The influenza virus HA protein may be H5 Indonesia/5/2006, A/Brisbane/50/2007, A/Sololmon Islands 3/2006, A/Brisbane/10/2007, A/Wisconsin/67/2005, B/Malaysia/2506/2005, B/Florida/4/2006, A/Singapore/1/57, A/Anhui/1/2005, A/Vietnam/1194/2004, A/Teal/HongKong/W312/97, A/Equine/Prague/56 or N HongKong/1073/99. Also provided is a method of inducing immunity to an influenza virus infection in a subject. The method comprising administering the virus like particle comprising an influenza virus HA protein, one or more than one plant lipid, and a pharmaceutically acceptable carrier. The virus like particle may be administered to a subject orally, intradermally, intranasally, intramusclarly, intraperitoneally, intravenously, or subcutaneously.
[0372] Compositions according to various embodiments of the invention may comprise VLPs of two or more influenza strains or subtypes. Two or more refers to two, three, four, five, six, seven, eight, nine, 10 or more strains or subtypes. The strains or subtypes represented may be of a single subtype (e.g. all H1N1, or all H5N1), or may be a combination of subtypes. Exemplary subtype and strains include, but are not limited to, those disclosed herein (e.g. A/New Caledonia/20/99 (H1N1)A/Indonesia/5/2006 (H5N1), A/chicken/New York/1995, A/herring gull/DE/677/88 (H2N8), A/Texas/32/2003, A/mallard/MN/33/00, A/duck/Shanghai/1/2000, A/northern pintail/TX/828189/02, A/Turkey/Ontario/6118/68(H8N4), A/shoveler/Iran/G54/03, A/chicken/Germany/N/1949(H10N7), A/duck/England/56(H11N6), A/duck/Alberta/60/76(H12N5), A/Gull/Maryland/704/77(H13N6), A/Mallard/Gurjev/263/82, A/duck/Australia/341/83 (H15N8), A/black-headed gull/Sweden/5/99(H16N3), B/Lee/40, C/Johannesburg/66, A/PuertoRico/8/34 (H1N1), A/Brisbane/59/2007 (H1N1), A/Solomon Islands 3/2006 (H1N1), A/Brisbane 10/2007 (H3N2), A/Wisconsin/67/2005 (H3N2), B/Malaysia/2506/2004, B/Florida/4/2006, A/Singapore/1/57 (H2N2), A/Anhui/1/2005 (H5N1), A/Vietnam/1194/2004 (H5N1), A/Teal/HongKong/W312/97 (H6N1), A/Equine/Prague/56 (H7N7), A/HongKong/1073/99 (H9N2)).
[0373] The choice of combination of strains and subtypes may depend on the geographical area of the subjects likely to be exposed to influenza, proximity of animal species to a human population to be immunized (e.g. species of waterfowl, agricultural animals such as swine, etc) and the strains they carry, are exposed to or are likely to be exposed to, predictions of antigenic drift within subtypes or strains, or combinations of these factors. Examples of combinations used in past years are available (see URL: who.int/csr/dieease/influenza/vaccine recommendations1/en). Some or all of these strains may be employed in the combinations shown, or in other combinations, in the production of a vaccine composition.
[0374] More particularly, exemplary combinations may include VLPs from two or more strains or subtypes selected from the group comprising: A/Brisbane/59/2007 (H1N1), an A/Brisbane/59/2007 (H1N1)-like virus, A/Brisbane/10/2007 (H3N2), an A/Brisbane/10/2007 (H3N2)-like virus, B/Florida/4/2006 or an B/Florida/4/2006-like virus.
[0375] Another exemplary combination may include VLPs from two or more strains or subtypes selected from the group comprising A/Indonesia/5/2005, an A/Indonesia/5/2005-like virus, A/Vietnam/1194/2004, an A/Vietnam/1194/2004-like virus, A/Anhui/1/05, an A/Anhui/1/05-like virus, A/goose/Guiyang/337/2006, A/goose/Guiyang/337/2006-like virus, A/chicken/Shanxi/2/2006, or A/chicken/Shanxi/2/2006-like virus.
[0376] Another exemplary combination may include VLPs of A/Chicken/Italy/13474/99 (H7 type) or A/Chicken/British Columbia/04 (H7N3) strains of influenza.
[0377] Another exemplary combination may include VLPs of A/Chicken/HongKong/G9/97 or A/HongKong/1073/99. Another exemplary combination may comprise VLPs of A/Solomon Islands/3/2006. Another exemplary combination may comprise VLPs of A/Brisbane/10/2007. Another exemplary combination may comprise VLPs of A/Wisconsin/67/2005. Another exemplary combination may comprise VLPs of the B/Malaysia/2506/2004, B/Florida/4/2006 or B/Brisbane/3/2007 strains or subtypes.
[0378] The two or more VLPs may be expressed individually, and the purified or semi-purified VLPs subsequently combined. Alternately, the VLPs may be co-expressed in the same host, for example a plant. The VLPs may be combined or produced in a desired ratio, for example about equivalent ratios, or may be combined in such a manner that one subtype or strain comprises the majority of the VLPs in the composition.
[0379] Therefore, the invention provides for compositions comprising VLPs of two or more strains or subtypes.
[0380] VLPs of enveloped viruses generally acquire their envelope from the membrane they bud through. Plant plasma membranes have a phytosterol complement that may have immunostimulatory effects. To investigate this possibility, plant-made H5 VLPs were administered to animals in the presence or absence of an adjuvant, and the HAI (hemagglutination inhibition antibody response) determined (
Table 5 lists sequences provided in various embodiments of the invention.
TABLE-US-00006 TABLE5 Sequencedescriptionforsequenceidentifiers. SEQ IDNo SequenceDescription InDisclosure 1 NterminalH1fragment FIG.4a 2 CterminalH1fragment FIG.4b 3 H5codingsequence FIG.6 4 primerPlato-443c FIG.7a 5 primerSpHA(Ind)-Plasto.r FIG.7b 6 primerPlasto-SpHA(Ind).c FIG.7c 7 primerHA(Ind)-Sac.r FIG.7d 8 Sequenceofthealfalfaplastocyanin-based FIG.1 expressioncassetteusedfortheexpressionof H1 9 HA1peptidesequence(A/New FIG.8a Caledonia/20/99) 10 HA5peptidesequence(A/Indonesia/5/2006) FIG.8b 11 InfluenzaASubtypeH7codingsequence FIG.9 (A/chicken/NewYork/1995) 12 InfluenzaASubtypeH2codingsequence FIG.10a (A/herringgull/DE/677/88(H2N8)) 13 InfluenzaASubtypeH3codingsequence FIG.10b (A/Texas/32/2003) 14 InfluenzaASubtypeH4codingsequence FIG.10c (A/mallard/MN/33/00) 15 InfluenzaASubtypeH5codingsequence FIG.10d (A/duck/Shanghai/1/2000) 16 InfluenzaASubtypeH6codingsequence FIG.10e (A/northernpintail/TX/828189/02) 17 InfluenzaASubtypeH8codingsequence FIG.10f (A/Turkey/Ontario/6118/68(H8N4)) 18 InfluenzaASubtypeH9codingsequence FIG.10g (A/shoveler/Iran/G54/03) 19 InfluenzaASubtypeH10codingsequence FIG.10h (A/chicken/Germany/N/1949(H10N7)) 20 InfluenzaASubtypeH11codingsequence FIG.10i (A/duck/England/56(H11N6)) 21 InfluenzaASubtypeH12codingsequence FIG.10j (A/duck/Alberta/60/76(H12N5)) 22 InfluenzaASubtypeH13codingsequence FIG.10k (A/Gull/Maryland/704/77(H13N6)) 23 InfluenzaASubtypeH14codingsequence FIG.10l (A/Mallard/Gurjev/263/82) 24 InfluenzaASubtypeH15codingsequence FIG.10m (A/duck/Australia/341/83(H15N8)) 25 InfluenzaASubtypeH16codingsequence FIG.10n (A/black-headedgull/Sweden/5/99(H16N3)) 26 InfluenzaBHAcodingsequence(B/Lee/40) FIG.10o 27 InfluenzaCHAcodingsequence FIG.10p (C/Johannesburg/66) 28 CompleteHAOH1sequence FIG.5 29 PrimerXmaI-pPlas.c FIG.10q 30 PrimerSacI-ATG-pPlas.r FIG.10r 31 PrimerSacI-PlasTer.c FIG.10s 32 PrimerEcoRI-PlasTer.r FIG.10t 33 A/NewCaledonia/20/99(H1N1) FIG.16 GenBankAccessionNo.AY289929 34 M.Sativaproteindisulfideisomerase FIG.17 GenBankAccessionNo.Z11499 35 A/.PuertoRico/8/34(H1N1) FIG.18 GenBankAccessionNo.NC_002016.1 36 Clone774:DNAfromDraIIItoSac1comprising FIG.28 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof A/Brisbane/59/2007(H1N1) 37 Clone775:DNAfromDraIIItoSac1comprising FIG.29 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAofA/SolomonIslands 3/2006(H1N1) 38 Clone776:DNAfromDraIIItoSac1comprising FIG.30 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAofA/Brisbane 10/2007(H3N2) 39 Clone777:DNAfromDraIIItoSac1comprising FIG.31 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof A/Wisconsin/67/2005(H3N2) 40 Clone778:DNAfromDraIIItoSac1comprising FIG.32 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof B/Malaysia/2506/2004 41 Clone779:DNAfromDraIIItoSac1comprising FIG.33 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAofB/Florida/4/2006 42 Clone780:DNAfromDraIIItoSac1comprising FIG.34 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAofA/Singapore/1/57 (H2N2) 43 Clone781:DNAfromDraIIItoSac1comprising FIG.35 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAofA/Anhui/1/2005 (H5N1) 44 Clone782:DNAfromDraIIItoSac1comprising FIG.36 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof A/Vietnam/1194/2004(H5N1) 45 Clone783:DNAfromDraIIItoSac1comprising FIG.37 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof A/Teal/HongKong/W312/97(H6N1) 46 Clone784:DNAfromDraIIItoSac1comprising FIG.38 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof A/Equine/Prague/56(H7N7) 47 Clone785:DNAfromDraIIItoSac1comprising FIG.39 plastocyaninregulatoryregionoperativelylinked tosequenceencodingHAof A/HongKong/1073/99(H9N2) 48 Clone774HAaminoacidsequence FIG.40A A/Brisbane/59/2007(H1N1) 49 Clone775HAaminoacidsequence FIG.40B A/SolomonIslands3/2006(H1N1) 50 Clone776HAaminoacidsequence FIG.41A A/Brisbane10/2007(H3N2) 51 Clone777HAaminoacidsequence FIG.41B A/Wisconsin/67/2005(H3N2) 52 Clone778HAaminoacidsequence FIG.42A B/Malaysia/2506/2004 53 Clone779HAaminoacidsequence FIG.42B B/Florida/4/2006 54 Clone780HAaminoacidsequence FIG.43A A/Singapore/1/57(H2N2) 55 Clone781HAaminoacidsequence FIG.43B A/Anhui/1/2005(H5N1) 56 Clone782HAaminoacidsequence FIG.44A A/Vietnam/1194/2004(H5N1) 57 Clone783HAaminoacidsequence FIG.44B A/Teal/HongKong/W312/97(H6N1) 58 Clone784HAaminoacidsequence FIG.45A A/Equine/Prague/56(H7N7) 59 Clone785HAaminoacidsequence FIG.45B A/HongKong/1073/99(H9N2) 60 HAexpressioncassettecomprisingalfalfa FIG.51 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH5from A/Indonesia/5/2005(Construct#660),alfalfa plastocyanin3 UTRandterminatorsequences 61 HAexpressioncassettecomprisingalfalfa FIG.52 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH1from A/NewCaledonia/20/1999(Construct#540), alfalfaplastocyanin3 UTRandterminator sequences 62 HAexpressioncassettecomprisingalfalfa FIG.53 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH1from A/Brisbane/59/2007(construct#774),alfalfa plastocyanin3 UTRandterminatorsequences 63 HAexpressioncassettecomprisingalfalfa FIG.54 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH1from A/SolomonIslands/3/2006(H1N1)(construct #775),alfalfaplastocyanin3 UTRand terminatorsequences 64 HAexpressioncassettecomprisingalfalfa FIG.55 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH2from A/Singapore/1/57(H2N2)(construct#780), alfalfaplastocyanin3 UTRandterminator sequences 65 HAexpressioncassettecomprisingalfalfa FIG.56 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH5from A/Anhui/1/2005(H5N1)(Construct#781), alfalfaplastocyanin3 UTRandterminator sequences 66 HAexpressioncassettecomprisingalfalfa FIG.57 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH5from A/Vietnam/1194/2004(H5N1)(Construct #782),alfalfaplastocyanin3 UTRand terminatorsequences 67 HAexpressioncassettecomprisingalfalfa FIG.58 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH6from A/Teal/HongKong/W312/97(H6N1) (Construct#783),alfalfaplastocyanin3 UTR andterminatorsequences 68 HAexpressioncassettecomprisingalfalfa FIG.59 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH9from A/HongKong/1073/99(H9N2)(Construct #785),alfalfaplastocyanin3 UTRand terminatorsequences 69 HAexpressioncassettecomprisingalfalfa FIG.60 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH3from A/Brisbane/10/2007(H3N2),alfalfa plastocyanin3 UTRandterminatorsequences 70 HAexpressioncassettecomprisingalfalfa FIG.61 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH3from A/Wisconsin/67/2005(H3N2),alfalfa plastocyanin3 UTRandterminatorsequences 71 HAexpressioncassettecomprisingalfalfa FIG.62 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofH7from A/Equine/Prague/56(H7N7),alfalfa plastocyanin3 UTRandterminatorsequences 72 HAexpressioncassettecomprisingalfalfa FIG.63 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofHAfrom B/Malaysia/2506/2004,alfalfaplastocyanin3 UTRandterminatorsequences 73 HAexpressioncassettecomprisingalfalfa FIG.64 plastocyaninpromoterand5 UTR, hemagglutinincodingsequenceofHAfrom B/Florida/4/2006,alfalfaplastocyanin3 UTR andterminatorsequences 74 ConsensusaminoacidsequenceofSEQID FIG.65 NO:49,48,33and9 75 AminoacidsequenceofH1NewCaledonia FIG.66 (AAP34324.1)encodedbySEQIDNO:33 76 AminoacidsequenceofH1PuertoRico FIG.67 (NC_0409878.1)encodedbySEQIDNO:35 77 pBinPlus.2613c AGGAAGGGAAGAAAGC GAAAGGAG 78 Mut-ATG115.r GTGCCGAAGCACGATC TGACAACGTTGAAGAT CGCTCACGCAAGAAAG ACAAGAGA 79 Mut-ATG161.c GTTGTCAGATCGTGCTT CGGCACCAGTACAACG TTTTCTTTCACTGAAGC GA 80 LC-C5-1.110r TCTCCTGGAGTCACAG ACAGGGTGG 81 Expressioncassettenumber828,fromPacI FIG.68 (upstreampromoter)toAscI(immediately downstreamNOSterminator). 82 SpPDI-HA(Ind).c GTTCCTTCTCAGATCTT CGCTGATCAGATTTGC ATTGGTTACCATGCA 83 Constructnumber663,fromHindIII(inthe FIG.69 multiplecloningsite,upstreamPlastocyanine promoter)toEcoRI(immediatelydownstream Plastocynineterminator). 84 SpPDI-H1B.c TTCTCAGATCTTCGCTG ACACAATATGTATAGGC TACCATGCTAACAAC 85 SacI-H1B.r CTTAGAGCTCTTAGATG CATATTCTACACTGTAA AGACCCATTGGAA 86 Constructnumber787,fromHindIII(inthe FIG.70 multiplecloningsite,upstreamPlastocyanine promoter)toEcoRI(immediatelydownstream Plastocynineterminator) 87 H3B-SpPDI.r TGTCATTTCCGGGAAG TTTTTGAGCGAAGATC TGAGAAGGAACCA 88 SpPDI-H3B.c TCTCAGATCTTCGCTCA AAAACTTCCCGGAAAT GACAACAGCACG 89 H3(A-Bri).982r TTGCTTAACATATCTGG GACAGG 90 Constructnumber790,fromHindIII(inthe FIG.7 multiplecloningsite,upstreamPlastocyanine promoter)toEcoRI(immediatelydownstream Plastocynineterminator). 91 HBF-SpPDI.r GTTATTCCAGTGCAGAT TCGATCAGCGAAGATC TGAGAAGGAACCAACA C 92 SpPDI-HBF.c CAGATCTTCGCTGATC GAATCTGCACTGGAAT AACATCTTCAAACTCAC C 93 Plaster80r CAAATAGTATTTCATAA CAACAACGATT 94 Constructnumber798,fromHindIII(inthe FIG.72 multiplecloningsite,upstreamPlastocyanine promoter)toEcoRI(immediatelydownstream Plastocynineterminator). 95 ApaI-SpPDI.c TTGTCGGGCCCATGGC GAAAAACGTTGCGATTT TCGGCTTATTGT 96 StuI-H1(A-NC).r AAAATAGGCCTTTAGAT GCATATTCTACACTGCA AAGACCCA 97 Constructnumber580,fromPacI(upstream FIG.73 35Spromoter)toAscI(immediately downstreamNOSterminator). 98 ApaI-H5(A-Indo).1c TGTCGGGCCCATGGAG AAAATAGTGCTTCTTCT TGCAAT 99 H5(A-Indo)-StuI.1707r AAATAGGCCTTTAAATG CAAATTCTGCATTGTAA CGA 100 Constructnumber685,fromPacI(upstream FIG.74 35Spromoter)toAscI(immediately downstreamNOSterminator). 101 Constructnumber686,fromPacI(upstream FIG.75 35Spromoter)toAscI(immediately downstreamNOSterminator) 102 ApaI-H1B.c TGTCGGGCCCATGAAA GTAAAACTACTGGTCCT GTTATGCACATT 103 StuI-H2B.r AAATAGGCCTTTAGATG CATATTCTACACTGTAA AGACCCATTGGA 104 Construct732,fromPacI(upstream35S FIG.76 promoter)toAscI(immediatelydownstream NOSterminator). 105 Constructnumber733,fromPacI(upstream FIG.77 35Spromoter)toAscI(immediately downstreamNOSterminator). 106 ApaI-H3B.c TTGTCGGGCCCATGAA GACTATCATTGCTTTGA GCTACATTCTATGTC 107 StuI-H3B.r AAAATAGGCCTTCAAAT GCAAATGTTGCACCTAA TGTTGCCTTT 108 Constructnumber735,fromPacI(upstream FIG.78 35Spromoter)toAscI(immediately downstreamNOSterminator). 109 Constructnumber736,fromPacI(upstream FIG.79 35Spromoter)toAscI(immediately downstreamNOSterminator). 110 ApI-HBF.c TTGTCGGGCCCATGAA GGCAATAATTGTACTAC TCATGGTAGTAAC 111 StuI-HBF.r AAAATAGGCCTTTATAG ACAGATGGAGCATGAA ACGTTGTCTCTGG 112 Constructnumber738,fromPacI(upstream FIG.80 35Spromoter)toAscI(immediately downstreamNOSterminator). 113 Constructnumber739,fromPacI(upstream FIG.81 35Spromoter)toAscI(immediately downstreamNOSterminator). 114 M.sativaMsj1codingsequence FIG.82 115 Hsp-40Luz.1c ATGTTTGGGCGCGGAC CAAC 116 Hsp40Luz-SacI.1272r AGCT CTACTG TTGAGCGCATTGCAC 117 Hsp40Luz-Plasto.r GTTGGTCCGCGCCCAA ACATTTTCTCTCAAGAT GAT 118 Hsp70Ara.1c ATGTCGGGTAAAGGAG AAGGA 119 Hsp70Ara-SacI.1956r AGCT
TTAGTC GACCTCCTCGATCTTA G 120 Hsp70Ara-Plasto.r TCCTTCTCCTTTACCCG ACATTTTCTCTCAAGAT GAT 121 ConstructnumberR850,fromHindIII(inthe FIG.83 multiplecloningsite,upstreampromoter)to EcoRI(immediatelydownstreamNOS terminator). 122 ConstructnumberR860,fromHindIII(inthe FIG.84 multiplecloningsite,upstreampromoter)to EcoRI(immediatelydownstreamNOS terminator) 123 ConstructnumberR870,fromHindIII(inthe FIG.85 multiplecloningsite,upstreampromoter)to EcoRI(immediatelydownstreamNOS terminator). 124 supP19-plasto.r CCTTGTATAGCTCGTTC CATTTTCTCTCAAGATG 125 supP19-1c ATGGAACGAGCTATAC AAGG 126 SupP19-SacI.r AGTCGAGCTCTTACTC GCTTTCTTTTTCGAAG
[0381] The invention will now be described in detail by way of reference only to the following non-limiting examples.
Methods and Materials
1. Assembly of Plastocyanin-Based Expression Cassettes for Native HA
[0382] All manipulations were done using the general molecular biology protocols of Sambrook and Russell (2001; which is incorporated herein by reference). The first cloning step consisted in assembling a receptor plasmid containing upstream and downstream regulatory elements of the alfalfa plastocyanin gene. The plastocyanin promoter and 5UTR sequences were amplified from alfalfa genomic DNA using oligonucleotide primers XmaI-pPlas.c (SEQ ID NO: 29;
[0383] A fragment encoding hemagglutinin from influenza strain A/Indonesia/5/05 (H5N1; Acc. No. LANL ISDN125873) was synthesized by Epoch Biolabs (Sugar Land, Tex., USA). The fragment produced, containing the complete H5 coding region including the native signal peptide flanked by a HindIII site immediately upstream of the initial ATG, and a SacI site immediately downstream of the stop (TAA) codon, is presented in SEQ ID NO: 3 (
[0384] Hemagglutinin expression cassettes number 774 to 785 were assembled as follows. A synthetic fragment was synthesized comprising the complete hemagglutinin coding sequence (from ATG to stop) flanked in 3 by alfalfa plastocyanin gene sequences corresponding to the first 84 nucleotides upstream of the plastocyanin ATG and ending with a DraIII restriction site. The synthetic fragments also comprised a SacI site immediately after the stop codon.
[0385] Synthetic hemagglutinin fragments were synthesized by Top Gene Technologies (Montreal, QC, Canada) and Epoch Biolabs (Sugar Land, Tex., USA). The fragment synthesized are presented in
TABLE-US-00007 TABLE 6 Hemagglutinin expression cassettes assembled from DraIII-SacI synthetic fragments. Synthetic fragment Complete cassette Synthetic Final fragment cassette Cassette SEQ SEQ number Corresponding HA Figure ID NO Figure ID NO 774 HA of A/Brisbane/59/2007 (H1N1) 28 36 53 62 775 HA of A/Solomon Islands 3/2006 (H1N1) 29 37 54 63 776 HA of A/Brisbane 10/2007 (H3N2) 30 38 60 69 777 HA of A/Wisconsin/67/2005 (H3N2) 31 39 61 70 778 HA of B/Malaysia/2506/2004 32 40 63 72 779 HA of B/Florida/4/2006 33 41 64 73 780 HA of A/Singapore/1/57 (H2N2) 34 42 55 64 781 HA of A/Anhui/1/2005 (H5N1) 35 43 56 65 782 HA of A/Vietnam/1194/2004 (H5N1) 36 44 57 66 783 HA of A/Teal/HongKong/W312/97 (H6N1) 37 45 58 67 784 HA of A/Equine/Prague/56 (H7N7) 38 46 62 71 785 HA of A/HongKong/1073/99 (H9N2) 39 47 59 68
Assembly of Plastocyanin-Based PDISP/HA-Fusion Expression Cassettes
H1 A/New Caledonia/20/99 (Construct Number 540)
[0386] The open reading frame from the H1 gene of influenza strain A/New Caledonia/20/99 (H1N1) was synthesized in two fragments (Plant Biotechnology Institute, National Research Council, Saskatoon, Canada). A first fragment synthesized corresponds to the wild-type H1 coding sequence (GenBank acc. No. AY289929; SEQ ID NO: 33;
[0387] The first H1 fragment was digested with BglII and SacI and cloned into the same sites of a binary vector (pCAMBIAPlasto) containing the plastocyanin promoter and 5UTR fused to the signal peptide of alfalfa protein disulfide isomerase (PDI) gene (nucleotides 32-103; Accession No. Z11499; SEQ ID NO: 34;
H5 A/Indonesia/5/2005 (Construct Number 663)
[0388] The signal peptide of alfalfa protein disulfide isomerase (PDISP) (nucleotides 32-103; Accession No. Z11499; SEQ ID NO: 34;
H1 A/Brisbane/59/2007 (Construct 787)
[0389] The signal peptide of alfalfa protein disulfide isomerase (PDISP) (nucleotides 32-103; Accession No. Z11499; SEQ ID NO: 34;
H3 A/Brisbane/10/2007 (Construct Number 790)
[0390] The signal peptide of alfalfa protein disulfide isomerase (PDISP) (nucleotides 32-103; Accession No. Z11499; SEQ ID NO: 34;
HA B/Florida/4/2006 (Construct Number 798)
[0391] The signal peptide of alfalfa protein disulfide isomerase (PDISP) (nucleotides 32-103; Accession No. Z11499; SEQ ID NO: 34;
Assembly of CPMV-HT-Based Expression Cassettes
[0392] CPMV-HT expression cassettes use the 35S promoter to control the expression of an mRNA comprising a coding sequence of interest flanked, in 5 by nucleotides 1-512 from the Cowpea mosaic virus (CPMV) RNA2 with mutated ATG at positions 115 and 161 and in 3, by nucleotides 3330-3481 from the CPMV RNA2 (corresponding to the 3 UTR) followed by the NOS terminator. Plasmid pBD-05-1LC, (Sainsbury et al. 2008; Plant Biotechnology Journal 6: 82-92 and PCT Publication WO 2007/135480), was used for the assembly of CPMV-HT-based hemagglutinin expression cassettes. The mutation of ATGs at position 115 and 161 of the CPMV RNA2 was done using a PCR-based ligation method presented in Darveau et al. (Methods in Neuroscience 26: 77-85 (1995)) Two separate PCRs were performed using pBD-05-1LC as template. The primers for the first amplification are pBinPlus.2613c (SEQ ID NO: 77) and Mut-ATG115.r (SEQ ID NO: 78). The primers for the second amplification were Mut-ATG161.c (SEQ ID NO: 79) and LC-05-1.110r (SEQ ID NO: 80). The two obtained fragments are then mixed and used as template for a third amplification using pBinPlus.2613c (SEQ ID NO: 77) and LC-05-1.110r (SEQ ID NO: 80) as primers. Resulting fragment is digested with PacI and ApaI and cloned into pBD-05-1LC digested with the same enzyme. The sequence of the expression cassette generated, named 828, is presented in
Assembly of SpPDI-H1 A/New Caledonia/20/99 in CPMV-HT expression cassette (construct number 580).
[0393] A sequence encoding alfalfa PDI signal peptide fused to HA0 from H1 A/New Caledonia/20/99 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream of initial ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-SpPDI.c (SEQ ID NO: 95) and StuI-H1(A-NC).r (SEQ ID NO: 96) using construct number 540 (SEQ ID NO:61;
Assembly of H5 A/Indonesia/5/2005 in CPMV-HT Expression Cassette (Construct Number 685).
[0394] The coding sequence of H5 from A/Indonesia/5/2005 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-H5 (A-Indo).1c (SEQ ID NO: 98) and H5 (A-Indo)-StuI.1707r (SEQ ID NO: 99) using construct number 660 (SEQ ID NO:60;
Assembly of SpPDI-H5 A/Indonesia/5/2005 in CPMV-HT Expression Cassette (Construct Number 686).
[0395] A sequence encoding alfalfa PDI signal peptide fused to HA0 from H5 A/Indonesia/5/2005 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-SpPDI.c (SEQ ID NO: 95) and H5 (A-Indo)-StuI.1707r (SEQ ID NO: 99) using construct number 663 (SEQ ID NO: 83) as template. Resulting fragment was digested with ApaI and StuI restriction enzymes and cloned into construct number 828 (SEQ ID NO: 81) digested with the same enzymes. Resulting cassette was named construct number 686 (SEQ ID NO: 101).
Assembly of H1 A/Brisbane/59/2007 in CPMV-HT Expression Cassette (Construct Number 732).
[0396] The coding sequence of HA from H1 A/Brisbane/59/2007 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-H1B.c (SEQ ID NO: 102) and StuI-H1B.r (SEQ ID NO: 103) using construct number 774 (SEQ ID NO:62;
Assembly of SpPDI-H1 A/Brisbane/59/2007 in CPMV-HT Expression Cassette (Construct Number 733).
[0397] A sequence encoding alfalfa PDI signal peptide fused to HA0 from H1 A/Brisbane/59/2007 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-SpPDI.c (SEQ ID NO: 95) and StuI-H1B.r (SEQ ID NO: 103) using construct number 787 (SEQ ID NO: 86) as template. Resulting fragment was digested with ApaI and StuI restriction enzymes and cloned into construct number 828 (SEQ ID NO: 81) digested with the same enzymes. Resulting cassette was named construct number 733 (SEQ ID NO: 105).
Assembly of H3 A/Brisbane/10/2007 in CPMV-HT Expression Cassette (Construct Number 735).
[0398] The coding sequence of HA from H3 A/Brisbane/10/2007 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-H3B.c (SEQ ID NO:106) and StuI-H3B.r (SEQ ID NO: 107) using construct number 776 (SEQ ID NO:69) as template. Resulting fragment was digested with ApaI and StuI restriction enzymes and cloned into construct number 828 (SEQ ID NO: 81) digested with the same enzymes. Resulting cassette was named construct number 735 (SEQ ID NO: 108).
Assembly of SpPDI-H3 A/Brisbane/10/2007 in CPMV-HT Expression Cassette (Construct Number 736).
[0399] A sequence encoding alfalfa PDI signal peptide fused to HA0 from H3 A/Brisbane/10/2007 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-SpPDI.c (SEQ ID NO:95) and StuI-H3B.r (SEQ ID NO: 107) using construct number 790 (SEQ ID NO:90) as template. Resulting fragment was digested with ApaI and StuI restriction enzymes and cloned into construct number 828 (SEQ ID NO: 81) digested with the same enzymes. Resulting cassette was named construct number 736 (SEQ ID NO:109).
Assembly of HA B/Florida/4/2006 in CPMV-HT Expression Cassette (Construct Number 738).
[0400] The coding sequence of HA from B/Florida/4/2006 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-HBF.c (SEQ ID NO: 110) and StuI-HBF.r (SEQ ID NO: 111) using construct number 779 (SEQ ID NO:73;
Assembly of SpPDI-HA B/Florida/4/2006 in CPMV-HT Expression Cassette (Construct Number 739).
[0401] A sequence encoding alfalfa PDI signal peptide fused to HA0 from B/Florida/4/2006 was cloned into CPMV-HT as follows. Restriction sites ApaI (immediately upstream ATG) and StuI (immediately downstream stop codon) were added to the hemagglutinin coding sequence by performing a PCR amplification with primers ApaI-SpPDI.c (SEQ ID NO: 95) and StuI-HBF.r (SEQ ID NO: 111) using construct number 798 (SEQ ID NO: 94) as template. Resulting fragment was digested with ApaI and StuI restriction enzymes and cloned into construct number 828 (SEQ ID NO: 81) digested with the same enzymes. Resulting cassette was named construct number 739 (SEQ ID NO: 113).
Assembly of Chaperone Expression Cassettes
[0402] Two heat shock protein (Hsp) expression cassettes were assembled. In a first cassette, expression of the Arabidopsis thaliana (ecotype Columbia) cytosolic HSP70 (Athsp70-1 in Lin et al. (2001) Cell Stress and Chaperones 6: 201-208) is controlled by a chimeric promoter combining elements of the alfalfa Nitrite reductase (Nir) and alfalfa Plastocyanin promoters (Nir/Plasto). A second cassette comprising the coding region of the alfalfa cytosolic HSP40 (MsJ1; Frugis et al. (1999) Plant Molecular Biology 40: 397-408) under the control of the chimeric Nir/Plasto promoter was also assembled.
[0403] An acceptor plasmid containing the alfalfa Nitrite reductase promoter (Nir), the GUS reporter gene and NOS terminator in plant binary vector was first assembled. Plasmid pNir3K51 (previously described in U.S. Pat. No. 6,420,548) was digested with HindIII and EcoRI. The resulting fragment was cloned into pCAMBIA2300 (Cambia, Canberra, Australia) digested by the same restriction enzyme to give pCAMBIA-Nir3K51.
[0404] Coding sequences for Hsp70 and Hsp40 were cloned separately in the acceptor plasmid pCAMBIANir3K51 by the PCR-based ligation method presented in Darveau et al. (Methods in Neuroscience 26:77-85 (1995)).
[0405] For Hsp40, Msj1 coding sequence (SEQ ID NO: 114) was amplified by RT-PCR from alfalfa (ecotype Rangelander) leaf total RNA using primers Hsp40Luz.1c (SEQ ID NO: 115) and Hsp40Luz-Sac1.1272r (SEQ ID NO: 116). A second amplification was performed with primers Plasto-443c (SEQ ID NO: 4;
[0406] A dual Hsp expression plasmid was assembled as follows. R860 was digested with BsrBI (downstream the NOS terminator), treated with T4 DNA polymerase to generate a blunt end, and digested with SbfI (upstream the chimeric NIR/Plasto promoter). The resulting fragment (Chimeric Nir/Plasto promoter-HSP70 coding sequence-Nos terminator) was cloned into R850 previously digested with SbfI and SmaI (both located in the multiple cloning site upstream chimeric Nir/Plasto promoter). The resulting plasmid, named R870, is presented in
Assembly of Other Expression Cassettes
Soluble H1 Expression Cassette
[0407] The cassette encoding the soluble form of H1 was prepared by replacing the region coding for the transmembrane domain and the cytoplasmic tail in 540 by a fragment encoding the leucine zipper GCN4 pII variant (Harbury et al, 1993, Science 1993; 262: 1401-1407). This fragment was synthesized with flanking KpnI and SacI sites to facilitate cloning. The plasmid resulting from this replacement was named 544 and the expression cassette is illustrated in
M1 A/Puerto Rico/8/34 Expression Cassette
[0408] A fusion between the tobacco etch virus (TEV) 5UTR and the open reading frame of the influenza A/PR/8/34 M1 gene (Acc. # NC_002016) was synthesized with a flanking SacI site added downstream of the stop codon. The fragment was digested with SwaI (in the TEV 5UTR) and SacI, and cloned into a 2X35S/TEV based expression cassette in a pCAMBIA binary plasmid. The resulting plasmid bore the M1 coding region under the control of a 2X35S/TEV promoter and 5UTR and the NOS terminator (construct 750;
HcPro Expression Cassette
[0409] An HcPro construct (35HcPro) was prepared as described in Hamilton et al. (2002). All clones were sequenced to confirm the integrity of the constructs. The plasmids were used to transform Agrobacteium tumefaciens (AGL1; ATCC, Manassas, Va. 20108, USA) by electroporation (Mattanovich et al., 1989). The integrity of all A. tumefaciens strains were confirmed by restriction mapping.
P19 Expression Cassette
[0410] The coding sequence of p19 protein of tomato bushy stunt virus (TBSV) was linked to the alfalfa plastocyanin expression cassette by the PCR-based ligation method presented in Darveau et al. (Methods in Neuroscience 26: 77-85 (1995)). In a first round of PCR, a segment of the plastocyanin promoter was amplified using primers Plasto-443c (SEQ ID NO: 4;
3. Preparation of Plant Biomass, Inoculum, Agroinfiltration, and Harvesting
[0411] Nicotiana benthamiana or Nicotiana tabacum plants were grown from seeds in flats filled with a commercial peat moss substrate. The plants were allowed to grow in the greenhouse under a 16/8 photoperiod and a temperature regime of 25 C. day/20 C. night. Three weeks after seeding, individual plantlets were picked out, transplanted in pots and left to grow in the greenhouse for three additional weeks under the same environmental conditions. Prior to transformation, apical and axillary buds were removed at various times as indicated below, either by pinching the buds from the plant, or by chemically treating the plant
[0412] Agrobacteria transfected with each construct were grown in a YEB medium supplemented with 10 mM 2-[N-morpholino]ethanesulfonic acid (MES), 20 M acetosyringone, 50 g/ml kanamycin and 25 g/ml of carbenicillin pH5.6 until they reached an OD.sub.600 between 0.6 and 1.6. Agrobacterium suspensions were centrifuged before use and resuspended in infiltration medium (10 mM MgCl.sub.2 and 10 mM MES pH 5.6). Syringe-infiltration was performed as described by Liu and Lomonossoff (2002, Journal of Virological Methods, 105:343-348). For vacuum-infiltration, A. tumefaciens suspensions were centrifuged, resuspended in the infiltration medium and stored overnight at 4 C. On the day of infiltration, culture batches were diluted in 2.5 culture volumes and allowed to warm before use. Whole plants of N. benthamiana or N. tabacum were placed upside down in the bacterial suspension in an air-tight stainless steel tank under a vacuum of 20-40 Torr for 2-min. Following syringe or vacuum infiltration, plants were returned to the greenhouse for a 4-5 day incubation period until harvest. Unless otherwise specified, all infiltrations were performed as co-infiltration with AGL1/35S-HcPro in a 1:1 ratio, except for CPMV-HT cassette-bearing strains which were co-infiltrated with strain AGL1/R472 in a 1:1 ratio.
4. Leaf Sampling and Total Protein Extraction
[0413] Following incubation, the aerial part of plants was harvested, frozen at 80 C., crushed into pieces. Total soluble proteins were extracted by homogenizing (Polytron) each sample of frozen-crushed plant material in 3 volumes of cold 50 mM Tris pH 7.4, 0.15 M NaCl, and 1 mM phenylmethanesulfonyl fluoride. After homogenization, the slurries were centrifuged at 20,000 g for 20 min at 4 C. and these clarified crude extracts (supernatant) kept for analyses. The total protein content of clarified crude extracts was determined by the Bradford assay (Bio-Rad, Hercules, Calif.) using bovine serum albumin as the reference standard.
5. Size Exclusion Chromatography of Protein Extract
[0414] Size exclusion chromatography (SEC) columns of 32 ml Sephacryl S-500 high resolution beads (S-500 HR: GE Healthcare, Uppsala, Sweden, Cat. No. 17-0613-10) were packed and equilibrated with equilibration/elution buffer (50 mM Tris pH8, 150 mM NaCl). One and a half millilitre of crude protein extract was loaded onto the column followed by an elution step with 45 mL of equilibration/elution buffer. The elution was collected in fractions of 1.5 mL relative protein content of eluted fractions was monitored by mixing 10 L of the fraction with 200 L of diluted Bio-Rad protein dye reagent (Bio-Rad, Hercules, Calif. The column was washed with 2 column volumes of 0.2N NaOH followed by 10 column volumes of 50 mM Tris pH8, 150 mM NaCl, 20% ethanol. Each separation was followed by a calibration of the column with Blue Dextran 2000 (GE Healthcare Bio-Science Corp., Piscataway, N.J., USA). Elution profiles of Blue Dextran 2000 and host soluble proteins were compared between each separation to ensure uniformity of the elution profiles between the columns used.
6. Protein Analysis and Immunoblotting
[0415] Protein concentrations were determined by the BCA protein assay (Pierce Biochemicals, Rockport Ill.). Proteins were separated by SDS-PAGE under reducing conditions and stained with Coomassie Blue. Stained gels were scanned and densitometry analysis performed using ImageJ Software (NIH).
[0416] Proteins from elution fraction from SEC were precipitated with acetone (Bollag et al., 1996), resuspended in 1/5 volume in equilibration/elution buffer and separated by SDS-PAGE under reducing conditions and electrotransferred onto polyvinylene difluoride (PVDF) membranes (Roche Diagnostics Corporation, Indianapolis, Ind.) for immunodetection. Prior to immunoblotting, the membranes were blocked with 5% skim milk and 0.1% Tween-20 in Tris-buffered saline (TBS-T) for 16-18h at 4 C.
[0417] Immunoblotting was performed by incubation with a suitable antibody (Table 6), in 2 g/ml in 2% skim milk in TBS-Tween 20 0.1%. Secondary antibodies used for chemiluminescence detection were as indicated in Table 4, diluted as indicated in 2% skim milk in TBS-Tween 20 0.1%. Immunoreactive complexes were detected by chemiluminescence using luminol as the substrate (Roche Diagnostics Corporation). Horseradish peroxidase-enzyme conjugation of human IgG antibody was carried out by using the EZ-Link Plus Activated Peroxidase conjugation kit (Pierce, Rockford, Ill.). Whole, inactivated virus (WIV), used as controls of detection for H1, H3 and B subtypes, were purchased from National Institute for Biological Standards and Control (NIBSC).
TABLE-US-00008 TABLE 6 Electrophoresis conditions, antibodies, and dilutions for immunoblotting of expressed proteins. HA Electrophoresis Primary Secondary subtype Influenza strain condition antibody Dilution antibody Dilution H1 A/Brisbane/59/2007 Reducing FII 10-I50 4 g/ml Goat anti- 1:10 000 (H1N1) mouse (JIR 115-035-146) H1 A/Solomon Reducing NIBSC 1:2000 Rabbit anti- 1:10 000 Islands/3/2006 07/104 sheep (JIR (H1N1) 313-035-045) H1 A/New Reducing FII 10-150 4 g/ml Goat anti- 1:10 000 Caledonia/20/99 mouse (JIR (H1N1) 115-035-146) H2 A/Singapore/1/57 Non-reducing NIBSC 1:1000 Rabbit anti- 1:10 000 (H2N2) 00/440 sheep (JIR 313-035-045) H3 A/Brisbane/10/2007 Non-Reducing TGA 1:4000 Rabbit anti- 1:10 000 (H3N2) AS393 sheep (JIR 313-035-045) H3 A/Brisbane/10/2007 Non-Reducing NIBSC 1:1000 Rabbit anti- 1:10 000 (H3N2) 08/136 sheep (JIR 313-035-045) H3 A/Wisconsin/67/ Non-Reducing NIBSC 1:1000 Rabbit anti- 1:10 000 2005 (H3N2) 05/236 sheep (JIR 313-035-045) H5 A/Indonesia/5/2005 Reducing ITC 1:4000 Goat anti- 1:10 000 (H5N1) IT-003- rabbit (JIR 005V 111-035-144) H5 A/Anhui/1/2005 Reducing NIBSC 1:750 Rabbit anti- 1:10 000 (H5N1) 07/338 sheep (JIR 313-035-045) H5 A/Vietnam/1194/ Non-reducing ITC IT-003- 1:2000 Goat anti- 1:10 000 2004 (H5N1) 005 rabbit (JIR 111-035-144) H6 A/Teal/Hong Non-reducing BEI NR 1:500 Rabbit anti- 1:10 000 Kong/W312/97 663 sheep (JIR (H6N1) 313-035-045) H7 A/Equine/Prague/ Non-reducing NIBSC 1:1000 Rabbit anti- 1:10 000 56 (H7N7) 02/294 sheep (JIR 313-035-045) H9 A/Hong Reducing NIBSC 1:1000 Rabbit anti- 1:10 000 Kong/1073/99 07/146 sheep (JIR (H9N2) 313-035-045) B B/Malaysia/2506/ Non-Reducing NIBSC 1:2000 Rabbit anti- 1:10 000 2004 07/184 sheep (JIR 313-035-045) B B/Florida/4/2006 Non-Reducing NIBSC 1:2000 Rabbit anti- 1:10 000 07/356 sheep (JIR 313-035-045) FII: Fitzgerald Industries International, Concord, MA, USA; NIBSC: National Institute for Biological Standards and Control; JIR: Jackson ImmunoResearch, West Grove, PA, USA; BEI NR: Biodefense and emerging infections research resources repository; ITC: Immune Technology Corporation, Woodside, NY, USA; TGA: Therapeutic Goods Administration, Australia.
[0418] Hemagglutination assay for H5 was based on a method described by Nayak and Reichl (2004). Briefly, serial double dilutions of the test samples (100 L) were made in V-bottomed 96-well microtiter plates containing 100 L PBS, leaving 100 L of diluted sample per well. One hundred microliters of a 0.25% turkey red blood cells suspension (Bio Link Inc., Syracuse, N.Y.) were added to each well, and plates were incubated for 2h at room temperature. The reciprocal of the highest dilution showing complete hemagglutination was recorded as HA activity. In parallel, a recombinant HA standard (A/Vietnam/1203/2004 H5N1) (Protein Science Corporation, Meriden, Conn.) was diluted in PBS and run as a control on each plate.
7. Sucrose Gradient Ultracentrifugation
[0419] One milliliter of fractions 9, 10 and 11 eluted from the gel filtration chromatography on H5-containing biomass were pooled, loaded onto a 20-60% (w/v) discontinuous sucrose density gradient, and centrifuged 17.5 h at 125 000 g (4 C.). The gradient was fractionated in 19 3-mL fractions starting from the top, and dialyzed to remove sucrose prior to immunological analysis and hemagglutination assays.
8. Electron Microscopy
[0420] One hundred microliters of the samples to be examined were placed in an Airfuge ultracentrifugation tube (Beckman Instruments, Palo Alto, Calif., USA). A grid was placed at the bottom of the tube which was then centrifuged 5 min at 120 000 g. The grid was removed, gently dried, and placed on a drop of 3% phosphotungstic acid at pH 6 for staining. Grids were examined on a Hitachi 7100 transmission electron microscope (TEM) (for images in
[0421] For images in
9. Plasma Membrane Lipid Analysis
[0422] Plasma membranes (PM) were obtained from tobacco leaves and cultured BY2 cells after cell fractionation according to Mongrand et al. by partitioning in an aqueous polymer two-phase system with polyethylene glycol 3350/dextran T-500 (6.6% each). All steps were performed at 4 C.
[0423] Lipids were extracted and purified from the different fractions according to Bligh and Dyer. Polar and neutral lipids were separated by monodimensional HP-TLC using the solvent systems described in Lefebvre et al. Lipids of PM fractions were detected after staining with copper acetate as described by Macala et al. Lipids were identified by comparison of their migration time with those of standards (all standards were obtained from Sigma-Aldrich, St-Louis, Mo., USA, except for SG which was obtained from Matreya, Pleasant Gap, Pa., USA).
10. H5 VLP (A/Indonesia/5/2005) Purification
[0424] Frozen 660-infiltrated leaves of N. benthamiana were homogenized in 1.5 volumes of 50 mM Tris pH 8, NaCl 150 mM and 0.04% sodium meta-bisulfite using a commercial blender. The resulting extract was supplemented with 1 mM PMSF and adjusted to pH 6 with 1 M acetic acid before being heated at 42 C. for 5 min. Diatomaceous earth (DE) was added to the heat-treated extract to adsorb the contaminants precipitated by the pH shift and heat treatment, and the slurry was filtered through a Whatman paper filter. The resulting clarified extract was centrifuged at 10,000g for 10 minutes at RT to remove residual DE, passed through 0.8/0.2 m Acropack 20 filters and loaded onto a fetuin-agarose affinity column (Sigma-Aldrich, St-Louis, Mo., USA). Following a wash step in 400 mM NaCl, 25 mM Tris pH 6, bound proteins were eluted with 1.5 M NaCl, 50 mM MES pH 6. Eluted VLP were supplemented with Tween-80 to a final concentration of 0.0005% (v/v). VLP were concentrated on a 100 kDa MWCO Amicon membrane, centrifuged at 10,000g for 30 minutes at 4 C. and resuspended in PBS pH 7.4 with 0.01% Tween-80 and 0.01% thimerosal. Suspended VLPs were filter-sterilized before use.
11. Animal Studies
Mice
[0425] Studies on the immune response to influenza VLP administration were performed with 6-8 week old female BALB/c mice (Charles River Laboratories). Seventy mice were randomly divided into fourteen groups of five animals. Eight groups were used for intramuscular immunization and six groups were used to test intranasal route of administration. All groups were immunized in a two-dose regiment, the boost immunization being done 3 weeks following the first immunization.
[0426] For intramuscular administration in hind legs, unanaesthetized mice were immunized with either the plant-made H5 VLP (A/Indonesia/5/2005 (H5N1) vaccine (0.1, 1, 5 or 12 g), or a control hemagglutinin (H5) antigen. The control H5 comprised recombinant soluble hemagglutinin produced based on strain A/Indonesia/5/05 H5N1 and purified from 293 cell culture (Immune Technology Corp., New York, USA) (used at 5 g per injection unless otherwise indicated). Buffer control was PBS. This antigen consists of amino acids 18-530 of the HA protein, and has a His-tag and a modified cleavage site. Electron microscopy confirmed that this commercial product is not in the form of VLPs.
[0427] To measure the effect of adjuvant, two groups of animals were immunized with 5 g plant-made VLP H5 vaccine plus one volume Alhydrogel 2% (alum, Accurate Chemical & Scientific Corporation, Westbury, N.Y., US) or with 5 g recombinant hemagglutinin purified from 293 cell culture plus 1 volume alum. Seventy mice were randomly divided into fourteen groups of five animals. Eight groups were used for intramuscular immunization and six groups were used to test intranasal route of administration. All groups were immunized according to a prime-boost regimen, the boost immunization performed 3 weeks following the first immunization.
[0428] For intramuscular administration in hind legs, unanaesthetized mice were immunized with the plant-made H5 VLP (0.1, 1, 5 or 12 g), or the control hemagglutinin (HA) antigen (5 g) or PBS. All antigen preparations were mixed with Alhydrogel 1% (alum, Accurate Chemical & Scientific Corporation, Westbury, N.Y., US) in a 1:1 volume ratio prior to immunizations. To measure the effect of adjuvant, two groups of animals were immunized with either 5 g plant-made VLP H5 vaccine or with 5 g of control HA antigen without any adjuvant.
[0429] For intranasal administration, mice were briefly anaesthetized by inhalation of isoflurane using an automated induction chamber. They were then immunized by addition of 4 l drop/nostril with the plant-made VLP vaccine (0.1 or 1 g), or with control HA antigen (1 g) or with PBS. All antigen preparations were mixed with chitosan glutamate 1% (Protosan, Novamatrix/FMC BioPolymer, Norway) prior to immunizations. The mice then breathed in the solutions. To verify the effect of adjuvant with the intranasal route of administration, two groups of animals were immunized with 1 g plant-made VLP H5 vaccine or with 1 g control HA antigen.
Ferrets
[0430] Ten groups of 5 ferrets (male, 18-24 weeks old, mass of approx 1 kg) were used. Treatment for each group is as described in Table 7. The adjuvant used was Alhydrogel (alum) (Superfos Biosector, Denmark) 2% (final=1%). Vaccine composition was membrane-associated A/Indonesia/5/05 (H5N1) VLPs produced as described. The vaccine control (positive control) was a fully glycosylated membrane-bound recombinant H5 from Indonesia strain produced using adenovirus in 293 cell culture by Immune Technology Corporation (ITC).
TABLE-US-00009 TABLE 7 Treatment groups Product injected to Route of Group n animals administration Adjuvant 1 5 PBS (negative control) i.m.* 2 5 Vaccine-plant, 1 g i.m. 3 5 Vaccine-plant, 1 g i.m. Alum 4 5 Vaccine-plant, 5 g i.m. 5 5 Vaccine-plant, 5 g i.m. Alum 6 5 Vaccine-plant, 7.5 g i.m. 7 5 Vaccine-plant, 15 g i.m. 8 5 Vaccine-plant, 15 g i.m. Alum 9 5 Vaccine-plant, 30 g i.m. 10 5 Vaccine-control, 5 g i.m. *i.m.: intramuscular
[0431] Ferrets were assessed for overall health and appearance (body weight, rectal temperature, posture, fur, movement patterns, breathing, excrement) regularly during the study. Animals were immunized by intramuscular injection (0.5-1.0 total volume) in quadriceps at day 0, 14 and 28; for protocols incorporating adjuvant, the vaccine composition was combined with Alhydrogel immediately prior to immunization in a 1:1 volume ratio). Serum samples were obtained on day 0 before immunizing, and on day 21 and 35. Animals were sacrificed (exsanguination/cardiac puncture) on days 40-45, and spleens were collected and necropsy performed.
[0432] Anti-influenza antibody titres may be quantified in ELISA assays using homologous or heterologous inactivated H5N1 viruses.
[0433] Hemagglutination inhibitory antibody titers of serum samples (pre-immune, day 21 and day 35) were evaluated by microtiter HAI as described (Aymard et al 1973). Briefly, sera were pretreated with receptor-destroying enzyme, heat-inactivated and mixed with a suspension of erythrocytes (washed red blood cells-RBC). Horse washed RBC (10%) from Lampire are recommended and considering that the assay may vary depending of the source of the RBC (horse-dependant), washed RBCs from 10 horses have been tested to select the most sensitive batch. Alternately, turkey RBC may be used. Antibody titer was expressed as the reciprocal of the highest dilution which completely inhibits hemagglutination.
[0434] Cross-reactive HAI titers: HAI titers of ferrets immunized with a vaccine for the A/Indonesia/5/05 (clade 2.1) were measured using inactivated H5N1 influenza strains from another subclade or clade such as the clade 1 Vietnam strains A/Vietnam/1203/2004 and A/Vietnam/1194/2004 or the A/Anhui/01/2005 (subclade 2.3) or the A/turkey/Turkey/1/05 (subclade 2.2). All analyses were performed on individual samples.
[0435] Data analysis: Statistical analysis (ANOVA) were performed on all data to establish if differences between groups are statistically significant.
Experimental Design for Lethal Challenge (Mice)
[0436] One hundred twenty eight mice were randomly divided into sixteen groups of eight animals, one group being unimmunized and not challenged (negative control). All groups were immunized via intramuscular administration in a two-dose regimen, the second immunization being done 2 weeks following the first immunization.
[0437] For intramuscular administration in hind legs, unanaesthetized mice were immunized with the plant-made H5 VLP (1, 5 or 15 g), or 15 g of control HA antigen or PBS. All antigen preparations were mixed with one volume of Alhydrogel 1% prior to immunizations (alum, Accurate Chemical & Scientific Corporation, Westbury, N.Y., US).
[0438] During the immunization period, mice were weighted once a week and observation and monitored for local reactions at the injection site.
[0439] Twenty two days following the second immunization, anesthetized mice were challenged intranasally (i.n.) into a BL4 containment laboratory (P4-Jean Mrieux-INSERM, Lyon, France) with 4.0910.sup.6 50% cell culture infective dose (CCID50) of influenza A/Turkey/582/06 virus (kindly provided by Dr. Bruno Lina, Lyon University, Lyon, France). Following challenge, mice were observed for ill clinical symptoms and weighed daily, over a fourteen day period. Mice with severe infection symptoms and weight loss of 25% were euthanized after anaesthesia.
Blood Collection, Lung and Nasal Washes and Spleen Collection
[0440] Lateral saphenous vein blood collection was performed fourteen days after the first immunization and fourteen days after second immunization on unanaesthetized animal. Serum was collected by centrifugation at 8000 g for 10 min.
[0441] Four weeks after second immunisation, mice were anaesthetized with CO.sub.2 gas and immediately upon termination, cardiac puncture was used to collect blood.
[0442] After final bleeding, a catheter was inserted into the trachea towards the lungs and one ml of cold PBS-protease inhibitor cocktail solution was put into a 1 cc syringe attached to the catheter and injected into the lungs and then removed for analysis. This wash procedure was performed two times. The lung washes were centrifuged to remove cellular debris. For nasal washes, a catheter was inserted towards the nasal area and 0.5 ml of the PBS-protease inhibitor cocktail solution was pushed through the catheter into the nasal passages and then collected. The nasal washes were centrifuged to remove cellular debris. Spleen collection was performed on mice immunized intramuscularly with 5 g of adjuvanted plant-made vaccine or 5 g adjuvanted recombinant H5 antigen as well as on mice immunized intranasaly with 1 g of adjuvanted plant-made vaccine or 1 g adjuvanted recombinant H5 antigen. Collected spleens were placed in RPMI supplemented with gentamycin and mashed in a 50 ml conical tube with plunger from a 10 ml syringe. Mashed spleens were rinsed 2 times and centrifuged at 2000 rpm for 5 min and resuspended in ACK lysing buffer for 5 min at room temperature. The splenocytes were washed in PBS-gentamycin, resuspended in 5% RPMI and counted. Splenocytes were used for proliferation assay.
Antibody Titers
[0443] Anti-influenza antibody titers of sera were measured at 14 days after the first immunization as well as 14 and 28 days after the second immunisation. The titer were determined by enzyme-linked immunosorbent assay (ELISA) using the inactivated virus A/Indonesia/5/05 as the coating antigen. The end-point titers were expressed as the reciprocal value of the highest dilution that reached an OD value of at least 0.1 higher than that of negative control samples.
[0444] For antibody class determination (IgG1, IgG2a, IgG2b, IgG3, IgM), the titers were evaluated by ELISA as previously described.
Hemagglutination Inhibition (HI) Titers
[0445] Hemagglutination inhibition (HI) titers of sera were measured at 14 and 28 days after the second immunisation as previously described (WHO 2002; Kendal 1982). Inactivated virus preparations from strains A/Indonesia/5/05 or A/Vietnam/1203/2004 were used to test mouse serum samples for HI activity. Sera were pre-treated with receptor-destroying enzyme II (RDE II) (Denka Seiken Co., Tokyo, Japan) prepared from Vibrio cholerae (Kendal 1982). HI assays were performed with 0.5% turkey red blood cells. HI antibody titres were defined as the reciprocal of the highest dilution causing complete inhibition of agglutination.
EXAMPLES
Example 1: Transient Expression of Influenza Virus A/Indonesia/5/05 (H5N1) Hemagglutinin by Agroinfiltration in N. benthamiana Plants
[0446] The ability of the transient expression system to produce influenza hemagglutinin was determined through the expression of the H5 subtype from strain A/Indonesia/5/05 (H5N1). As presented in
[0447] N. benthamiana plants were infiltrated with AGL1/660, and the leaves were harvested after a six-day incubation period. To determine whether H5 accumulated in the agroinfiltrated leaves, protein were first extracted from infiltrated leaf tissue and analyzed by Western blotting using anti-H5 (Vietnam) polyclonal antibodies. A unique band of approximately 72 kDa was detected in extracts (
[0448] The formation of active HA trimers was demonstrated by the capacity of crude protein extracts from AGL1/660-transformed leaves to agglutinate turkey red blood cells (data not shown).
Example 2: Characterization of Hemagglutinin-Containing Structures in Plant Extracts Using Size Exclusion Chromatography
[0449] The assembly of plant-produced influenza hemagglutinin into high molecular weight structures was assessed by gel filtration. Crude protein extracts from AGL1/660-infiltrated plants (1.5 mL) were fractionated by size exclusion chromatography (SEC) on Sephacryl S-500 HR columns (GE Healthcare Bio-Science Corp., Piscataway, N.J., USA). Elution fractions were assayed for their total protein content and for HA abundance using immunodetection with anti-HA antibodies (
[0450] A second expression cassette was assembled with the H1 nucleic acid sequence from A/New Caledonia/20/99 (H1N1) (SEQ ID NO: 33;
[0451] Protein extracts from plants infiltrated with AGL1/540 or AGL1/544 were fractionated by SEC and the presence of H1 eluted fractions was examined by Western blotting with anti-influenza A antibodies (Fitzgerald, Concord, Mass., USA). In AGL1/540-infiltrated leaves, H1 accumulated mainly as a very high molecular weight structure, with the peak was skewed toward smaller size structures (H1;
[0452] To evaluate the impact of M1 co-expression on hemagglutinin assembly into structure, a M1 expression cassette was assembled using the nucleic acid corresponding to the coding sequence of the A/PR/8/34 (H1N1) M1 (SEQ ID NO: 35;
Example 3: Isolation of H5 Structures by Centrifugation in Sucrose Gradient and Observation Under Electron Microscopy
[0453] The observation of hemagglutinin structure under electron microscopy (EM) required a higher concentration and purity level than that obtained from SEC on crude leaf protein extracts. To allow EM observation of H5 structures, a crude leaf protein extract was first concentrated by PEG precipitation (20% PEG) followed by resuspension in 1/10 volumes of extraction buffer. The concentrated protein extract was fractionated by S-500 HR gel filtration and elution fractions 9, 10, and 11 (corresponding to the void volume of the column) were pooled and further isolated from host proteins by ultracentrifugation on a 20-60% sucrose density gradient. The sucrose gradient was fractionated starting from the top and the fractions were dialysed and concentrated on a 100 NMWL centrifugal filter unit prior to analysis. As shown on the Western blots and hemagglutination results (FIG. 14A), H5 accumulated mainly in fractions 16 to 19 which contained 60% sucrose, whereas most of the host proteins peaked at fraction 13. Fractions 17, 18, and 19 were pooled, negatively stained, and observed under EM. Examination of the sample clearly demonstrated the presence of spiked spheric structures ranging in size from 80 to 300 nm which matched the morphological characteristics of influenza VLPs (
Example 4: Purification of Influenza H5 VLPs from Plant Biomass
[0454] In addition to an abundant content of soluble proteins, plant leaf extracts contain a complex mixture of soluble sugars, nucleic acids and lipids. The crude extract was clarified by a pH shift and heat treatment followed by filtration on diatomaceous earth (see Material and method section for a detailed description of the clarification method).
[0455] Influenza H5 VLPs were purified from these clarified extracts by affinity chromatography on a fetuin column. A comparison of the load fraction (
[0456] The purification procedure resulted in over 75% purity in H5, as determined by densitometry on the Coomassie Blue stained SDS-PAGE gel (
[0457] As shown in
[0458] The bioactivity of HA VLPs was confirmed by their capacity to agglutinate turkey red blood cells (data not shown).
[0459]
[0460] VLPs were formulated for immunization of mice by filtering through a 0.22 m filter; endotoxin content was measured using the endotoxin LAL (Limulus Amebocyte Lysate) detection kit (Lonza, Walkserville, Miss., USA). The filtered vaccine contained 105.811.6% EU/ml (endotoxin units/ml).
Example 5: Localization of Influenza VLPs in Plants
[0461] To localize the VLPs and confirm their plasma membrane origin, thin leaf sections of H5-producing plants were fixed and examined under TEM after positive staining. Observation of leaf cells indicated the presence of VLPs in extracellular cavities formed by the invagination of the plasma membrane (
Example 6: Plasma Membrane Lipid Analysis
[0462] Further confirmation of the composition and origin of the plant influenza VLPs was obtained from analyses of the lipid content. Lipids were extracted from purified VLPs and their composition was compared to that of highly purified tobacco plasma membranes by high performance thin layer chromatography (HP-TLC). The migration patterns of polar and neutral lipids from VLPs and control plasma membranes were similar. Purified VLPs contained the major phospholipids (phosphatidylcholine and phosphatidylethanolamine) and sphingolipids (glucosyl-ceramide) found in the plasma membrane (
Example 7: Immunogenicity of the H5 VLPs and Effect of Route of Administration
[0463] Mice were administered plant-made H5 VLPs by intramuscular injection, or intranasal (inhalation). 0.1 to 12 ug of VLPs were injected intramuscularly into mice, with alum as an adjuvant, according to the described methods. Peak antibody titers were observed with the lowest antigen quantity, in a similar magnitude to that of 5 ug recombinant, soluble hemagglutinin (H5) (
[0464] 0.1 to 1 ug plant-made H5 VLPs were administered intranasally with a chitosan adjuvant provided for an antibody response greater than that of the recombinant soluble H5 with an alum adjuvant (
[0465] For both administration routes, and over a range of antigen quantities, seroconversion was observed in all of the mice tested. Recombinant H5 soluble antigen conferred low (<1/40) or negligible (1<1/10 for the non-adjuvanted recombinant H5) HI titres.
Example 8: Hemagglutination-Inhibition Antibody Titer (HAI) H5 VLP
[0466]
[0467] HAI response following intranasal administration was significantly increased in mice administered plant-made H5 VLPs (1.0 or 0.1 ug) compared to those administered 1 ug recombinant soluble H5, which was similar to the negative control. All mice immunized by intramuscular injection of H5 VLPs (from 0.1 to 12 g) had higher HAI titers than mice immunised with the control H5 antigen (
[0468] When administered intramuscularly, all doses of VLPs induced high level of antibodies capable of binding homologous whole inactivated viruses (
[0469] The immunogenicity of the plant-derived influenza VLPs was then investigated through a dose-ranging study in mice. Groups of five BALB/c mice were immunized intramuscularly twice at 3-week intervals with 0.1 g to 12 g of VLPs containing HA from influenza A/Indonesia/5/05 (H5N1) formulated in alum (1:1 ratio). Hemagglutination-inhibition titers (HI or HAI), using whole inactivated virus antigen (A/Indonesia/5/05 (H5N1)), were measured on sera collected 14 days after the second immunization. Immunization with doses of VLP as low as 0.1 g induced the production of antibodies that inhibited viruses from agglutinating erythrocytes at high dilutions (
[0470] For both administration routes, and over a range of antigen quantities, the HAI response is superior in mice administered VLPs.
Example 9: Effect of Adjuvant on Immunogenicity of H5 VLPs
[0471] Plant-made H5 VLPs have a plasma membrane origin (
[0472] Plant-made H5 VLPs were administered intramuscularly (
[0473] Alum enhanced the mean level of HAI titers by a factor of 5 for intramuscular administration of VLP (
Example 10: Antibody Isotypes
[0474] Mice administered plant-made H5 VLPs or recombinant soluble H5 in the presence or absence of alum as an added adjuvant demonstrate a variety of immunoglobulin isotypes (
[0475] In the presence of an added adjuvant, the antibody isotype profiles of VLPs and the recombinant H5 are similar, with IgG1 being the dominant isotype. When VLPs or recombinant H5 are administered without an added adjuvant, IgG1 response is reduced, but remains the dominant isotype response to VLPs, with IgM, IgG2a, IgG2B and IgG3 maintaining similar titers as in the presence of an added adjuvant. IgG1, IgG2a, and IgG2b titers are markedly reduced when recombinant H5 is administered without an added adjuvant (
[0476] These data, therefore, demonstrate that plant-made VLPs do not require an added adjuvant to elicit a antibody response in a host.
[0477] Antibody titers against whole inactivated influenza virus strains (A/Indonesia/5/05; A/Vietnam/1203/04)I in mice administered plant-made VLPs or soluble recombinant HA intramuscularly in the presence of an added antigen are illustrated in
Example 11: Cross-Reactivity of Serum Antibodies Induced by the H5 VLP Vaccine
[0478] Cross-reactivity of serum antibodies induced by H5 VLP was assessed against whole inactivated influenza viruses of different strains. All VLP doses (from 0.1 to 12 g) as well as 5 g of control HA antigen induced high binding antibody titers against a clade 1 strain (A/Vietnam/1194/04), the homologous strain A/Indonesia/5/05 of clade 2.1, and a clade 2.2 strain A/turkey/Turkey/1/05 (
[0479] However, only the plant-made VLP induced HAI titer against the A/turkey/Turkey/1/05 strain (
Example 12: Cross-Protection Conferred by Immunization with Plant-Made H5 VLP
[0480] Mice that previously had been administered a two-dose regimen of A/Indonesia/5/05 H5 VLPs as described, were subsequently challenged intranasally with influenza A/Turkey/582/06 (H5N1) (Turkey H5N1) infectious virus, and observed. The dose administered, per animal, was 10 LD.sub.50 (4.0910.sup.5 CCID.sub.50).
[0481] By 7 days post-challenge, only 37.5% of the mice administered the PBS vaccine control had survived exposure to Turkey H5N1 (
[0482] Body mass of the mice was also monitored during the experiment, and the average mass of the surviving mice plotted (
[0483] These data, therefore, demonstrate that plant-made influenza VLPs comprising the H5 hemagglutinin viral protein induce an immune response specific for pathogenic influenza strains, and that virus-like particles may bud from a plant plasma membrane.
[0484] These data, therefore, demonstrate that plants are capable of producing influenza virus-like particles, and also for the first time, that virus-like particles can bud from a plant plasma membrane.
[0485] Further, using the current transient expression technology, a first antigen lot was produced only 16 days after the sequence of the target HA was obtained. Under the current yields for H5 VLPs, and at an exemplary dose of 5 g per subject, each kg of infiltrated leaf may produce 20,000 vaccine doses. This unique combination of platform simplicity, surge capacity and powerful immunogenicity provides for, among other embodiments, a new method response in the context of a pandemic.
Example 13: Characterization of Hemagglutinin-Containing (H1, H2, H3, H5, H6 and H9) Structures in Plant Extracts Using Size Exclusion Chromatography
[0486] The assembly of plant-produced influenza hemagglutinin of different subtypes into high molecular weight structures was assessed by gel filtration. Crude or concentrated protein extracts from AGL1/660-, AGL1/540-, AGL1/783-, AGL1/780-, AGL1/785- and AGL1/790-infiltrated plants (1.5 mL) were fractionated by size exclusion chromatography (SEC) on Sephacryl S-500 HR columns (GE Healthcare Bio-Science Corp., Piscataway, N.J., USA). As shown in
Example 14: Transient Expression of Seasonal Influenza Virus Hemagglutinin by Agroinfiltration in N. benthamiana Plants Using the Wild-Type Nucleotide Sequence
[0487] The ability of the transient expression system to produce seasonal influenza hemagglutinins was determined through the expression of the H1 subtype from strains A/Brisbane/59/2007 (H1N1) (plasmid #774), A/New Caledonia/20/1999 (H1N1) (plasmid #540) and A/Solomon Islands/3/2006 (H1N1) (plasmid #775), of the H3 subtype from strains A/Brisbane/10/2007 (plasmid #776) and A/Wisconsin/67/2005 (plasmid #777) and of the B type from strains B/Malaysia/2506/2004 (Victoria lineage) (plasmid #778) and B/Florida/4/2006 (Yamagata lineage) (plasmid #779). The hemagglutinin gene coding sequences were first assembled in the plastocyanin expression cassettepromoter, 5UTR, 3UTR and transcription termination sequences from the alfalfa plastocyanin geneand the assembled cassettes were inserted into to a pCAMBIA binary plasmid. The plasmids were then transfected into Agrobacterium (AGL1), producing Agrobacterium strains AGL1/774, AGL1/540, AGL1/775, AGL1/776, AGL1/777, AGL1/778 and AGL1/779, respectively.
[0488] N. benthamiana plants were infiltrated with AGL1/774, AGL1/540, AGL1/775, AGL1/776, AGL1/777, AGL1/778 and AGL1/779 and the leaves were harvested after a six-day incubation period. To determine whether H1 accumulated in the agroinfiltrated leaves, protein was first extracted from infiltrated leaf tissue and analyzed by Western blotting using anti-HA antibodies (see Table 6 for the antibodies and conditions used for the detection of each HA subtype). For the HA from H1 strains, a unique band of approximately 72 kDa was detected in extracts (
Example 15: Transient Expression of Potential Pandemic Influenza Virus Hemagglutinin by Agroinfiltration in N. benthamiana Plants Using the Wild-Type Nucleotide Sequence
[0489] The ability of the transient expression system to produce potential influenza hemagglutinins was determined through the expression of the H5 subtype from strains A/Anhui/1/2005 (H5N1) (plasmid #781), A/Indonesia/5/2005 (H5N1) (plasmid #660) and A/Vietnam/1194/2004 (H5N1) (plasmid #782), the H2 subtype from strain A/Singapore/1/1957 (H2N2) (plasmid #780), the H6 from strain A/Teal/Hong Kong/W312/1997 (H6N1) (plasmid #783), the H7 for strain A/Equipe/Prague/1956 (H7N7) (plasmid #784) and finally H9 from strain A/Hong Kong/1073/1999 (H9N2) (plasmid #785). The hemagglutinin gene coding sequences were first assembled in the plastocyanin expression cassettepromoter, 5UTR, 3UTR and transcription termination sequences from the alfalfa plastocyanin geneand the assembled cassettes were inserted into to a pCAMBIA binary plasmid. The plasmids were then transfected into Agrobacterium (AGL1), producing Agrobacterium strains AGL1/781, AGL1/660, AGL1/782, AGL1/780, AGL1/783, AGL1/784 and AGL1/785.
[0490] N. benthamiana plants were infiltrated with AGL1/781, AGL1/660, AGL1/782, AGL1/780, AGL1/784 and AGL1/785, and the leaves were harvested after a six-day incubation period. To determine whether H5 accumulated in the agroinfiltrated leaves, protein was first extracted from infiltrated leaf tissue and analyzed by Western blotting using appropriate anti-HA antibodies (see Table 6 for the antibodies and conditions used for the detection of each HA subtype). A unique band of approximately 72 kDa was detected in extracts of plants transformed with H5 and H2 expression constructs (
Example 16: Transient Expression of H5 by Agroinfiltration in N. tabacum Plants
[0491] The ability of the transient expression system to produce influenza hemagglutinin in leaves of Nicotiana tabacum was analysed through the expression of the H5 subtype from strain A/Indonesia/5/2005 (H5N1) (plasmid #660). The hemagglutinin gene coding sequences were first assembled in the plastocyanin expression cassettepromoter, 5UTR, 3UTR and transcription termination sequences from the alfalfa plastocyanin geneand the assembled cassettes were inserted into to a pCAMBIA binary plasmid. The plasmids was then transfected into Agrobacterium (AGL1), producing strain AGL1/660.
[0492] N. tabacum plants were infiltrated with AGL1/660 and the leaves were harvested after a six-day incubation period. To determine whether H5 accumulated in the agroinfiltrated leaves, proteins were first extracted from infiltrated leaves and analyzed by Western blot using anti-H5 antibodies. A unique band of approximately 72 kDa was detected in extracts (
Example 17: Immunogenicity of Plant-Made H5N1 VLP Vaccine from A/Indonesia/5/05 (H5N1) in Ferrets
[0493] A dose escalation study in ferrets was performed to evaluate the immunogenicity of plant derived VLPs. In vitro cross-reactivity of serum antibody induced by the H5 VLP vaccine at 3 doses (1, 5 and 15 ug) was assessed by hemagglutination inhibition of three other H5N1 strainsA/turkey/Turkey/1/05 (clade 2.2), A/Vietnam/1194/04 (clade 1) and A/Anhui/5/05 (all whole, inactivated virus), using serum taken 14 days after the first dose of vaccine (
Example 18: Analysis of the Immunogenicity Results According to CHMP Criteria
[0494] The EMEA's Committee for Medicinal Products for Human Use (CHMP) (http://www.emea.europa.eu/htms/general/contacts/CHMP/CHMP.html) sets out three criteria (applied following the second dose) for vaccine efficacy: 1Number of seroconversion or significant increase in HI titers (4-fold) >40%; 2Mean geometric increase of at least 2.5; 3proportion of subjects achieving an HI titer of 1/40 should be at least 70%. Analysis of these criteria in the ferret model is shown in Tables 8-11. (*) is indicative of meeting or exceeding the CHMP criteria. A summary of cross-immunogenicity analysis in relation to CHMP criteria for licensure is shown in Table 12.
[0495] Animals were assessed daily for body weight, temperature and overall condition. No sign of sickness or discomfort was recorded during the study. Body weight and temperature was within normal ranges during the study. The vaccine was safe and tolerated by the animals.
TABLE-US-00010 TABLE 8 Data for homologous strain (A/Indonesia/5/05) Study group 1 g 5 g 15 g 5 g Day Criteria 1 g adjuvanted 5 g adjuvanted 7.5 g 15 g adjuvanted 30 g ITC 14 (post % 4-fold increase in HI titer 0% 100% 0% 100%* 20% 20% 80%* 0% 0% 1st inj.) Mean geometric increase 0% 7.6 0% 15.6* 1.3 1.2 11.2* 0% 0% % of HI titer of 1/40 0% 60% 0% 100%* 20% 0% 80%* 0% 0% Mean HI titer 38 78 56 35 (14 % 4-fold increase in HI titer 0% 100%* 0% 60%* 0% 0% 40%* 0% 0% days post Mean geometric increase 0% 10.8* 0% 5.9* 0.7 0% 4* 0% 0% boost) % of HI titer of 1/40 0% 100%* 0% 100%* 0% 0% 100%* 0% 0% Mean HI titer 411 465 217
TABLE-US-00011 TABLE 9 Data for heterologous strain (A/Vietnam/1194/04) Study group 1 g 5 g 15 g 5 g Day Criteria 1 g adjuvanted 5 g adjuvanted 7.5 g 15 g adjuvanted 30 g ITC 14 (post % 4-fold increase in HI titer 0% 0% 0% 1st inj.) Mean geometric increase 1.2 1.2 1.3 % of HI titer of 1/40 0% 0% 0% 35 (post % 4-fold increase in HI titer 60% 80%* 60% boost) Mean geometric increase 2.3 5.1* 1.78 % of HI titer of 1/40 0% 80%* 20%
TABLE-US-00012 TABLE 10 Data for heterologous strain (A/turkey/Turkey/1/05) Study group 1 g 5 g 15 g 5 g Day Criteria 1 g adjuvanted 5 g adjuvanted 7.5 g 15 g adjuvanted 30 g ITC 14 (post % 4-fold increase in HI titer 40% 20% 60% 1st inj.) Mean geometric increase 1.9 1.7 2.8 % of HI titer of 1/40 40% 20% 40% 35 (post % 4-fold increase in HI titer 80%* 100%* 80%* boost) Mean geometric increase 10.6* 20.8* 7.7* % of HI titer of 1/40 100%* 100%* 100%*
TABLE-US-00013 TABLE 11 Data for heterologous strain (A/Anhui/5/05) Study group 1 g 5 g 15 g 5 g Day Criteria 1 g adjuvanted 5 g adjuvanted 7.5 g 15 g adjuvanted 30 g ITC 14 (post % 4-fold increase in HI titer 40% 20% 80%* 1st inj.) Mean geometric increase 1.8 1.3 6.4* % of HI titer of 1/40 20% 20% 80%* 35 (post % 4-fold increase in HI titer 100%* 100%* 60%* boost) Mean geometric increase 11.8* 14.4* 3* % of HI titer of 1/40 100%* 80%* 80%*
TABLE-US-00014 TABLE 12 Summary of cross-immunogenicity analysis in relation to CHMP criteria for licensure. Study group 1 g 5 g 15 g Strain Criteria adjuvanted adjuvanted adjuvanted A/turkey/Turkey/1/05 % 4-fold increase in HI titer 80%* 100%* 80%* (clade 2.2 Mean geometric increase 10.6* 20.8* 7.7* % of HI titer of 1/40 100%* 100%* 100%* A/Anhui/1/05 (clade % 4-fold increase in HI titer 100%* 100%* 60%* 2.3) Mean geometric increase 11.8* 14.4* 3* % of HI titer of 1/40 100%* 80%* 80%* A/Vietnam/1194/04 % 4-fold increase in HI titer 60% 80%* 60% (clade 1) Mean geometric increase 2.3 7.1* 1.78 % of HI titer of 1/40 0% 80%* 20%
Example 19: Selection of Hemagglutinin Nucleotide Sequences
[0496] The nucleotide sequences of the HA were retrieved from an influenza sequence database (see URL: flu.lanl.gov), or the NCBI influenza virus resource (Bao et al., 2008. J. Virology 82(2): 596-601; see URL: ncbi.nlm.nih.gov/genomes/FLU/FLU.html). For several of the HA nucleic acid sequences, multiple entries are listed in the databases (Table 13). Some variation is associated primarily with the culture system (OriginMDCK, egg, unknown, viral RNA/clinical isolate); for example, the glycosylation site at position 194 (mature protein numbering) of the HA is absent when type B influenza virus is expressed in allantoic fluid of eggs (see also Chen et al., 2008). For some sequences, domains may be lacking (e.g. incomplete clones, sequencing artifacts, etc.). Domains and sub-domains of influenza hemagglutinin are discussed generally in the Descrition. Domains or subdomains of a first sequence may be combined with a domain from a second existing sequence e.g. the signal peptide of a first strain sequence may be combined with the balance of the hemagglutinin coding sequence from a second strain to provide a complete coding sequence.
TABLE-US-00015 TABLE 13 Variation in Influenza subtypes for selected HA coding sequences Sequence database Strain reference No. Origin SP HA1 HA2 DTm Divergence H1 A/Solomon ISDN231558 MDCK Y Y Y Y 189: R ou G, 220: K Islands/3/2006 (Vaccine rec.) (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon ISDN238190 Egg Y Y Y Y 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon EU100724 ? Y Y Y Y 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon ISDN220951 MDCK Y Y N N 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon ISDN220953 Egg Y Y N N 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon EU124137 Egg Y Y N N 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon EU124135 MDCK Y Y N N 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) A/Solomon EU124177 MDCK Y Y Y Y 189: R ou G, 220: K Islands/3/2006 (MDCK) T (Egg), 249: Q (MDCK) R (Egg), 550: L (MDCK) R (Egg) H1 A/Brisbane/59/2007 ISDN282676 MDCK Y Y Y 203: D/I/N D est le plus abondant chezles H1 A/Brisbane/59/ ISDN285101 Egg Y Y N N 203: D/I/N D est le 2007 plus abondant chezles H1 A/Brisbane/59/ ISDN285777 Egg Y Y Y Y 203: D/I/N D est le 2007 plus abondant chezles H1 A/Brisbane/59/ ISDN282677 Egg Y Y Y Y 203: D/I/N D est le 2007 plus abond ant chezles H1 H3 A/Brisbane/10/2007 ISDN274893 Egg Y Y Y Y 202: V/G, 210: L/P, 215: del Ala, 242: S/I A/Brisbane/10/ ISDN257648 MDCK N Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ ISDN256751 Egg Y Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ ISDN273757 Egg Y Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ ISDN273759 Egg Y Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ EU199248 Egg N Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ EU199366 Egg Y Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ ISDN257043 Egg N Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ EU199250 MDCK N Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ ISDN275357 Egg N Y N N 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I A/Brisbane/10/ ISDN260430 Egg N Y Y Y 202: V/G, 210: L/P, 2007 215: del Ala, 242: S/I H3 A/Wisconsin/67/ ISDN131464 ? N Y Y N 138: A/S 2005 (vaccine rec.) 156: H/Q 186: G/V 196: H/Y A/Wisconsin/67/ DQ865947 ? N Y partiel N 138: A/S 2005 156: H/Q 186: G/V 196: H/Y A/Wisconsin/67/ EF473424 ? N Y Y N 138: A/S 2005 156: H/Q 186: G/V 196: H/Y A/Wisconsin/67/ ISDN138723 Egg N Y Y Y 138: A/S 2005 156: H/Q 186: G/V 196: H/Y A/Wisconsin/67/ EF473455 Egg N Y Y Y 138: A/S 2005 156: H/Q 186: G/V 196: H/Y A/Wisconsin/67/ ISDN138724 ? N Y Y Y 138: A/S 2005 156: H/Q 186: G/V 196: H/Y B B/Malaysia/2506/ ISDN126672 Egg Y Y N N 120 K/N 2004 (vaccine rec.) 210 T/A B/Malaysia/2506/ EF566433 Egg Y Y N N 120 K/N 2004 210 T/A B/Malaysia/2506/ ISDN231265 Egg Y Y Y Y 120 K/N 2004 210 T/A B/Malaysia/2506/ ISDN231557 MDCK Y Y Y Y 120 K/N 2004 210 T/A B/Malaysia/2506/ EF566394 MDCK Y Y N N 120 K/N 2004 210 T/A B/Malaysia/2506/ EU124274 Egg Y Y Y Y 120 K/N 2004 210 T/A B/Malaysia/2506/ EU124275 MDCK Y Y Y Y 120 K/N 2004 210 T/A B/Malaysia/2506/ ISDN124776 MDCK Y Y N N 120 K/N 2004 210 T/A B B/Florida/4/2006 ISDN261649 Egg Y Y Y N lacking glycosylation site at position 211; 10 amino acids of DTm/cytoplasmic tail B/Florida/4/2006 EU100604 MDCK N Y N N B/Florida/4/2006 ISDN218061 MDCK N Y N N B/Florida/4/2006 ISDN285778 Egg Y Y Y Y Includes cytoplasmic tail B B/Brisbane/3/2007 ISDN256628 Egg N Y N N lacking glycosylation site at position 211 B/Brisbane/3/2007 ISDN263782 Egg Y Y Y Y lacking glycosylation site at position 211 B/Brisbane/3/2007 ISDN263783 MDCK Y Y Y Y H5 A/Viet ISDN38686 ? Y Y Y Y Nam/1194/2004 (Vaccine rec.) A/Viet AY651333 ? Y Y Y Y Nam/1194/2004 A/Viet EF541402 ? Y Y Y Y Nam/1194/2004 H5 A/Anhui1/1/2005 DQ37928 ? Y Y Y Y (vaccine rec.) A/Anhui1/1/2005 ISDN131465 Egg Y Y Y Y H7 A/Chicken/Italy/ AJ91720 ARN Y Y Y Y 13474/1999 gen H7 A/Equine/Prague/ AB298277 ? Y Y Y Y 152 (R/G) 56 (Lab 169 (T/I) reassortant) 208 (N/D) (glycosylation site abolished) A/Equine/Prague/ X62552 ? Y Y Y Y 56 H9 A/Hong AJ404626 ? Y Y Y Y Kong/1073/1999 A/Hong Kong/1073/1999 AB080226 ? N Y N N H2 A/Singapore/1/1957 AB296074 ? Y Y Y Y A/Singapore/1/ L20410 RNA Y Y Y Y 1957 A/Singapore/1/ L11142 ? Y Y Y Y 1957 H2 A/Japan/305/1957 L20406 ? Y Y Y Y A/Japan/305/1957 L20407 ? Y Y Y Y A/Japan/305/1957 CY014976 ? Y Y Y Y A/Japan/305/1957 AY209953 ? Y Y N N A/Japan/305/1957 J02127 ? Y Y Y Y A/Japan/305/1957 DQ508841 ? Y Y Y Y A/Japan/305/1957 AY643086 ? Y Y Y N A/Japan/305/1957 AB289337 ? Y Y Y Y A/Japan/305/1957 AY643085 ? Y Y Y Y A/Japan/305/1957 AY643087 Drug Y Y Y N resistant H6 A/Teal/Hong AF250479 Egg Y Y Y Y Kong/W312/1997 (H6N1) Y, N - Yes, No, respectively SP - presence of signal peptide sequence Y/N HA1 - complete HA1 domain Y/N HA2 - complete HA2 domain Y/N DTm - complete transmembrane domain Y/N
Strain: H1 from A/Solomon Islands/3/2006
[0497] Eight amino acid sequences were compared, and variations identified. (Table 14). Position 171 exhibited a variation of glycine (G) or arginine (R) in some sequences.
TABLE-US-00016 TABLE 14 A/Solomon Islands/3/2006 amino acid variation Amino acid #* MDCK Egg 212 K T 241 Q R 542 L R Numbering from the starting M
Strain: H1 from A/Brisbane/59/2007
[0498] Position 203 exhibited a variation of aspartic acid (D), isoleucine (I) or asparagine (N).
Strain: H3 from A/Brisbane/10/2007
[0499] Sequence variations were observed at 5 positions (Table 15). In position 215, a deletion is observed in two sampled sequences.
TABLE-US-00017 TABLE 15 H3 from A/Brisbane/10/2007 amino acid variation Origin 202, 210, 215, 235 242* ISDN274893 Egg V L Y I ISDN273759 Egg G P A S I EU199248 Egg G P A S I EU199366 Egg G P A S I ISDN273757 Egg V L S S ISDN257043 Egg G P A S I EU199250 MDCK G L A S I ISDN375357 Egg G P A S I ISDN260430 Egg G P A S I ISDN256751 Egg G P A S I ISDN257648 MDCK G P A S I *Numbering from the starting M
Strain: H3 from A/Wisconsin/67/2005
[0500] Sequence variations in this strain were observed at 4 positions (Table 16).
TABLE-US-00018 TABLE 16 H3 from A/Wisconsin/67/2005 amino acid variation Origin 138, 156, 186, 196 ISDN138724 Unknown A H G H DQ865947 Unknown S H V Y EF473424 Unknown A H G H ISDN138723 Egg S Q V Y ISDN131464 Unknown A H G H EF473455 Egg A H G H *Numbering from the mature protein
Strain: B from B/Malaysia/2506/2004
[0501] Variation at two positions is observed (Table 17). Position 120 is not a glycosylation site; position 210 is involved in glycosylation; this glycosylation is abolished following culture in eggs.
TABLE-US-00019 TABLE 17 Hemagglutinin from B/Malaysia/2506/2004 amino acid variation Amino acid #* MDCK Egg 120 K N 210 T A *Numbering from the middle of SP
Strain: Hemagglutinin from B/Florida/4/2006; ISDN261649
[0502] Observed variations include amino acid sequence variation at position 211, depending on the culture system. Asparatine (N) is found in sequences isolated from MDCK cells, while glutamic acid (D) is found in sequence isolated from eggs. Position 211 is a glycosylation site, and is abolished following culture in eggs.
Strain: H2 from A/Singapore/1/1957
[0503] Sequence variations were observed in 6 position s (Table 18).
TABLE-US-00020 TABLE 18 H2 from A/Singapore/1/1957 amino acid variation Amino acid No. Origin 166 168 199\ 236 238 358 L20410 Viral RNA K E T L S V L11142 Unknown E G K L S I AB296074 Unknown K G T Q G V Consensus K G T Q/L G V A/Japan/ 305/1957 .sup.1Numbering from the mature protein
Strains: H5 from A/Vietnam/1194/2004 and H5 from A/Anhui/1/2005
[0504] There were no variations observed in the amino acid sequence upon aligning the primary sequences of either of these H5 strains.
Strain: H6 from A/Teal/Hong Kong/W312/1997
[0505] Only one entry was available for strain (AF250179).
Strain: H7 from A/Equine/Prague/56
[0506] A total of 2 sequence entries were found in the databases. The entry AB298877 was excluded as it is a laboratory reassortant.
Strain: H9 from A/Hong Kong/1073/1999; AJ404626
[0507] A total of 2 sequence entries were found in the databases. Only one was complete.
Example 20. Transient Expression of Influenza Virus Hemagglutinin Fused to a Signal Peptide from a Plant Secreted Protein
[0508] The effect of signal peptide modification on HA accumulation level for other hemagglutinins was also investigated through the expression of the A subtype HAs from strains A/Brisbane/59/2007 (H1N1) (plasmid #787), A/New Caledonia/20/1999 (H1N1) (plasmid #540), from strains A/Brisbane/10/2007 (H3N2) (plasmid 790) and A/Indonesia/5/2005 (H5N1) (plasmid #663) and of the B type from strains B/Florida/4/2006 (plasmid #798) fused to the signal peptide (SP; nucleotides 32-103) from of alfalfa protein disulfide isomerase (PDI; accession No. Z11499; SEQ. ID. NO: 34;
[0509] N. benthamiana plants were infiltrated with AGL1/787, AGL1/540, AGL1/790, AGL1/663 and AGL1/798. In parallel, a series of plants was infiltrated with AGL1/774, AGL776, AGL1/660 and AGL1/779 for comparison purposes. Leaves were harvested after a six-day incubation period and proteins were extracted from infiltrated leaves and analyzed by Western blot using the appropriate anti-HA antibodies. The expression of HA from H1/Brisbane and H3/Brisbane were considerably improved using the SP from PDI compared to the expression observed for the same HAs with their native signal peptide (
Example 21. HA Expression Under the Control of CPMV-HT Expression Cassette
[0510] An expression cassette CPMV-HT (Sainsbury et al. 2008 Plant Physiology 148: 1212-1218; see also WO 2007/135480) comprising untranslated sequences from the Cowpea mosaic virus (CPMV) RNA2 was used for expression of some hemagglutinins in transgenic plants. HA from A/New Caledonia/20/1999 (H1), A/Brisbane/59/2007 (H1), A/Brisbane/10/2007 (H3), A/Indonesia/5/2005 (H5) and B/Florida/4/2006 (B) were expressed under the control of CPMV-HT in N. benthamiana plants, agroinfiltrated as described. After incubation, leaves were harvest, extracted and HA contents in protein extracts were compared by Western blot. As shown in
TABLE-US-00021 TABLE 19 Expression cassette used for expression of influenza hemagglutinins with native or PDI signal peptides. Agro HA Signal Expression strain expressed Peptide Cassette AGL1/540 H1 (A/New Caledonia/20/99) PDI Plastocyanin AGL1/580 H1 (A/New Caledonia/20/99) PDI CPMV-HT AGL1/774 H1 (A/Brisbane/59/2007) native Plastocyanin AGL1/787 H1 (A/Brisbane/59/2007) PDI Plastocyanin AGL1/732 H1 (A/Brisbane/59/2007) native CPMV-HT AGL1/776 H3 (A/Brisbane/10/2007) native Plastocyanin AGL1/790 H3 (A/Brisbane/10/2007) PDI Plastocyanin AGL1/735 H3 (A/Brisbane/10/2007) native CPMV-HT AGL1/736 H3 (A/Brisbane/10/2007) PDI CPMV-HT AGL1/660 H5 (A/Indonesia/5/2005) native Plastocyanin AGL1/685 H5 (A/Indonesia/5/2005) native CPMV-HT AGL1/779 B (B/Florida/4/2006) native Plastocyanin AGL1/798 B (B/Florida/4/2006) PDI Plastocyanin AGL1/738 B (B/Florida/4/2006) native CPMV-HT AGL1/739 B (B/Florida/4/2006) PDI CPMV-HT
Example 22. Co-Expression with Hsp70 and Hsp40 in Combination with Signal Peptide Modification
[0511] Cytosolic Hsp70 and Hsp40 (construct number R870) of plant origin were co-expressed with H1 New Caledonia (construct number 540) or H3 Brisbane (construct number 790), both bearing a signal peptide of plant origin (alfalfa PDI signal peptide). The co-expression was performed by agroinfiltration of N. benthamiana plants with a bacterial suspension containing a mixture (1:1:1 ratio) of AGL1/540, AGL1/R870, AGL1/35SHcPro (For H1) or AGL1/790, AGL1/R870 and AGL1/35SHcPro (for H3). Control plants were agroinfiltrated with a mixture (1:2 ratio) of AGL1/540, AGL1/35SHcPro (for H1) or AGL1/790, AGL1/35SHcPro (for H3). After incubation, leaves were harvest, extracted and HA contents in protein extracts were compared by Western blot (
[0512] All citations are hereby incorporated by reference.
[0513] The present invention has been described with regard to one or more embodiments. However, it will be apparent to persons skilled in the art that a number of variations and modifications can be made without departing from the scope of the invention as defined in the claims.
REFERENCES
[0514] Aymard, H. M., M. T. Coleman, W. R. Dowdle, W. G. Laver, G. C. Schild, and R. G. Webster. 1973. Influenza virus neuraminidase-inhibition test procedures. Bull. W. H. O. 48: 199-202 [0515] Bollag, D. M., Rozycki, M. D., and Edelstein, S. J. (1996) Protein methods (2.sup.nd edition). Wiley-Liss, New York, USA. [0516] Bligh, E.G., & Dyer, W. J. Can. J. Med. Sci. 37, 911-917 (1959). [0517] Chen, B. J., Leser, G. P., Morita, E., and Lamb R. A. (2007) Influenza virus hemagglutinin and neuraminidase, but not the matrix protein, are required for assembly and budding of plasmid-derived virus-like particles. J. Virol. 81, 7111-7123. [0518] Chen Z, Aspelund A, Jin H. 2008 Stabilizing the glycosylation pattern of influenza B hemagglutinin following adaptation to growth in eggs. Vaccine vol 26 p 361-371 [0519] Crawford, J., Wilkinson, B., Vosnesensky, A., Smith, G., Garcia, M., Stone, H., and Perdue, M. L. (1999). Baculovirus-derived hemagglutinin vaccines protect against lethal influenza infections by avian H5 and H7 subtypes. Vaccine 17, 2265-2274. [0520] Darveau, A., Pelletier, A. & Perreault, J. PCR-mediated synthesis of chimeric molecules. Methods Neurosc. 26, 77-85 (1995). [0521] Grgacic E V L, Anderson D A. Virus-like particles: passport to immune recognition. Methods 2006; 40: 60-65. [0522] Gillim-Ross, L., and Subbarao, K. (2006) Emerging respiratory viruses: challenges and vaccine strategies. Clin. Microbiol. Rev. 19, 614-636. [0523] Gomez-Puertas, P., Mena, I., Castillo, M., Vivo, A., Perez-Pastrana, E. and Portela, A. (1999) Efficient formation of influenza virus-like particles: dependence on the expression level of viral proteins. J. Gen. Virol. 80, 1635-1645. [0524] Gomez-Puertas, P., Albo, C., Perez-Pastrana, E., Vivo, A., and Portela, A. (2000) Influenza Virus protein is the major driving force in virus budding. J Virol. 74, 11538-11547. [0525] Hamilton, A., Voinnet, O., Chappell, L. & Baulcombe, D. Two classes of short interfering RNA in RNA silencing. EMBO J. 21, 4671-4679 (2002). [0526] Hfgen, R. & Willmitzer, L. Storage of competent cells for Agrobacterium transformation. Nucleic Acid Res. 16, 9877 (1988). [0527] Harbury P B, Zhang T, Kim P S, Alber T. (1993) A switch between two-, three-, and four-stranded coiled coils in GCN4 leucine zipper mutants. Science; 262: 1401-1407) [0528] Horimoto T., Kawaoka Y. Strategies for developing vaccines against h5N1 influenza a viruses. Trends in Mol. Med. 2006; 12(11):506-514. [0529] Huang Z, Elkin G, Maloney B J, Beuhner N, Arntzen C J, Thanavala Y, Mason H S. Virus-like particle expression and assembly in plants: hepatitis B and Norwalk viruses. Vaccine. 2005 Mar. 7; 23(15):1851-8. [0530] Johansson, B. E. (1999). Immunization with influenza A virus hemagglutinin and neuraminidase produced in recombinant baculovirus results in a balanced and broadened immune response superior to conventional vaccine. Vaccine 17, 2073-2080. [0531] Latham, T., and Galarza, J. M. (2001). Formation of wild-type and chimeric influenza virus-like particles following simultaneous expression of only four structural proteins. J. Virol. 75, 6154-6165. [0532] Lefebvre, B. et al. Plant Physiol. 144, 402-418 (2007). [0533] Leutwiler L S et al 1986. Nucleic Acid Research 14910):4051-64 [0534] Liu, L & Lomonossoff, G. P. Agroinfection as a rapid method for propagating Cowpea mosaic virus-based constructs. J. Virol. Methods 105, 343-348 (2002). [0535] Macala, L. J., Yo, R. K. & Ando, S. J Lipid Res. 24, 1243-1250 (1983) [0536] Mattanovich, D., Rker, F., da Camara Machado, A., Laimer, M., Regner, F., Steinkellner, H., Himmler, G., and Katinger, H. (1989) Efficient transformation of Agrobacterium spp. By electroporation. Nucl. Ac. Res. 17, 6747. [0537] Mena, I., Vivo, A., Perez, E., and Portela, A. (1996) Rescue of synthetic chloramphenicol acetyltransferase RNA into influenza virus-like particles obtained from recombinant plasmids. J. Virol. 70, 5016-5024. [0538] Mongrand S, Morel J, Laroche J, Claverol S, Carde J P, Hartmann M A et al. Lipid rafts in higher plant cells. The Journal of Biological Chemistry 2004; 279(35): 36277-36286. [0539] Neumann, G., Watanabe, T., and Kawaoka, Y. (2000) Plasmid-driven formation of virus-like particles. J. Virol. 74, 547-551. [0540] Nayak D P, Reichl U. (2004) Neuraminidase activity assays for monitoring MDCK cell culture derived influenza virus. J Virol Methods 122(1):9-15. [0541] Olsen, C. W., McGregor, M. W., Dybdahl-Sissoko, N., Schram, B. R., Nelson, K. M., Lunn, D., Macklin, M. D., and Swain, W. F. (1997). Immunogenicity and efficacy of baculovirus-expressed and DNA-based equine influenza virus hemagglutinin vaccines in mice. Vaccine 15, 1149-1156. [0542] Quan F S, Huang C, Compans R W, Kang S M. Virus-like particle vaccine induces protective immunity against homologous and heterologous strains of influenza virus. Journal of Virology 2007; 81(7): 3514-3524. [0543] Rowe, T. et al. 1999. Detection of antibody to avian influenza a (h5N1) virus in human serum by using a combination of serologic assays. J. Clin Microbiol 37(4):937-43 Saint-Jore-Dupas C et al. 2007. From planta to pharma with glycosylation in the toolbox. Trends in Biotechnology 25(7):317-23 [0544] Sambrook J, and Russell D W. Molecular cloning: a laboratory manual. Cold Spring Harbor, N.Y. Cold Spring Harbor Laboratory Press, 2001. [0545] Stockhaus J et al 1987. Analysis of cis-active sequences involved in the leaf-specific expression of a potato gene in transgenic plants. Proceedings of the National Academy of Sciences U.S.S. 84(22):7943-7947. [0546] Stockhaus J et al 1989. Identification of enhancer elements in the upstream region of the nuclear photosynthetic gene ST-LS1. Plant Cell. 1(8):805-13. [0547] Suzuki, Y. (2005) Sialobiology of influenza. Molecular mechanism of host range variation of influenza viruses. Biol. Pharm. Bull 28, 399-408. [0548] Tsuji M., Cell. Mol. Life Sci., 63 (2006); 1889-1898 [0549] Wakefield L., G. G. Brownlee Nuc Acid Res. 17 (1989); 8569-8580. [0550] Kendal, A P, Pereira M S, Skehel J. Concepts and procedures for laboratory-based influenza surveillance. Atlanta: CDC; 1982. p. B17-B35 [0551] WHO. Manual on animal influenza diagnosis and surveillance. Department of communicable disease surveillance and response. World Health Organisation Global Influenza Program. 2002. [0552] Skehel J J and Wildy D C Ann Rev Biochem 2000 69:531-69 [0553] Vaccaro L et al 2005. Biophysical J. 88:25-36. [0554] Gamblin, S. J., Haire, L. F., Russell, R. J., Stevens, D. J., Xiao, B., Ha, Y., Vasisht, N., Steinhauer, D. A., Daniels, R. S., Elliot, A., Wiley, D. C., Skehel, J. J. (2004) The structure and receptor binding properties of the 1918 influenza hemagglutinin. Science 303:1838-1842