METHODS AND MICROORGANISMS FOR PRODUCING FLAVORS AND FRAGRANCE CHEMICALS
20190177713 · 2019-06-13
Inventors
Cpc classification
C12P17/04
CHEMISTRY; METALLURGY
C12Y401/02004
CHEMISTRY; METALLURGY
C12P17/06
CHEMISTRY; METALLURGY
International classification
C12P17/06
CHEMISTRY; METALLURGY
Abstract
The present disclosure relates to biosynthetic pathways for producing flavor and fragrance chemicals, such as green notes including trans-2-unsaturated aldehydes and lactones. The present disclosure provides methods for producing trans-2-unsaturated aldehydes, delta-lactones, and gamma-lactones. The present disclosure provides pathways for the preparation of trans-2-unsaturated aldehydes, delta-lactones, and gamma-lactones by reacting aldehydes in the presence of aldolases.
Claims
1.-67. (canceled)
68. A non-naturally occurring microorganism having a trans-2-unsaturated aldehyde pathway, wherein the non-naturally occurring microorganism comprises at least one of the following trans-2-unsaturated aldehyde pathway enzymes: i. an aldolase that catalyzes condensation of two aldehydes to produce 3-hydroxy aldehyde; and ii. a dehydratase that dehydrates the 3-hydroxy aldehyde to trans-2-unsaturated aldehyde, wherein the non-naturally occurring microorganism comprises at least one exogenous nucleic acid encoding an enzyme from the trans-2-unsaturated aldehyde pathway.
69. The non-naturally occurring microorganism of claim 68, wherein the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated aldehyde pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified or wild-type microorganism.
70. The non-naturally occurring microorganism of claim 68, wherein the non-naturally occurring microorganism comprises an exogenous nucleic acid that encodes the aldolase.
71. The non-naturally occurring microorganism of claim 70, wherein the aldolase is a pyruvate-dependent aldolase.
72. The non-naturally occurring microorganism of claim 68, wherein the aldolase comprises an amino acid sequence of SEQ ID NO: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20, an active fragment thereof, or a homologue thereof.
73. The non-naturally occurring microorganism of claim 72, wherein the aldolase comprises at least about 50% identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
74. The non-naturally occurring microorganism of claim 72, wherein the aldolase comprises at least about 60% identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
75. The non-naturally occurring microorganism of claim 72, wherein the aldolase comprises at least about 70% identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
76. The non-naturally occurring microorganism of claim 72, wherein the aldolase comprises at least about 80% identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
77. The non-naturally occurring microorganism of claim 72, wherein the aldolase comprises at least about 90% identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
78. The non-naturally occurring microorganism of claim 68, wherein the aldolase enzyme comprises the following conserved amino acid residues in the active site of the enzyme: lysine167, lysine 201, aspartic acid 16 and aspartic acid 102, where a number associated with each residue refers to a residue number in the amino acid sequence of SEQ ID NO: 16.
79. The non-naturally occurring of claim 68, wherein the non-naturally occurring microorganism comprises an exogenous nucleic acid that encodes a ketoreductase, oxidoreductase, aldehyde reductase, enoate reductase, dehydratase, lactonization enzyme, or alcohol dehydrogenase.
80. The non-naturally occurring microorganism of claim 68, wherein the non-naturally occurring microorganism further comprises: a decarboxylase capable of decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide.
81. The non-naturally occurring microorganism of claim 80, wherein the decarboxylase comprises an amino acid sequence of SEQ ID NO: 71 or an active fragment or homologue thereof.
82. The non-naturally occurring microorganism of claim 80, wherein the decarboxylase is pyruvate decarboxylase (PDC), benzoylformate decarboxylase (BFD), or alpha-ketoacid decarboxylase (KDC).
83. The non-naturally occurring microorganism of claim 82, wherein the BFD comprises an amino acid sequence of SEQ ID NO: 76 or an active fragment or homologue thereof.
84. The non-naturally occurring microorganism of claim 82, wherein the KDC comprises an amino acid sequence of SEQ ID NO: 68 or 77 or an active fragment or homologue thereof.
85. The non-naturally occurring microorganism of claim 68, wherein the non-naturally occurring microorganism further expresses an enzyme identified in table 10 or table 9.
86. The non-naturally occurring microorganism of claim 68, wherein one or more genes encoding an enzyme that utilizes pyruvate are deleted from the non-naturally occurring microorganism as compared to wild-type.
87. The non-naturally occurring microorganism of claim 68, wherein one or more genes encoding an enzyme capable of catalyzing a reaction involving an acetaldehyde molecule, a pyruvate, or an aldehyde precursor is deleted from the non-naturally occurring microorganism as compared to wild-type.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0123] The novel features of the disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings (also FIGURE and FIG. herein), of which:
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
DETAILED DESCRIPTION
[0135] While various embodiments of the disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions may occur to those skilled in the art without departing from the present disclosure. It should be understood that various alternatives to the embodiments of the disclosure described herein may be employed.
[0136] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the present disclosure belongs. In case of conflict, the present application including the definitions will control. Also, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. All publications, patents and other references mentioned herein are incorporated by reference in their entireties for all purposes as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference, unless only specific sections of patents or patent publications are indicated to be incorporated by reference.
[0137] The present disclosure describes non-naturally occurring microorganisms that are engineered by expressing genes encoding enzymes involved in biochemical pathways for producing trans-2-unsaturated aldehydes or lactones, such as delta-lactones and gamma-lactones, by using aldolases. The present disclosure also describes additional genetic modifications that may be used to improve the performance of the trans-2-unsaturated aldehyde pathway and the lactones (e.g. delta-lactone or gamma-lactone) production pathways. The genetic modifications may be towards optimizing the expression system or to the non-natural organism for improvement of production metrics including yield, titre, and productivity. Additionally, genetic modifications may be aimed at improving the non-natural microorganism's characteristics including but not limited to tolerance to inhibitors found in the feedstocks, product tolerance, osmotolerance, and efficient product secretion.
[0138] In order to further define the present disclosure, the following terms, abbreviations and definitions are provided.
[0139] As used herein, the term about modifying the quantity of an ingredient or reactant of the present disclosure employed refers to variations in the numerical quantity that may occur, for example, through typical measuring and liquid handling procedures used for making concentrates or solutions in the real world; through inadvertent error in these procedures; through differences in the manufacture, source, or purity of the ingredients employed to make the compositions or to carry out the methods; and the like. The term about also encompasses amounts that differ due to different equilibrium conditions for a composition resulting from a particular initial mixture. Whether or not modified by the term about, the claims include equivalents to the quantities. In some embodiments, the term about means within 10% of the reported numerical value, or within 5% of the reported numerical value, or within 20% of the reported numerical value.
[0140] The indefinite articles a and an preceding an element or component of the present disclosure are intended to be nonrestrictive regarding the number of instances, i.e., occurrences of the element or component. Therefore a or an should be read to include one or at least one, and the singular word form of the element or component also includes the plural unless the number is obviously meant to be singular.
[0141] As used herein, synergistic refers to a greater-than-additive effect produced by a combination (i.e., an effect that is greater than the sum of individual effects) or an additive effect when the individual effects are not expected to be additive. The term also refers to the addition of one compound which results in less of another compound being required.
[0142] The term polynucleotide is intended to encompass a singular nucleic acid as well as plural nucleic acids, and may refer to a nucleic acid molecule or construct, e.g., messenger RNA (mRNA) or plasmid DNA (pDNA). A polynucleotide may contain the nucleotide sequence of the full-length cDNA sequence, or a fragment thereof, including the untranslated 5 and 3 sequences and the coding sequences. The polynucleotide may be composed of any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. For example, polynucleotides may be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. Polynucleotide embraces chemically, enzymatically, or metabolically modified forms.
[0143] The term amino acid refers to the basic chemical structural unit of a protein or polypeptide. The following abbreviations are used herein to identify specific amino acids:
TABLE-US-00001 Three-Letter One-Letter Amino Acid Abbreviation Abbreviation Alanine Ala A Arginine Arg R Asparagine Asn N Aspartic acid Asp D Cysteine Cys C Glutamine Gln Q Glutamic acid Glu E Glycine Gly G Histidine His H Leucine Leu L Lysine Lys K Methionine Met M Phenylalanine Phe F Proline Pro P Serine Ser S Threonine Thr T Tryptophan Trp W Tyrosine Tyr Y Valine Val V
[0144] The term gene refers to a nucleic acid fragment that is capable of being expressed as a specific protein, optionally including regulatory sequences preceding (5 non-coding sequences) and following (3 non-coding sequences) the coding sequence. The term gene refers to a linear sequence of nucleotides along a segment of DNA that provides the coded instructions for synthesis of RNA. In some instances, a gene provides coded instructions for translation into protein. In some instances, a gene provides coded instructions for the synthesis of non-coding RNA, which does not lead to translation into protein.
[0145] As used herein, the term protein comprises at least one polypeptide comprising amino acid residues bound together by peptide bonds.
[0146] As used herein, the terms variant, modified, and mutant are synonymous and refer to a polypeptide differing from a specifically recited polypeptide by one or more amino acid insertions, deletions, mutations, and substitutions, created using, e.g., recombinant DNA techniques, such as mutagenesis. Guidance in determining which amino acid residues may be replaced, added, or deleted without abolishing activities of interest, may be found by comparing the sequence of the particular polypeptide with that of homologous polypeptides, e.g., yeast or bacterial, and minimizing the number of amino acid sequence changes made in regions of high homology (conserved regions) or by replacing amino acids with consensus sequences.
[0147] The mutants of the present disclosure may be generated in accordance with any suitable method, including, but not limited to, methods described and exemplified herein. Mutations, such as substitutions, insertions, deletions, and/or side chain modifications, may be introduced into the nucleotide and amino acid sequences of the gene of interest using any suitable technique, including site-directed mutagenesis (Wu, ed., Meth. Enzymol. 217, Academic Press (1993)) or random mutagenesis, or a combination. The lambda red recombinase method may be used to knock out genes (Datsenko et al., PNAS USA 97: 6640-6645 (2000)). Permanent, marker-free, multiple gene disruptions may be created. Non-naturally occurring nucleotides and amino acids also may be used.
Random Mutagenesis
[0148] The random mutagenesis of the DNA sequence encoding an enzyme of the present disclosure may conveniently be performed by using any method known in the art. For instance, the random mutagenesis may be performed by using a suitable physical or chemical mutagenizing agent, by using a suitable oligonucleotide, or by subjecting the DNA sequence to PCR generated mutagenesis. In some embodiments, the random mutagenesis may be performed by using any combination of these mutagenizing agents.
[0149] In some embodiments, the mutagenizing agent may, e.g., be one which induces transitions, transversions, inversions, scrambling, deletions, and/or insertions. Examples of a physical or chemical mutagenizing agent suitable for the present purpose include, but it is not limited to, ultraviolet (UV) irradiation, hydroxylamine, N-methyl-N-nitro-N-nitrosoguanidine (MNNG), O-methyl hydroxylamine, nitrous acid, ethyl methane sulphonate (EMS), sodium bisulphite, formic acid, and nucleotide analogues. When such agents are used the mutagenesis is typically performed by incubating the DNA sequence encoding the unmodified or wild-type enzyme to be mutagenized in the presence of the mutagenizing agent of choice under suitable conditions for the mutagenesis to take place, and selecting for mutated DNA having the desired properties. When the mutagenesis is performed by using an oligonucleotide, the oligonucleotide may be doped or spiked with the non-parent or non wild-type nucleotides during the synthesis of the oligonucleotide at the positions wanted to be changed. The doping or spiking may be done so that codons for unwanted amino acids are avoided. The doped or spiked oligonucleotide can be incorporated into the DNA encoding the enzyme (e.g., DERA) by any published technique using e.g., PCR, LCR or any DNA polymerase and ligase. When PCR generated mutagenesis is used either a chemically treated or non-treated gene encoding a parent lipolytic enzyme is subjected to PCR under conditions that increases the misincorporation of nucleotides (Deshler 1992, Leung et al. 1989).
[0150] A mutator strain of E. coli (Fowler et al. 1974), S. cereviciae or any other microbial organism may be used for the random mutagenesis of the DNA encoding the enzyme (e.g., DERA) by e.g., transforming a plasmid containing the parent enzyme into the mutator strain, growing the mutator strain with the plasmid and isolating the mutated plasmid from the mutator strain. The mutated plasmid may subsequently be transformed into the expression organism.
[0151] The DNA sequence to be mutagenized may conveniently be present in a genomic or cDNA library prepared from an organism expressing the parent or wild-type enzyme (e.g., DERA). Alternatively, the DNA sequence may be present on a suitable vector such as a plasmid or a bacteriophage, which as such may be incubated with or otherwise exposed to the mutagenizing agent. The DNA to be mutagenized may also be present in a host cell either by being integrated in the genome of said cell or by being present on a vector harboured in the cell. Finally, the DNA to be mutagenized may be in isolated form. It will be understood that the DNA sequence to be subjected to random mutagenesis is preferably a cDNA or a genomic DNA sequence.
[0152] In some embodiments, it may be convenient to amplify the mutated DNA sequence prior to expression in a host cell or screening. Such amplification may be performed in accordance with methods known in the art. In some embodiments, the method comprises PCR generated amplification using oligonucleotide primers prepared on the basis of the DNA or amino acid sequence of the parent or wild type enzyme.
[0153] Subsequent to the incubation with or exposure to the mutagenizing agent, the mutated DNA is expressed by culturing a suitable host cell carrying the DNA sequence under conditions allowing expression to take place. The host cell may be one which has been transformed with the mutated DNA sequence, optionally present on a vector, or one which carried the DNA sequence encoding the parent enzyme during the mutagenesis treatment. The mutated DNA sequence may further comprise a DNA sequence encoding functions permitting expression of the mutated DNA sequence.
[0154] As used herein, homologue refers to a protein that is functionally equivalent i.e. has the same enzymatic activity as an enzyme having an amino acid sequence of the specified sequence identification number, but may have a limited number of amino acid substitutions, deletions, insertions or additions in the amino acid sequence. In order to maintain the function of the protein, the substitutions may be conservative substitutions, replacing an amino acid with one having similar properties.
[0155] In various aspects, a homologue of each enzyme refers to a protein which has an identity of at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95% or at least 99% with the amino acid sequence of SEQ ID NO corresponding to the enzyme and retains enzymatic activity. Algorithms for determining sequence identity are publicly available and include e.g. BLAST available through the National Center for Biotechnology Information (NCBI). One skilled in the art may determine if the sequences are similar to a degree that indicates homology and thus similar or identical function.
[0156] A polynucleotide encoding a homologue of each enzyme may be obtained by appropriately introducing substitution, deletion, insertion, and/or addition to the DNA of the enzyme which is composed of a nucleotide sequence disclosed herein, using methods such as site-specific mutagenesis (Nucleic Acid Res. 10, pp. 6487 (1982), Methods in Enzymol. 100, pp. 448 (1983), Molecular Cloning 2nd Edt., Cold Spring Harbor Laboratory Press (1989), PCR A Practical Approach IRL Press pp. 200 (1991)). The polynucleotide encoding a homologue of each enzyme may be introduced and expressed in a host to obtain the homologue.
[0157] As used herein, term microbial cell is intended to include whole microorganism cells, and/or fragmented cells, and/or homogenized cells. The term microbial cell preparation may include whole microorganism cells as well as cell mass particulate forms of immobilized intracellular enzymes. In some embodiments, the microbial cell is a viable cell. In some embodiments, the microbial cell produces a crude cell lysate. In some embodiments, the crude cell lysate is purified. In some embodiments, the crude cell lysate is unpurified. In some embodiments, the crude cell lysate is a combination of purified and unpurified crude cell lysate. In some embodiments, the microbial cell comprises one or more gene deletions to increase the availability of aldehyde and/or pyruvate. In some embodiments, the microbial cell comprises one or more gene deletions encoding an alcohol dehydrogenase, a lactate dehydrogenase, and/or a pyruvate formate lyase. In some embodiments, a deleted gene may be an alcohol dehydrogenase gene, a lactate dehydrogenase gene, and/or a pyruvate formate lyase gene.
[0158] As used herein, enzyme includes proteins produced by a cell capable of catalyzing biochemical reactions. Further, unless context dictates otherwise, as used herein enzyme includes protein fragments that retain the relevant catalytic activity, and may include artificial enzymes synthesized to retain the relevant catalytic activity. In some embodiments, at least one enzyme (e.g., aldolase, DERA) of the present disclosure may be in the form of a whole microbial cell, a microbial cell, a permeabilized microbial cell, a microbial cell extract, one or more cell components of a microbial cell extract, a partially purified enzyme, a purified enzyme, or combinations thereof.
[0159] Each of the enzymes described herein may be attached to an additional amino acid sequence as long as it retains an activity functionally equivalent to that of the enzyme. As mentioned above, it is understood that each enzyme or a homologue thereof may be a (poly)peptide fragment as long as it retains an activity functionally equivalent to that of the enzyme.
[0160] In some embodiments, at least one enzyme (e.g., aldolase, DERA) is expressed in a host cell. In some embodiments, the at least one enzyme is an unmodified or wild type enzyme. In some embodiments, the at least one enzyme is a modified or a variant enzyme. In some embodiments, the host cell is a microbial cell. In some embodiments, the host cell is a fungal or a bacteria cell. In some embodiments, the microbial host cell is a transformed microbial host cell. In some embodiments, the microbial or transformed microbial host cell may be selected from Comamonas sp., Corynebacterium sp., Brevibacterium sp., Rhodococcus sp., Azotobacter sp., Citrobacter sp., Enterobacter sp., Clostridium sp., Klebsiella sp., Salmonella sp., Lactobacillus sp., Aspergillus sp., Saccharomyces sp., Yarrowia sp., Zygosaccharomyces sp., Pichia sp., Kluyveromyces sp., Candida sp., Hansenula sp., Dunaliella Debaryomyces sp., Mucor sp., Torulopsis sp., Methylobacteria sp., Bacillus sp., Escherichia sp., Pseudomonas sp., Rhizobium sp., and Streptomyces sp. In some embodiments, the microbial host cell may be Bacillus sp., Pseudomonas sp., or Escherichia sp.
[0161] As used herein, the term enzymatic activity describes the ability of an enzyme to convert a substrate (e.g., aldehyde molecule) into a product or an intermediate. For example, an enzymatic activity may be described as the ability of an enzyme to catalyze condensation of aldehyde molecules, such as the ability of an aldolase (e.g., DERA or a modified DERA) to catalyze condensation of two aldehyde molecules or one aldehyde and pyruvic acid to produce 3-hydroxy aldehyde or 4-hydroxy-2-oxo carboxylic acid, respectively. In some embodiments, both the natural substrate of the enzyme and a synthetic modified analog of the natural substrate can be used. The enzymatic activity can be determined in what is known as an activity assay via the increase in the product or intermediate, the decrease in the starting material, the decrease or increase in a specific cofactor, or a combination of at least two of the aforementioned parameters as a function of a defined period of time. If the enzyme catalyzes a reversible reaction, both the starting material and the product may be employed as substrate in the activity assay in question.
[0162] As used herein, the term microorganism is intended to mean any organism that exists as a microscopic cell and encompasses prokaryotic or eukaryotic cells or organisms having a microscopic size and includes bacteria, archaea and eubacteria of all species as well as eukaryotic microorganisms such as yeast and fungi. The term also includes cell cultures of any species (including e.g. plant and mammalian cells) that may be cultured for the production of a biochemical.
[0163] As used herein, the term non-naturally occurring when used in reference to a microorganism refers to a microorganism that has at least one genetic alteration not normally found in a naturally occurring strain of the referenced species, including wild-type strains of the referenced species. Genetic alterations include, for example, modifications introducing expressible nucleic acids encoding metabolic polypeptides, other nucleic acid additions, nucleic acid deletions and/or other functional disruption of the microbial genetic material. Such modifications include, for example, coding regions and functional fragments thereof, for heterologous, homologous or both heterologous and homologous polypeptides for the referenced species. Additional modifications include, for example, non-coding regulatory regions in which the modifications alter expression of a gene or operon. In some embodiments, the non-naturally occurring microorganism comprises an exogenous nucleic acid that encodes an aldolase enzyme. In some embodiments, the non-naturally occurring microorganism comprises an exogenous nucleic acid that encodes a pyruvate dependent aldolase. In some embodiments, the non-naturally occurring microorganism comprises an exogenous nucleic acid that encodes a pyruvate class II aldolase (e.g., HpaI, BphI, Eda, or a homologue, or a mutant, or any combination thereof). In some embodiments, the non-naturally occurring microorganism comprises an exogenous nucleic acid that encodes a ketoreductase, oxidoreductase, aldehyde reductase, enoate reductase, dehydratase, lactonization enzyme, or alcohol dehydrogenase, or any combination thereof.
[0164] The term endogenous refers to a referenced molecule or activity that originates in a host microorganism. Similarly, the term when used in reference to expression of an encoding nucleic acid refers to expression of an encoding nucleic acid contained within the microorganism.
[0165] As used herein the term exogenous refers to molecules or activity that is introduced into a host microorganism. The molecule may be introduced, for example, by introduction of an encoding nucleic acid into the host genetic material such as by integration into a host chromosome or as non-chromosomal genetic material such as a plasmid. In reference to expression of an encoding nucleic acid the term refers to introduction of the encoding nucleic acid in an expressible form into the microorganism. When used in reference to a biosynthetic activity, the term refers to an activity that is introduced into a reference host organism. The source may be, for example, an encoding nucleic acid that expresses the activity following introduction into the host microorganism.
[0166] The term heterologous refers to a molecule or activity derived from a source other than the referenced species whereas homologous refers to a molecule or activity derived from the host microbial organism. Accordingly, exogenous expression of an encoding nucleic acid of the present disclosure may use either or both a heterologous or homologous encoding nucleic acid.
[0167] The term oxidoreductase is defined as any enzyme that facilitates the oxidation or reduction of a substrate. The term oxidoreductase includes oxidases, which facilitate oxidation reactions in which molecular oxygen is the electron acceptor; reductases, which facilitate reduction reactions in which the analyte is reduced and molecular oxygen is not the analyte; and dehydrogenases, which facilitate oxidation reactions in which molecular oxygen is not the electron acceptor. See, for example, Oxford Dictionary of Biochemistry and Molecular Biology, Revised Edition, A. D. Smith, Ed., New York: Oxford University Press (1997) pp. 161, 476, 477, and 560. Non-limiting examples of oxidoreductases include a reductase, an oxidase, a dehydrogenase, a ketoreductase, an alcohol dehydrogenase, a carbonyl reductase, an aldehyde dehydrogenase, an amino acid dehydrogenase, an amine oxidase, a disulfide reductase, an enoate reductase, and a mixed function oxidase. A listing of such enzymes may be found in Enzyme Nomenclature; Webb, E. C., Ed. Academic: Orlando 1984; pp 20-141.
[0168] As used herein, the term operably linked refers to a linkage between one or more expression control sequences and the coding region in a polynucleotide to be expressed in such a way that expression is achieved under conditions compatible with the expression control sequence.
[0169] The expression derived from in relation to an enzyme or (poly)peptide denotes that the enzyme or poly(peptide) was isolated from a (micro)organism or that it includes all or a biologically active part of the amino acid sequence of an enzyme or (poly)peptide isolated or characterized from such a (micro)organism.
[0170] In some embodiments, the processes/pathways disclosed herein is a process comprising, consisting of, or consisting essentially of condensing two aldehyde molecules using an aldolase enzyme as described herein.
[0171] The aldolases catalyze aldol condensation by stereo-controlled addition of a nucleophilic donor onto an electrophilic aldehyde acceptor. Due to the mechanistic requirements aldolases are quite specific for the nucleophilic donor component but show large flexibility in the acceptor range. Hence aldolases are categorized based on their nucleophilic donors. Different classes of aldolases are 1) acetaldehyde dependent aldolase, 2) pyruvate/phosphoenolpyruvate-dependent aldolases, 3) dihydroxyacetone phosphate/dihydroxyacetone-dependent aldolases, and 4) glycine dependent aldolases.
[0172] In some embodiments, aldolases may be acetaldehyde dependent aldolases. In some embodiments, aldolases may be pyruvate dependent aldolases. In some embodiments, the aldehydes may be donors or acceptors.
[0173] In some embodiments, the donors may include one or more of acetaldehyde (ethanal), propanal, 2-methylpropanal, methylglyoxal, lactaldehyde, glycolaldehyde, acrolein, formaldehyde, acetaldehyde, propionaldehyde, n-butyraldehyde, iso-butyraldehyde, hexanal, n-pentanal (valeraldehyde), caproaldehyde, crotonaldehyde, n-heptaldhyde, n-octanal, n-nonylaldehyde, phenylacetaldehyde, benzaldehyde, p-tolualdehyde, salicylaldehyde, vanillin, piperonal, 2-ethyl-2-hex-enal and 2-ethylhexaldehyde, undecaldehyde, decaldehyde, nonaldehyde, octaldehyde, heptaldehyde, hexaldehyde, pentaldehyde, or butyraldehyde.
[0174] In some embodiments, the donors may be non-aldehydes including pyruvate, propanone (acetone), glyoxylic acid, or 3-propenol.
[0175] In some embodiments, the acceptors may include one or more of acetaldehyde (ethanal), propanal, butanal, isobutanal, 2-methyl-1-butanal, 3-methyl-1-butanal, pentanal, hexanal, 3-methyl-1-pentanal, 4-methyl-1-pentanal, succinate semialdehyde, lactaldehyde, glycoldehyde, glyceraldehyde, 2-phenylacetaldehyde, cinnamaldehyde, glyoxal, glyoxylic acid, methyl glyoxal, acrolein, succindialdehyde, glutaraldehyde, adipaldehyde, malondialdehyde, malonic semialdehyde (3-oxopropionic acid), muconate semialdehyde, 2-hydroxymuconate semialdehyde, formaldehyde, acetaldehyde, propionaldehyde, n-butyraldehyde (butanal), iso-butyraldehyde, tert-butanal, hexanal (n-hexaldehyde), n-pentanal (valeraldehyde, pentaldehyde), caproaldehyde, crotonaldehyde, n-heptaldhyde (heptaldehyde, heptanal), n-octanal (octaldehyde), n-nonylaldehyde (nonaldehyde), n-decaldehyde, 3-hydroxypropanal, 3-hydroxybutanal, 3-hydroxypentanal, 3-hydroxyhexanal, 3-hydroxyheptanal, 3-hydroxy-octanal, 3-hydroxynonanal, 3-hydroxydecanal, phenylacetaldehyde, benzaldehyde, p-tolualdehyde, salicylaldehyde, vanillin, piperonal, 2-ethyl-2-hex-enal and 2-ethylhexaldehyde, undecaldehyde.
[0176] As used herein, the term DERA refers to the enzyme deoxyribose-5-phosphate aldolase belonging to the class aldolases, the term AKR refers to the class aldo-ketoreductase, the term ADH refers to the enzyme alcohol dehydrogenase, the term PDC refers to the enzyme pyruvate decarboxylase, the term BFD refers to the enzyme benzoylformate decarboxylase, the term KDC refers to the enzyme alpha-ketoacid decarboxylase, the term KRED refers to ketoreductase, the term G6PD refers to the enzyme glucose-6-phosphate 1-dehydrogenase (hemi-acetal oxidase), the term AKHD refers to the enzyme aspartokinase/homoserine dehydrogenase, the term HSK refers to the enzyme homoserine kinase, the term TS refers to the enzyme threonine synthase, the term IMDH refers to the enzyme isopropylmalate dehydrogenase, the term IPMI refers to the enzyme isopropylmalate dehydratase, the term NADH refers to reduced nicotinamide adenine dinucleotide, the term NADPH refers to reduced nicotinamide adenine dinucleotide phosphate, the term NAD refers to nicotinamide adenine dinucleotide, and the term NADP refers to nicotinamide adenine dinucleotide phosphate.
[0177] In some embodiments, the trans-2-unsaturated aldehyde pathway or the delta-lactone pathway disclosed herein comprise the condensation of two aldehyde molecules to 3-hydroxy acetaldehyde using enzyme from class aldolases. In some embodiments, the condensation of an aldehyde and a 3-hydroxy acetaldehyde molecule may be performed using an enzyme from class aldolases. In some embodiments, the enzyme from the class aldolases is a deoxyribose-5-phosphate aldolase (DERA) (EC 4.1.2.4.).
[0178] In some embodiments, DERA enzymes may be described as class I aldolases that form covalent Schiff base intermediates. In all studied structures, DERA adopts the classical eight-bladed TIM barrel fold. The oligomerisation state of DERA seems to depend on the temperature of the organism. For example, DERA from E. coli is a homodimer, whereas DERA from Thermotoga maritima is a homotetramer. The degree of oligomerization does not seem to affect catalysis but may affect stability under various conditions.
[0179] In some embodiments, the DERA is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the aldolase (e.g., DERA) is an enzyme comprising an amino acid sequence encoded by a DNA which comprises at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% nucleotide sequence identity to any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0180] In some embodiments, DERAs as described herein are derived from microorganisms of the genus Bacillus, Escherichia, Thermotoga, Deinococcus, Listeria, Staphylococcus, Streptococcus, and Methanothermobacter. In some embodiments, the DERA is derived from Bacillus halodurans, Bacillus cereus, Bacillus subtilis, Escherichia coli, Thermotoga maritima, Deinococcus radiodurans, Listeria monocytogenes, Staphylococcus aureus, Streptococcus pneumonia, and Methanothermobacter thermautotrophicus. In some embodiments, a DERA as used in a process described herein comprises an amino acid sequence of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or active fragments or homologues thereof. In some embodiments, the DERA is an enzyme comprising an amino acid sequence which comprises at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
[0181] In some embodiments, the aldolase enzyme comprises the following conserved amino acid residues in the active site of the enzyme: lysine 167, lysine 201, aspartic acid 16 and aspartic acid 102, where the number associated with each residue refers to the residue number in the amino acid sequence of E. coli DERA of the SEQ ID NO: 16 and corresponding codons in the nucleotide sequence of SEQ ID NO: 2.
[0182] In some embodiments, the DERA enzyme is specifically modified to increase activity towards an alkyl aldehyde. In some embodiments, the DERA enzyme is specifically modified to increase activity towards hexanal. In some embodiments, the DERA enzyme is modified to increase activity towards propanal, butanal, pentanal, hexanal, heptanal, octanal, nonanal, decanal, undecanal, dodecanal, tridecanal, and any combination thereof. In some embodiments, the DERA enzyme is modified to increase activity towards condensation of an acetaldehyde and an acetaldehyde, propanal, butanal, pentanal, hexanal, heptanal, octanal, nonanal, decanal, undecanal, dodecanal, or a tridecanal. In some embodiments, the DERA enzyme is modified to increase activity towards condensation of an acetaldehyde and a 3-hydroxy aldehyde (e.g., 3-hydroxy-propanal, 3-hydroxy-butanal, 3-hydroxy-pentanal, 3-hydroxy-hexanal, 3-hydroxy-heptanal, 3-hydroxy-octanal, 3-hydroxy-nonanal, 3-hydroxy-decanal, 3-hydroxy-undecanal, 3-hydroxy-dodecanal, 3-hydroxy-tridecanal). In some embodiments, the DERA enzyme used for the condensation of an acetaldehyde and an aldehyde is different from the DERA enzyme used for the condensation of an acetaldehyde and a 3-hydroxy aldehyde. In some embodiments, an aldolase enzyme (e.g., pyruvate-dependent aldolase) is modified to increase activity towards condensation of a pyruvic acid and an aldehyde (e.g., acetaldehyde, propanal, butanal, pentanal, hexanal, heptanal, octanal, nonanal, decanal, undecanal, dodecanal, or tridecanal).
[0183] In some embodiments, the DERA enzyme is modified to increase activity towards a 3-hydroxy aldehyde. In some embodiments, the DERA enzyme is modified to increase activity towards 3-hydroxy-propanal, 3-hydroxy-butanal, 3-hydroxy-pentanal, 3-hydroxy-hexanal, 3-hydroxy-heptanal, 3-hydroxy-octanal, 3-hydroxy-nonanal, 3-hydroxy-decanal, 3-hydroxy-undecanal, 3-hydroxy-dodecanal, 3-hydroxy-tridecanal, and any combination thereof. In some embodiments, the DERA enzyme is specifically modified to increase activity towards 3-hydroxy octanal.
[0184] In some embodiments, the DERA enzyme comprises one or more of the following mutations: R190K, R190I, R190F, R190A, R190L, R190M, T12A, and S238A. In some embodiments, the DERA enzyme comprises, but is not limited to, one or more of the following mutations: R190K, R190I, R190F, T12A, and S238A. In some embodiments, the DERA enzyme comprises, but is not limited to, one or more of the following mutations: R190A or R190L or R190M, T12A and S238A. In some embodiments, the number associated with amino acids R190, T12, and S238 corresponds to the amino acid residue numbers in BH1352 DERA, represented in SEQ ID NO: 18. In some embodiments, all residues R190, T12, and S238 are mutated or modified. In some embodiments, only one of R190, T12, and S238 is mutated or modified. In some embodiments, the amino acid R190 is mutated or modified. In some embodiments, the DERA enzyme from another organism may comprise one or more amino acid mutations that correspond to the amino acid mutations R190K, R190I, R190F, R190A, R190L, R190M, T12A, and S238A (e.g., of SEQ ID NO: 18), wherein the amino acids R190, T12 and S238 correspond to the amino acid residue numbers in SEQ ID NO: 18. In some embodiments, one or more amino acid(s) is mutated to a hydrophobic amino acid. In some embodiments, one or more amino acid(s) is mutated to a nonpolar amino acid. In some embodiments, one or more amino acid(s) is mutated to a charged amino acid. In some embodiments, one or more amino acid(s) is mutated to a basic amino acid.
[0185] In some embodiments, enzymes belong to the Pfam database [Finn R. D. et al., Pfam: the protein families database Nucl. Acids Res. (1 Jan. 2014) 42 (Dl): D222-D230] group PF01791 (DeoC/LacD family aldolase) include deoxyribose-5-phosphate aldolases, which also belong to the InterPro family IPR002915, IPR013785, IPR011343, and IPR028581. Protein sequences that belong to the InterPro and Pfam family of proteins may be obtained, such that they are homologues of DERA described herein.
[0186] In some embodiments, the 5,3-dihydroxy aldehyde product of the DERA catalyzed reaction spontaneously forms a hemi-acetal.
[0187] In some embodiments the hemi-acetal is oxidized to form a lactone by a hemi-acetal specific oxidase. TABLE 1 lists hemi-acetal specific oxidases.
TABLE-US-00002 TABLE 1 Protein Genbank ID GI number Organism SEQ ID NO Zwf NP_416366.1 16129805 Escherichia coli K-12 21 MG1655 G6PD P37986.1 585164 Dickeya dadantii 3937 22 G6PD Q9Z8U6.1 6225396 Chlamydia pneumoniae 23
[0188] In some embodiments, hemi-acetal oxidases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the hemi-acetal oxidase is derived from Escherichia coli K-12 MG1655. In some embodiments, a hemi-acetal oxidase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 21 or active fragments or homologues thereof.
[0189] In some embodiments, the hemi-acetal oxidase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 24.
[0190] In some embodiments, the gamma-lactone pathway disclosed herein comprises the condensation of one aldehyde molecule to pyruvate using enzyme from class aldolases. In some embodiments, the condensation of an aldehyde and a pyruvate molecule may be performed using an enzyme from class aldolases. In some embodiments, the enzyme from the class aldolases is a pyruvate dependent aldolase (PDA).
[0191] In some embodiments, sources of encoding nucleic acids for the pathway enzymes described herein are not particularly restricted and may include any species where the encoded gene product may catalyze the relevant reaction. The enzymes may be derived from, but not limited to, the following species: Paraburkholderia xenovorans LB400, Agrobacterium tumefaciens, Bacillus cereus, Bacillus halodurans, Bacillus subtilis, Helicobacter pylori, Lactobacillus brevis, Pseudomonas aeruginosa, Pseudomonas putida, Pseudomonas synringae, Rhodopseudomonas palustris, Salmonella typhimurium, Saccharomyces cerevisiae, Clostridium acetobutylicum. TABLE 2 illustrates exemplary pyruvate dependent aldolase enzymes.
TABLE-US-00003 TABLE 2 SEQ Protein Genbank ID GI number Organism ID NO EDA NP_416364 16129803 Escherichia coli K-12 MG1655 25 MphE NP_414886 16128337 Escherichia coli K-12 MG1655 26 BphI ABE37049 91693852 Paraburkholderia xenovorans 27 LB400
[0192] In some embodiments, enzymes described herein may belong to the InterPro superfamily family IPR000887 and IPR017629, which describe the pyruvate dependent aldolase family of enzymes.
[0193] In some embodiments, pyruvate dependent aldolase as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the pyruvate dependent aldolase is derived from Eschericha coli K-12 MG1655. In some embodiments, a pyruvate dependent aldolase as used in a process described herein comprises an amino acid sequence of SEQ ID Nos: 25 or 26, or active fragments or homologues thereof.
[0194] In some embodiments, the pyruvate dependent aldolase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 28 or 29.
[0195] In some embodiments, sources of encoding nucleic acids for the pathway enzymes described herein are not particularly restricted and may include any species where the encoded gene product may catalyze the relevant reaction. The enzymes may be derived from, but not limited to, the following species: Agrobacterium tumefaciens, Bacillus cereus, Bacillus halodurans, Bacillus subtilis, Helicobacter pylori, Lactobacillus brevis, Pseudomonas aeruginosa, Pseudomonas putida, Pseudomonas synringae, Rhodopseudomonas palustris, Salmonella typhimurium, Saccharomyces cerevisiae, Clostridium acetobutylicum. TABLE 3 illustrates exemplary aldo-keto reductase enzymes.
TABLE-US-00004 TABLE 3 SEQ Protein Genebank ID GI number Organism ID NO AKR11B CAB12792.1 2633288 Bacillus subtilis 30 PA1127 NP_249818.1 15596324 Pseudomonas aeruginosa 31 AKR WP_ 499200775 Bacillus halodurans 32 010898315 AKR NP_790200 28867581 Pseudomonas syringae 33
[0196] In some embodiments, enzymes described herein may belong to the InterPro superfamily family IPR023210, IPR001395, IPR018170, and IPR020471, which describes the aldo-keto reductase family of enzymes that possess a beta-alpha-beta fold which comprises a parallel 8 beta/alpha barrel which contains the NADP binding motif.
[0197] In some embodiments, there is provided an alcohol dehydrogenase, aldo-keto reductases (AKR), oxidoreductase, or aldehyde reductase capable of selectively reducing trans-2-unsaturated aldehydes to trans-2-unsaturated alcohols or to trans-2-unsaturated carboxylic acids. In some embodiments, there is provided alcohol dehydrogenases, aldo-keto reductases (AKR), oxidoreductases, or aldehyde reductases capable of selectively reducing 2-keto-4-hydroxy aldehydes to 2,4-dihydroxy aldehydes. In some embodiments, there is provided alcohol dehydrogenases, aldo-keto reductases (AKR), oxidoreductases, or aldehyde reductases capable of selectively reducing 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid. In some embodiments, the source of this enzyme is not particularly restricted.
[0198] In some embodiments, aldo-keto reductases (AKRs) as described herein are derived from microoganisms of the genus Pseudomonas. In some embodiments, an AKR as provided herein is derived from Pseudomonas aeruginosa. In some embodiments, an AKR as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 31 or active fragments or homologues thereof.
[0199] In some embodiments, the AKR is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 34.
[0200] In some embodiments, L-threonine is the starting metabolite for the production of 2-ketobutyrate by pathways disclosed herein. It is a common metabolite but it may be produced by a sequence of reactions starting from L-aspartate.
[0201] In some embodiments, L-threonine is produced from L-aspartate by sequential reactions catalyzed by aspartate kinase/homoserine dehydrogenase (ThrA) (EC 2.7.2.4), homoserine kinase (ThrB) (EC 2.7.1.39) and threonine synthase (ThrC) (EC 4.2.3.1). The reaction proceeds via L-aspatyl-4-phosphate, L-aspartate semialdehyde, L-homoserine and O-phospho-L-homoserine. Over expression of aspartate kinase/homoserine dehydrogenase, homoserine kinase and threonine synthase leads to increased levels of L-threonine [Mak, W. S., et al., Integrative genomic mining for enzyme function to enable engineering of a non-natural biosynthetic pathway. Nat Commun, 2015. 6: p. 10005.; Rodriguez, G. M. and S. Atsumi, Toward aldehyde and alkane production by removing aldehyde reductase activity in Escherichia coli. Metab Eng, 2014. 25: p. http://blast.ncbi.nlm.nih.gov/Blast.cgi227-37.; Zhang, K., et al., Expanding metabolism for biosynthesis of nonnatural alcohols. Proc Natl Acad Sci USA, 2008. 105(52): p. 20653-8.]. TABLE 4 illustrates examples of isopropylmalate synthases, isopropylmalate dehydratases and 3-isopropylmalate dehydrogenases.
TABLE-US-00005 TABLE 4 SEQ Protein Genbank ID GI number Organism ID NO ThrA NP_414543.1 16127996 Escherichia coli K-12 35 MG1655 ThrA P27725.1 113540 Serratia marcescens 36 ThrA Q89AR4.1 38372169 Buchnera aphidicola str. 37 Bp (Baizongia pistaciae) ThrB NP_414544.1 16127997 Escherichia coli K-12 38 MG1655 ThrB Q8DEP3.1 32129677 Vibrio vulnificus 39 CMCP6 ThrB Q057U7.1 122285538 Buchnera aphidicola 40 BCc ThrC NP_414545.1 16127998 Escherichia coli K-12 41 MG1655 ThrC P44503.1 1174691 Haemophilus influenzae 42 Rd KW20 ThrC P29363.3 12231046 Pseudomonas 43 aeruginosa PAO1
[0202] In some embodiments, aspartate kinases/homoserine dehydrogenases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the aspartate kinase/homoserine dehydrogenase is derived from Escherichia coli K-12 MG1655. In some embodiments, an aspartate kinase/homoserine dehydrogenase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 35 or active fragments or homologues thereof.
[0203] In some embodiments, the aspartate kinase/homoserine dehydrogenase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 44.
[0204] In some embodiments, homoserine kinases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the homoserine kinase is derived from Escherichia coli K-12 MG1655. In some embodiments, a homoserine kinase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 38 or active fragments or homologues thereof.
[0205] In some embodiments, the homoserine kinase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 45.
[0206] In some embodiments, threonine synthases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the threonine synthase is derived from Escherichia coli K-12 MG1655. In some embodiments, a threonine synthase used in a process as described herein comprises an amino acid sequence of SEQ ID NO: 41 or active fragments or homologues thereof.
[0207] In some embodiments, the threonine synthase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 46.
[0208] In some embodiments, 2-ketobutyrate is the starting metabolite for the production of longer chain precursor 2-ketoacids by pathways disclosed herein. In some embodiments, 2-ketobutyrate is produced by dehydration of L-threonine.
[0209] In some embodiments, 2-ketobutyrate is produced by dehydration of L-threonine by threonine dehydratase (IlvA) (EC 4.3.1.19) to yield water and 2-aminobut-2-enoate, which spontaneously converts into 2-ketobutyrate. Over expression of threonine dehydratase leads to increased levels of 2-ketobutyrate [Mak, W. S., et al., Integrative genomic mining for enzyme function to enable engineering of a non-natural biosynthetic pathway. Nat Commun, 2015. 6: p. 10005.; Rodriguez, G. M. and S. Atsumi, Toward aldehyde and alkane production by removing aldehyde reductase activity in Escherichia coli. Metab Eng, 2014. 25: p. http://blast.ncbi.nlm.nih.gov/Blast.cgi227-37.; Zhang, K., et al., Expanding metabolism for biosynthesis of nonnatural alcohols. Proc Natl Acad Sci USA, 2008. 105(52): p. 20653-8.]. TABLE 5 illustrates exemplary threonine dehydratases.
TABLE-US-00006 TABLE 5 Protein Genebank ID GI number Organism SEQ ID NO IlvA NP_418220 16131630 Escherichia coli K-12 MG1655 47 IlvA Q9CKJ2.1 20140770 Pasteurella multocida subsp. multocida 48 str. Pm70 IlvA P53607.1 1729930 Burkholderia multivorans ATCC 49 17616
[0210] In some embodiments, threonine dehydratase as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the threonine dehydratase is derived from Escherichia coli K-12 MG1655. In some embodiments, a threonine dehydratase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 47 or active fragments or homologues thereof.
[0211] In some embodiments, the threonine dehydratase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 50.
[0212] In some embodiments, 2-ketoacids of different chain length are the starting metabolites for the production of longer chain precursor aldehydes by pathways disclosed herein. In some embodiments, 2-ketoacids are produced by multiple reactions starting from 2-ketobutyrate.
[0213] In some embodiments, 2-ketoacids such as 2-ketovalerate, 2-ketoheptanoic acid and 2-ketooctanoic acid are produced from 2-ketobutyrate by sequential reactions catalyzed by 2-isopropylmalate synthase (LeuA) (EC 2.3.3.13), isopropylmalate dehydratase (LeuC) (EC 4.2.1.33; 4.2.1.35) and/or 3-isopropylmalate dehydrogenase (LeuB) (EC 1.1.1.85). Each cycle requires one acetyl-CoA and leads to chain elongation. In some embodiments, longer chains are produced by passing the cycle several times. Over expression of the enzymes (e.g., 2-isopropylmalate synthase, isopropylmalate dehydratase, and/or 3-isopropylmalate) dehydrogenase can lead to increased levels of 2-ketoacid production [Mak, W. S., et al., Integrative genomic mining for enzyme function to enable engineering of a non-natural biosynthetic pathway. Nat Commun, 2015. 6: p. 10005.; Rodriguez, G. M. and S. Atsumi, Toward aldehyde and alkane production by removing aldehyde reductase activity in Escherichia coli. Metab Eng, 2014. 25: p. http://blast.ncbi.nlm.nih.gov/Blast.cgi 227-37.; Zhang, K., et al., Expanding metabolism for biosynthesis of nonnatural alcohols. Proc Natl Acad Sci USA, 2008. 105(52): p. 20653-8.]. TABLE 6 illustrates examples of isopropylmalate synthases, isopropylmalate dehydratases and 3-isopropylmalate dehydrogenases.
TABLE-US-00007 TABLE 6 Genebank GI SEQ Protein ID number Organism ID NO LeuA NP_414616.1 16128068 Escherichia coli K-12 51 MG1655 LeuA Q9ZEY8.3 11182435 Buchnera aphidicola 52 str. APS LeuA Q47BI0.1 123626799 Dechloromonas 53 aromatica RCB LeuB NP_414615.4 90111082 Escherichia coli K-12 54 MG1655 LeuB Q4QLS3.1 81335999 Haemophilus influenzae 55 86-028NP LeuB Q8PH05.1 24211902 Xanthomonas axonopodis 56 pv. citri str. 306 LeuC NP_414614.1 16128066 Escherichia coli K-12 57 MG1655 LeuC B1KKZ2.1 226736001 Shewanella woodyi 58 ATCC 51908 LeuC A6WXG4.1 166989645 Ochrobactrum anthropi 59 ATCC 49188 LeuD NP_414613.1 16128065 Escherichia coli K-12 60 MG1655 LeuD C4LAV4.1 259494466 Tolumonas auensis 61 DSM 9187 LeuD C0ZCK0.1 254809060 Brevibacillus brevis 62 NBRC 100599
[0214] In some embodiments, 2-isopropylmalate synthases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the 2-isopropylmalate synthase is derived from Escherichia coli K-12 MG1655. In some embodiments, a 2-isopropylmalate synthase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 51 or active fragments or homologues thereof.
[0215] In some embodiments, the 2-isopropylmalate synthase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 63.
[0216] In some embodiments, 3-isopropylmalate dehydrogenases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the 3-isopropylmalate dehydrogenase is derived from Escherichia coli K-12 MG655. In some embodiments, a 3-isopropylmalate dehydrogenase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 54 or active fragments or homologues thereof.
[0217] In some embodiments, the 3-isopropylmalate dehydrogenase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 64.
[0218] In some embodiments, 3-isopropylmalate dehydratases as described herein are derived from microorganisms of the genus Escherichia. In some embodiments, the 3-isopropylmalate dehydratase is derived from Escherichia coli K-12 MG1655. In some embodiments, a 3-isopropylmalate dehydratase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 57 or active fragments or homologues thereof. In some embodiments, a isopropylmalate dehydratase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 60 or active fragments or homologues thereof.
[0219] In some embodiments, the isopropylmalate dehydratases is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 65.
[0220] In some embodiments, the starting aldehyde of any one of the pathways disclosed herein is butyraldehyde. In some embodiments, the butyraldehyde is a natural metabolite. In some embodiments, the butyraldehyde is produced by decarboxylation of 2-ketovalerate.
[0221] In some embodiments, butyraldehyde is produced by the decarboxylation of 2-ketovalerate by alpha-ketoacid decarboxylase (KDC) (EC 4.1.1.74) to yield butyraldehyde and carbon dioxide. KDC (KivD) from lactococcus lactis lactis KF147 has broad substrate specificity, ranging from keto-propionic acid to keto-octonoic acid, with highest activity observed for keto-valerate. [Mak, W. S., et al., Integrative genomic mining for enzyme function to enable engineering of a non-natural biosynthetic pathway. Nat Commun, 2015. 6: p. 10005.]. TABLE 7 illustrates examples of alpha-ketoacid decarboxylases.
TABLE-US-00008 TABLE 7 Genebank SEQ Protein ID GI number Organism ID NO KivD ADA65057.1 281375551 Lactococcus lactis 66 lactis KF147 Indolepyruvate P23234.1 118333 Enterobacter cloacae 67 decarboxylase KDC A0R480.1 189028401 Mycobacterium 68 smegmatis str. MC2 155
[0222] In some embodiments, alpha-ketoacid decarboxylases as described herein are derived from microorganisms of the genus Lactococcus. In some embodiments, the alpha-ketoacid decarboxylase is derived from Lactococcus lactis lactis KF147. In some embodiments, a alpha-ketoacid decarboxylase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 66 or active fragments or homologues thereof.
[0223] In some embodiments, the alpha-ketoacid decarboxylase a is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 69.
[0224] In some embodiments, butyraldehyde is obtained by the decarboxylation of 2-ketovalerate by KDC. In some embodiments, butyraldehyde is (alternatively or additionally) obtained by one or more of the reaction pathways identified in TABLE 8.
TABLE-US-00009 TABLE 8 Kegg reaction ID Enzyme Name EC number Reaction R01172 butanal: NAD+ 1.2.1.10; Butanal + CoA + oxidoreductase 1.2.1.57; NAD+ <=> (CoA-acylating) 1.2.1.87 Butanoyl-CoA + NADH + H+ R01173 butanal: NADP+ 1.2.1.57 Butanal + CoA + oxidoreductase NADP+ <=> (CoA-acylating Butanoyl-CoA + NADPH + H+ R01172 butanal: NAD+ 1.2.1.10; Butanal + CoA + oxidoreductase 1.2.1.57; NAD+ <=> (CoA-acylating) 1.2.1.87 Butanoyl-CoA + NADH + H+ R03544 butanol 1.1.1.- Butanal + NADH + dehydrogenase H+ <=> 1-Butanol + NAD+ R03545 butanol 1.1.1.- Butanal + dehydrogenase NADPH + H+ <=> 1-Butanol + NADP+
[0225] In some embodiments, hexanal is produced by the decarboxylation of 2-ketoheptanal by a mutated alpha-ketoacid decarboxylase (KDC) (EC 4.1.1.74) to yield hexanal and carbon dioxide. Three mutations G402V, M538L and F542V in KDC (KivD) from lactococcus lactis lactis KF147 changes substrate specificity towards longer chain alpha-ketoacids, ranging from keto-hexanoic acid to keto-octonoic acid, with highest activity observed for keto-heptanoic acid. [Mak, W. S., et al., Integrative genomic mining for enzyme function to enable engineering of a non-natural biosynthetic pathway. Nat Commun, 2015. 6: p. 10005.].
[0226] In some embodiments, mutated KDCs showing high homology to KivD from Lactococcus lactis lactis KF147 might be used. Mutations include the following: G402V, M538L and F542. Amino acid positions are based on SEQ ID NO: 66.
[0227] In some embodiments, mutated alpha-ketoacid decarboxylases as described herein are derived from microorganisms of the genus Lactococcus. In some embodiments, the mutated alpha-ketoacid decarboxylase is derived from Lactococcus lactis lactis KF147. In some embodiments, a mutated alpha-ketoacid decarboxylase as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 68 or active fragments or homologues thereof.
[0228] In some embodiments, the mutated alpha-ketoacid decarboxylase is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 70 or 79.
[0229] In some embodiments, the starting aldehyde of any one of the pathways disclosed herein is acetaldehyde which is a common central metabolite, or may be produced by decarboxylation of pyruvate.
[0230] In some embodiments, acetaldehyde is produced by the decarboxylation of pyruvate by pyruvate decarboxylase (PDC) (EC 4.1.1.1) to yield acetaldehyde and carbon dioxide. In some embodiments, the non-naturally occurring microorganism comprises a decarboxylase capable of the decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide. PDC from S. cerevisiae has a broad substrate range for aliphatic 2-keto acids. It has been extensively studied, engineered, and expressed in E. coli [Candy, J. M., Duggleby, R. G., & Mattick, J. S. (1991). Expression of active yeast pyruvate decarboxylase has also been studied. Journal of General Microbiology, (137), 5-9; Killenberg-Jabs, M., Knig, S., Hohmann, S., & Hbner, G. (1996). Purification and characterization of the pyruvate decarboxylase from a haploid strain of S. cerevisiae has been reported. [Biological Chemistry Hoppe-Seyler, 377(5), 313-7]. PDC from Zymomonas mobilis also has a broad substrate range for 2-keto acids, and has been extensively studied and expressed in Escherichia coli [Pohl, M., Siegert, P., Mesch, K., Bruhn, H., & Grotzinger, J. (1998). The role of residues glutamate-50 and phenylalanine-496 in Zymomonas mobilis pyruvate decarboxylase, the promoter and nucleotide sequences of the Zymomonas mobilis pyruvate decarboxylase, and the active site mutants of pyruvate decarboxylase from Zymomonas mobilis have been studied. [The Biochemical Journal, 315, Pt 3, 745-51. Conway, T., Osman, Y. a, Konnan, J. I., Hoffmann, E. M., & Ingram, L. O. (1987); Journal of Bacteriology, 169(3), 949-54. Siegert, P., Mesch, K., & Bruhn, H. (1998); Eur. J. Biochem., 257, 538-546; Candy, J. M., Koga, J., Nixon, P. F., & Duggleby, R. G. (1996)]. The sequence identifiers for the exemplary PDC described herein may be found in TABLE 9 and searched for using the GenBank accession number (GI number).
TABLE-US-00010 TABLE 9 Protein Genebank ID GI number Organism SEQ ID NO PDC WP_011241152 499560369 Zymomonas mobilis 71 PDC P06169.7 30923172 Saccharomyces 72 cerevisiae PDC AEE86169 332660769 Arabidopsis thaliana 73 PDC KLA18896 821638028 Bacillus cereus 74
[0231] In some embodiments, PDCs as described herein are derived from microorganisms of the genus Zymomonas. In some embodiments, the PDC is derived from Zymomonas mobilis. In some embodiments, a PDC as used in a process described herein comprises an amino acid sequence of SEQ ID NO: 71 or active fragments or homologues thereof.
[0232] In some embodiments, the PDC is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 75.
[0233] Pyruvate decarboxylases have also been shown to act on pyruvate for the production of acetaldehyde may include, but are not limited to, benzoylformate decarboxylase (BFD) (EC 4.1.1.7) derived from Pseudomonas putida and branched chain alpha-ketoacid decarboxylase (KDC) derived from Lactococcus lactis [Gocke, D., Graf, T., Brosi, H., Frindi-Wosch, I., Walter, L., Mller, M., & Pohl, M. (2009). Comparative characterisation of thiamine diphosphate-dependent decarboxylases. Journal of Molecular Catalysis B: Enzymatic, 61(1-2), 30-35]. In addition, mutants of PDC and BFD that have been generated by site-directed mutagenesis including but not limited to: PDC I472A, PDC I476F, PDC I472A/I476F, BFD A460I, BFD F464I, and BFD A460I/F464I, have also shown activity on pyruvate towards acetaldehyde formation [Siegert, P., McLeish, M. J., Baumann, M., Iding, H., Kneen, M. M., Kenyon, G. L., & Pohl, M. (2005). Exchanging the substrate specificities of pyruvate decarboxylase from Zymomonas mobilis and benzoylformate decarboxylase from Pseudomonas putida. Protein Engineering, Design & Selection: PEDS, 18(7), 345-57].
[0234] In some embodiments, the non-naturally occurring microorganism further includes: a decarboxylase capable of the decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide. In some embodiments, the decarboxylase comprises a pyruvate decarboxylase (PDC), which may comprise an amino acid sequence of SEQ ID NO: 71 or an active fragment or homologue thereof; benzoylformate decarboxylase (BFD), which may comprise an amino acid sequence or SEQ ID NO: 76 or active fragment or homologue thereof; or alpha-detoacid decarboxylase (KDC), which may comprise an amino acid sequence of SEQ ID NO: 68 or 77 or active fragment or homologue thereof. The microorganism may alternatively or further express an enzyme identified in TABLE 9, and/or TABLE 10.
[0235] In some embodiments, the BFD described herein comprises an amino acid sequence of SEQ ID NO: 76 or active fragment or homologue thereof, and that of the KDC of SEQ ID NO: 68 or 77 or active fragments or homologues thereof.
[0236] In some embodiments, the BFD is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 78. In some embodiments, the KDC is an enzyme comprising an amino acid sequence encoded by a DNA which comprises the nucleotide sequence of SEQ ID NO: 79 or 70. In some embodiments, the processes as described herein are carried out with live cells. In some embodiments, the processes are carried out in vitro with lysed cells or with partially, or with substantially completely purified enzyme, or with purified enzyme. In some embodiments, the processes are carried out with permeabilized cells. In some embodiments, methods are carried out in vitro and the enzyme is immobilized. For example, the enzyme may be immobilized on a support (e.g., solid array) using a linker, such as using a biotin-(strept)avidin complex.
[0237] In some embodiments, the non-naturally occurring microorganism expresses at least one enzyme identified in TABLE 10. In some embodiments, acetaldehyde is obtained by the decarboxylation of pyruvate by PDC. In some embodiments, acetaldehyde is (alternatively or additionally) obtained by one or more of the reaction pathways identified in TABLE 10 below.
TABLE-US-00011 TABLE 10 KEGG REACTION EC ID ENZYME NAME NUMBER REACTION R00025 ethylnitronate: oxygen 2- 1.13.12.16 Ethylnitronate + Oxygen + oxidoreductase (nitrite- Reduced FMN <=> forming) Acetaldehyde + Nitrite + FMN + H2O R00224 pyruvate carboxy-lyase 4.1.1.1 Pyruvate <=> Acetaldehyde + (acetaldehyde-forming) CO2 R00228 acetaldehyde: NAD+ 1.2.1.10 Acetaldehyde + CoA + NAD+ <=> oxidoreductase (CoA- Acetyl-CoA + NADH + H+ acetylating) R00326 acetaldehyde: acceptor 1.2.99.6 Acetaldehyde + Acceptor + H2O <=> oxidoreductase Acetate + Reduced acceptor R00710 Acetaldehyde: NAD+ 1.2.1.3, Acetaldehyde + NAD+ + H2O <=> oxidoreductase 1.2.1.5 Acetate + NADH + H+ R00711 Acetaldehyde: NADP+ 1.2.1.4, Acetaldehyde + NADP+ + H2O <=> oxidoreductase 1.2.1.5, Acetate + NADPH + H+ 1.2.1.- R00746 Ethanol: NADP+ 1.1.1.2, Ethanol + NADP+ <=> oxidoreductase 1.1.1.71 Acetaldehyde + NADPH + H+ R00747 2-Phosphonoacetaldehyde 3.11.1.1 Phosphonoacetaldehyde + H2O <=> phosphonohydrolase Acetaldehyde + Orthophosphate R00748 ethanolamine-phosphate 4.2.3.2 Ethanolamine phosphate + H2O <=> phosphate-lyase (deaminating; Acetaldehyde + Ammonia + acetaldehyde-forming) Orthophosphate R00749 ethanolamine ammonia-lyase 4.3.1.7 Ethanolamine <=> Acetaldehyde + (acetaldehyde-forming) Ammonia R00750 4-hydroxy-2-oxopentanoate 4.1.3.39 Acetaldehyde + Pyruvate <=> 4- pyruvate-lyase (acetaldehyde- Hydroxy-2-oxopentanoate forming) R00751 L-threonine acetaldehyde-lyase 4.1.2.5 L-Threonine <=> Glycine + (glycine-forming) Acetaldehyde R00753 (S)-lactate acetaldehyde-lyase 4.1.2.36 (S)-Lactate <=> Formate + (formate-forming) Acetaldehyde R00754 ethanol: NAD+ oxidoreductase 1.1.1.1, Ethanol + NAD+ <=> 1.1.1.71 Acetaldehyde + NADH + H+ R00755 Pyruvate decarboxylase, TPP 4.1.1.1 Acetaldehyde + Thiamin dependent reaction diphosphate <=> 2-(alpha- Hydroxyethyl)thiamine diphosphate R00799 Nitroethane: oxygen 1.7.3.1 Nitrite + Acetaldehyde + oxidoreductase Hydrogen peroxide <=> Nitroethane + Oxygen + H2O R01019 acetaldehyde: pyrroloquinoline- 1.2.99.3 PQQ + Acetaldehyde + H2O <=> quinone oxidoreductase PQQH2 + Acetate R01066 2-deoxy-D-ribose-5-phosphate 4.1.2.4 2-Deoxy-D-ribose 5-phosphate <=> acetaldehyde-lyase (D- D-Glyceraldehyde 3- glyceraldehyde-3-phosphate- phosphate + Acetaldehyde forming) R01410 Hydrogen cyanide + Acetaldehyde + Ammonia <=> alpha-Aminopropiononitrile + H2O R01841 17alpha-Hydroxyprogesterone 4.1.2.30 17alpha-Hydroxyprogesterone <=> acetaldehyde-lyase Androstenedione + Acetaldehyde R02345 3-Hydroxybutan-2-one: D- 2.2.1.4 Acetoin + D-Ribose 5-phosphate <=> ribose-5-phosphate Acetaldehyde + 1-Deoxy- aldehydetransferase D-altro-heptulose 7-phosphate R03723 24R,24(1)R)-fucosterol- 4.1.2.33 ((24R,24(1)R)-Fucosterol epoxide acetaldehyde-lyase epoxide <=> Desmosterol + (desmosterol-forming) Acetaldehyde R05198 ethanol: cytochrome c 1.1.2.8 Ethanol + 2 Ferricytochrome c <=> oxidoreductase 2 Ferrocytochrome c + Acetaldehyde + 2H+ R05380 acetaldehyde hydro-lyase 4.2.1.112 Acetaldehyde <=> Acetylene + H2O R05381 diethanolamine ethanolamine- 4.3.3.- Ethanolamine + Acetaldehyde <=> lyase (acetaldehyde-forming) Diethanolamine R05382 triethanolamine 4.3.3.- Triethanolamine <=> diethanolamine-lyase Diethanolamine + Acetaldehyde (acetaldehyde-forming) R05565 1.14.15.- 2 Atrazine + Oxygen <=> 2 Deethylatrazine + 2 Acetaldehyde R05567 1.14.15.- 2 Deisopropylatrazine + Oxygen <=> 2 Deisopropyldeethylatrazine + 2 Acetaldehyde R05811 2.1.1.- Cobalt-precorrin 5 + S- Adenosyl-L-methionine + H2O <=> Cobalt-precorrin 6 + S- Adenosyl-L-homocysteine + Acetaldehyde R06171 L-allo-threonine acetaldehyde- 4.1.2.5, L-Allothreonine <=> Glycine + lyase (glycine-forming) 4.1.2.49 Acetaldehyde R06973 4.1.1.- 3-Oxopropanoate <=> Acetaldehyde + CO2 R07247 fluoroacetaldehyde: L-threonine 2.2.1.8 L-Threonine + aldehydetransferase Fluoroacetaldehyde <=> Acetaldehyde + 4-Fluoro-L- threonine R07772 cobalt-precorrin 5A 3.7.1.12 Cobalt-precorrin 5A + H2O <=> acylhydrolase Cobalt-precorrin 5B + Acetaldehyde R08195 D-threonine acetaldehyde-lyase 4.1.2.42 D-Threonine <=> Glycine + (glycine-forming) Acetaldehyde R08196 D-Allothreonine <=> Glycine + Acetaldehyde R08516 17alpha-Hydroxypregnenolone 4.1.2.30 17alpha-Hydroxypregnenolone acetaldehyde-lyase Dehydroepiandrosterone + Acetaldehyde R09127 ethanol: cytochrome c 1.1.2.7 Ethanol + 2 Ferricytochrome cL <=> oxidoreductase Acetaldehyde + 2 Ferrocytochrome cL + 2H+ R09156 chloroethane, donor: oxygen 1.13.12.-, Chloroethane + Oxygen + oxidoreductase (dechlorinating, 1.14.99.39 Reduced acceptor <=> acetaldehyde-forming) Acetaldehyde + Hydrochloric acid + Acceptor + H2O R09479 ethanol: quinone oxidoreductase 1.1.5.5 Ethanol + Ubiquinone <=> Acetaldehyde + Ubiquinol R09524 acetyl-CoA: acetoin O- 2.3.1.190 Acetoin + CoA + NAD+ <=> acetyltransferase Acetaldehyde + Acetyl-CoA + NADH + H+ R09552 ethanol: N,N-dimethyl-4- 1.1.99.36 Ethanol + N,N-Dimethyl-4- nitrosoaniline oxidoreductase nitrosoaniline <=> Acetaldehyde + 4-(Hydroxylamino)-N,N- dimethylaniline R09959 7,8-dihydroneopterin 3- 4.1.2.50 7,8-Dihydroneopterin 3- triphosphate acetaldehyde- triphosphate + H2O <=> 6- lyase (6-carboxy-5,6,7,8- Carboxy-5,6,7,8-tetrahydropterin + tetrahydropterin and Acetaldehyde + Triphosphate triphosphate-forming) R10285 choline trimethylamine-lyase 4.3.99.4 Choline <=> Trimethylamine + (acetaldehyde-forming) Acetaldehyde + H+
[0238] In some embodiments, pyruvate is obtained by one or more of the reaction pathways identified in TABLE 11 below.
TABLE-US-00012 TABLE 11 Kegg reaction ID Enzyme Name EC number Reaction R00006 acetolactate synthase 2.2.1.6 2-Acetolactate + CO2 <=> 2 Pyruvate R00008 4-hydroxy-4-methyl- 4.1.3.17 Parapyruvate <=> 2 Pyruvate 2-oxoglutarate aldolase R00014 pyruvate 1.2.4.1 2.2.1.6 Pyruvate + Thiamin diphosphate <=> dehydrogenase 4.1.1.1 2-(alpha- Hydroxyethyl)thiamine diphosphate + CO2 R00195 diaminopropionate 4.3.1.15 2,3-Diaminopropanoate + H2O <=> ammonia-lyase Pyruvate + 2 Ammonia R00196 L-lactate 1.1.2.3 (S)-Lactate + 2 Ferricytochrome c <=> dehydrogenase Pyruvate + 2 Ferrocytochrome c + 2H+ R00197 D-lactate 1.1.2.4 (R)-Lactate + 2 Ferricytochrome c <=> dehydrogenase Pyruvate + 2 Ferrocytochrome c + 2H+ R00198 D-lactate 1.1.2.5 (R)-Lactate + 2 Ferricytochrome c- dehydrogenase 553 <=> Pyruvate + 2 Ferrocytochrome c-553 + 2H+ R00199 pyruvate, water 2.7.9.2 ATP + Pyruvate + H2O <=> AMP + dikinase Phosphoenolpyruvate + Orthophosphate R00200 pyruvate kinase 2.7.1.40 ATP + Pyruvate <=> ADP + Phosphoenolpyruvate R00203 lactaldehyde 1.2.1.22 Methylglyoxal + NAD+ + H2O <=> dehydrogenase 1.2.1.23 Pyruvate + NADH + H+ R00205 2-oxoaldehyde 1.2.1.49 Methylglyoxal + NADP+ + H2O <=> dehydrogenase Pyruvate + NADPH + H+ (NADP+) R00206 pyruvate, phosphate 2.7.9.1 ATP + Pyruvate + Orthophosphate <=> dikinase AMP + Phosphoenolpyruvate + Diphosphate R00207 pyruvate oxidase 1.2.3.3 Pyruvate + Orthophosphate + Oxygen <=> Acetyl phosphate + Hydrogen peroxide + CO2 R00208 phosphoenolpyruvate 3.1.3.60 Phosphoenolpyruvate + H2O <=> phosphatase Pyruvate + Orthophosphate R00209 pyruvate 1.2.4.1 1.8.1.4 Pyruvate + CoA + NAD+ <=> dehydrogenase 2.3.1.12 Acetyl-CoA + CO2 + NADH + H+ (acetyl-transferring) R00210 pyruvate 1.2.1.51 Pyruvate + CoA + NADP+ <=> dehydrogenase Acetyl-CoA + CO2 + NADPH + (NADP+) H+ R00211 pyruvate oxidase 1.2.3.6 Pyruvate + CoA + Oxygen <=> (CoA-acetylating) Hydrogen peroxide + Acetyl-CoA CO2 R00212 formate C- 2.3.1.54 Acetyl-CoA + Formate <=> CoA + acetyltransferase Pyruvate R00213 carbamoyl-serine 4.3.1.13 O-Carbamoyl-L-serine + H2O <=> ammonia-lyase Pyruvate + 2 Ammonia + CO2 R00214 malate 1.1.1.38 S)-Malate + NAD+ <=> Pyruvate + dehydrogenase 1.1.1.39 CO2 + NADH + H+ (oxaloacetate- decarboxylating) R00215 D-malate 1.1.1.83 (R)-Malate + NAD+ <=> Pyruvate + dehydrogenase CO2 + NADH + H+ (decarboxylating) R00216 malate 1.1.1.40 (S)-Malate + NADP+ <=> dehydrogenase Pyruvate + CO2 + NADPH + H+ (oxaloacetate- decarboxylating) (NADP+) R00217 malate 1.1.1.38 Oxaloacetate <=> Pyruvate + CO2 dehydrogenase 1.1.1.40 (oxaloacetate- 4.1.1.3 decarboxylating) R00218 acetylenedicarboxylate 4.1.1.78 Acetylenedicarboxylate + H2O <=> decarboxylase Pyruvate + CO2 R00219 4.1.1.- 2-Hydroxyethylenedicarboxylate carboxy-lyase (pyruvate-forming R00220 L-serine ammonia- 4.3.1.17 L-Serine <=> Pyruvate + lyase 4.3.1.19 Ammonia R00221 D-serine ammonia- 4.3.1.18 D-Serine <=> Pyruvate + lyase Ammonia R00223 diaminopropionate 4.3.1.15 Serine <=> Pyruvate + Ammonia ammonia-lyase R00224 pyruvate 4.1.1.1 Pyruvate <=> Acetaldehyde + CO2 decarboxylase R00226 acetolactate synthase 2.2.1.6 (S)-2-Acetolactate + CO2 <=> 2 Pyruvate R00237 (S)-citramalyl-CoA 4.1.3.25 (3S)-Citramalyl-CoA <=> Acetyl- lyase CoA + Pyruvate R00258 alanine transaminase 2.6.1.2 L-Alanine + 2-Oxoglutarate <=> Pyruvate + L-Glutamate R00297 D-lactate 1.1.99.6 (R)-Lactate + Acceptor <=> dehydrogenase Pyruvate + Reduced acceptor (acceptor) R00324 acetylpyruvate 3.7.1.6 Acetylpyruvate + H2O <=> hydrolase Acetate + Pyruvate R00325 citramalate lyase 4.1.3.22 (S)-2-Methylmalate <=> Acetate + Pyruvate R00344 pyruvate 6.4.1.1 ATP + Pyruvate + HCO3 <=> carboxylase ADP + Orthophosphate + Oxaloacetate R00350 4-hydroxy-4-methyl- 4.1.3.17 4-Carboxy-4-hydroxy-2- 2-oxoglutarate oxoadipate <=> Oxaloacetate + aldolase Pyruvate R00353 methylmalonyl-CoA 2.1.3.1 Malonyl-CoA + Pyruvate <=> carboxytransferase Acetyl-CoA + Oxaloacetate R00368 strombine 1.5.1.22 N-(Carboxymethyl)-D-alanine + dehydrogenase NAD+ + H2O <=> Glycine + Pyruvate + NADH + H+ R00369 alanine-glyoxylate 2.6.1.44 L-Alanine + Glyoxylate <=> transaminase Pyruvate + Glycine R00396 alanine 1.4.1.1 L-Alanine + NAD+ + H2O <=> dehydrogenase Pyruvate + Ammonia + NADH + H+ R00398 alanopine 1.5.1.17 Alanopine + NAD+ + H2O <=> L- dehydrogenase Alanine + Pyruvate + NADH + H+ R00400 alanine-oxo-acid 2.6.1.12 L-Alanine + Oxaloacetate <=> transaminase Pyruvate + L-Aspartate R00409 methylisocitrate 4.1.3.30 (2S,3R)-3-Hydroxybutane-1,2,3- lyase tricarboxylate <=> Pyruvate + Succinate R00430 pyruvate kinase 2.7.1.40 GTP + Pyruvate <=> GDP + Phosphoenolpyruvate R00452 D-lysopine 1.5.1.16 D-Lysopine + NADP+ + H2O <=> dehydrogenase L-Lysine + Pyruvate + NADPH + H+ R00453 lysine-pyruvate 6- 2.6.1.71 L-Lysine + Pyruvate <=> L-2- transaminase Aminoadipate 6-semialdehyde + L-Alanine R00470 4-hydroxy-2- 4.1.3.16 4-Hydroxy-2-oxoglutarate <=> oxoglutarate 4.1.3.42 Pyruvate + Glyoxylate aldolase R00471 4.1.3.16 4.1.3.16 (4R)-4-Hydroxy-2-oxoglutarate <=> Pyruvate + Glyoxylate R00532 serine-sulfate 4.3.1.10 L-Serine O-sulfate + H2O <=> ammonia-lyase Pyruvate + Ammonia + Sulfate R00543 acylpyruvate 3.7.1.5 3-Acylpyruvate + H2O <=> hydrolase Carboxylate + Pyruvate R00562 D-octopine 1.5.1.11 D-Octopine + NAD+ + H2O <=> dehydrogenase L-Arginine + Pyruvate + NADH + H+ R00572 pyruvate kinase 2.7.1.40 CTP + Pyruvate <=> CDP + Phosphoenolpyruvate R00576 glutamine- 2.6.1.15 L-Glutamine + Pyruvate <=> 2- pyruvate Oxoglutaramate + L-Alanine transaminase R00585 serine-pyruvate 2.6.1.51 L-Serine + Pyruvate <=> transaminase Hydroxypyruvate + L-Alanine R00659 pyruvate kinase 2.7.1.40 UTP + Pyruvate <=> UDP + Phosphoenolpyruvate R00666 N5- 1.5.1.24 N5-(L-1-Carboxyethyl)-L- (carboxyethyl)ornithine ornithine + NADP+ + H2O <=> L- synthase Ornithine + Pyruvate + NADPH + H+ R00673 Tryptophanase 4.1.99.1 L-Tryptophan + H2O <=> Indole + Pyruvate + Ammonia R00692 phenylalanine(histidine) 2.6.1.58 L-Phenylalanine + Pyruvate <=> transaminase Phenylpyruvate + L-Alanine R00703 L-lactate 1.1.1.27 (S)-Lactate + NAD+ <=> Pyruvate + dehydrogenase NADH + H+ R00704 D-lactate 1.1.1.28 (R)-Lactate + NAD+ <=> Pyruvate + dehydrogenase NADH + H+ R00724 pyruvate kinase 2.7.1.40 ITP + Pyruvate <=> IDP + Phosphoenolpyruvate R00728 tyrosine phenol- 4.1.99.2 L-Tyrosine + H2O <=> Phenol + lyase Pyruvate + Ammonia R00750 4-hydroxy-2- 4.1.3.39 Acetaldehyde + Pyruvate <=> 4- oxovalerate aldolase Hydroxy-2-oxopentanoate R00782 cystathionine 4.4.1.1 4.4.1.8 L-Cysteine +H2O <=> Hydrogen gamma-lyase 4.4.1.28 sulfide + Pyruvate + Ammonia R00906 beta-alanopine 1.5.1.26 beta-Alanopine + NAD+ + H2O <=> dehydrogenase beta-Alanine + Pyruvate + NADH + H+ R00907 beta-alanine- 2.6.1.18 L-Alanine + 3-Oxopropanoate <=> pyruvate Pyruvate + beta-Alanine transaminase R00930 methylmalonyl-CoA 2.1.3.1 (S)-Methylmalonyl-CoA + carboxytransferase Pyruvate <=> Propanoyl-CoA + Oxaloacetate R00985 anthranilate synthase 4.1.3.27 Chorismate + Ammonia <=> Anthranilate + Pyruvate + H2O R00986 anthranilate synthase 4.1.3.27 Chorismate + L-Glutamine <=> Anthranilate + Pyruvate + L- Glutamate R01012 phosphoenolpyruvate- 2.7.1.121 Phosphoenolpyruvate + Glycerone <=> glycerone Pyruvate + Glycerone phosphotransferase phosphate R01031 3-chloro-D-alanine 4.5.1.2 3-Chloro-D-alanine + H2O <=> dehydrochlorinase Pyruvate + Hydrochloric acid + Ammonia R01032 unclear Cl + Pyruvate + Ammonia <=> 3- reaction Chloro-L-alanine + H2O R01064 2-dehydro-3-deoxy- 4.1.2.21 2-Dehydro-3-deoxy-6-phospho-D- 6- 4.1.2.55 galactonate <=> Pyruvate + D- phosphogalactonate Glyceraldehyde 3-phosphate aldolase R01085 acylpyruvate 3.7.1.5 3-Fumarylpyruvate + H2O <=> hydrolase 3.7.1.20 Fumarate + Pyruvate R01138 pyruvate kinase 2.7.1.40 dATP + Pyruvate <=> dADP + Phosphoenolpyruvate R01147 Pyridoxamine-5- Pyridoxamine phosphate + phosphate: 2- Pyruvate <=> Pyridoxal phosphate + oxoglutarate D-Alanine aminotransferase R01148 D-amino-acid 2.6.1.21 D-Alanine + 2-Oxoglutarate <=> transaminase Pyruvate + D-Glutamate R01196 pyruvate synthase 1.2.7.1 2 Reduced ferredoxin + Acetyl- 1.2.7.11 CoA + CO2 + 2H+ <=> 2 Oxidized ferredoxin + Pyruvate + CoA R01215 valine-pyruvate 2.6.1.66 L-Valine + Pyruvate <=> 3- transaminase Methyl-2-oxobutanoic acid + L- Alanine R01261 alanine-oxo-acid 2.6.1.12 L-Alanine + 2-Oxo acid <=> transaminase Pyruvate + L-Amino acid R01286 cystathionine beta- 4.4.1.8 L-Cystathionine + H2O <=> L- lyase Homocysteine + Ammonia + Pyruvate R01302 chorismate lyase 4.1.3.40 4-Hydroxybenzoate + Pyruvate <=> Chorismate R01335 3.7.1.- Glycolate + Pyruvate <=> 5- Hydroxy-2,4-dioxopentanoate + H2O R01344 D-amino-acid 2.6.1.21 D-Amino acid + Pyruvate <=> 2- transaminase Oxo acid + D-Alanine R01355 2,3-dimethylmalate 4.1.3.32 (2R,3S)-2,3-Dimethylmalate <=> lyase Propanoate + Pyruvate R01447 lactate-malate 1.1.99.7 (S)-Lactate + Oxaloacetate <=> transhydrogenase (S)-Malate + Pyruvate R01576 3-deoxy-D-manno- 4.1.2.23 3-Deoxy-D-manno-octulosonate <=> octulosonate Pyruvate + D-Arabinose aldolase R01584 N-methylalanine 1.4.1.17 N-Methyl-L-alanine + H2O + dehydrogenase NADP+ <=> Pyruvate + Methylamine + NADPH + H+ R01645 4-hydroxy-2- 4.1.2.52 4-Hydroxy-2-oxo-heptanedioate <=> oxoheptanedioate Succinate semialdehyde + aldolase Pyruvate R01647 4-hydroxy-2- 4.1.2.52 Succinate semialdehyde + oxoheptanedioate Pyruvate <=> 2,4-Dihydroxyhept- aldolase 2-enedioate R01683 tauropine 1.5.1.23 Tauropine + NAD+ + H2O <=> dehydrogenase Taurine + Pyruvate + NADH + H+ R01699 pyruvate 1.2.4.1 Pyruvate + Enzyme N6- dehydrogenase (lipoyl)lysine <=> (acetyl-transferring) [Dihydrolipoyllysine-residue acetyltransferase] S- acetyldihydrolipoyllysine + CO2 R01712 pyridoxamine- 2.6.1.30 Pyridoxamine + Pyruvate <=> pyruvate Pyridoxal + L-Alanine transaminase R01782 2-dehydro-3-deoxy- 4.1.2.28 2-Dehydro-3-deoxy-D-xylonate <=> D-pentonate aldolase Pyruvate + Glycolaldehyde R01784 2-dehydro-3-deoxy- 4.1.2.18 2-Dehydro-3-deoxy-L-arabinonate <=> L-pentonate aldolase Pyruvate + Glycolaldehyde R01811 N-acetylneuraminate 4.1.3.3 N-Acetylneuraminate <=> N- lyase Acetyl-D-mannosamine + Pyruvate R01858 pyruvate kinase 2.7.1.40 dGTP + Pyruvate <=> dGDP + Phosphoenolpyruvate R01874 D-cysteine 4.4.1.15 D-Cysteine + H2O <=> Hydrogen desulfhydrase sulfide + Ammonia + Pyruvate R02050 (R)-3-amino-2- 2.6.1.40 (R)-3-Amino-2-methylpropanoate + methylpropionate- Pyruvate <=> 2-Methyl-3- pyruvate oxopropanoate + L-Alanine transaminase R02261 2-keto-3-deoxy-L- 4.1.2.53 2-Dehydro-3-deoxy-L-rhamnonate <=> rhamnonate aldolase (S)-Lactaldehyde + Pyruvate R02271 aminolevulinate 2.6.1.43 5-Aminolevulinate + Pyruvate <=> transaminase 4,5-Dioxopentanoate + L-Alanine R02293 diaminobutyrate- 2.6.1.46 L-2,4-Diaminobutanoate + pyruvate Pyruvate <=> L-Aspartate 4- transaminase semialdehyde + L-Alanine R02320 pyruvate kinase 2.7.1.40 Nucleoside triphosphate + Pyruvate <=> NDP + Phosphoenolpyruvate R02408 cystathionine 4.4.1.1 4.4.1.8 L-Cystine + H2O <=> Pyruvate + gamma-lyase Ammonia + Thiocysteine R02628 phosphoenolpyruvate- 2.7.3.9 Phosphoenolpyruvate + Protein protein histidine <=> Pyruvate + Protein phosphotransferase N(pi)-phospho-L-histidine R02721 unclear D-Glyceraldehyde 3-phosphate + reaction Pyruvate <=> 5-(2-Hydroxyethyl)- 4-methylthiazole R02754 2-dehydro-3- 4.1.2.20 5-Dehydro-4-deoxy-D-glucarate <=> deoxyglucarate Pyruvate + 2-Hydroxy-3- aldolase oxopropanoate R02953 S-alkylcysteine lyase 4.4.1.6 S-Alkyl-L-cysteine + H2O <=> Alkyl thiol + Ammonia + Pyruvate R02970 alanine- 2.6.1.47 Pyruvate + Aminomalonate <=> L- oxomalonate Alanine + Oxomalonate transaminase R03001 D-methionine- 2.6.1.41 D-Methionine + Pyruvate <=> 4- pyruvate Methylthio-2-oxobutanoic acid + transaminase L-Alanine R03037 Isochorismatase 3.3.2.1 Isochorismate + H2O <=> (2S,3S)- 2,3-Dihydro-2,3- dihydroxybenzoate + Pyruvate R03050 acetolactate synthase 2.2.1.6 2-Acetolactate + Thiamin diphosphate <=> 2-(alpha- Hydroxyethyl)thiamine diphosphate + Pyruvate R03081 2-dehydro-3-deoxy- 4.1.2.18 2-Dehydro-3-deoxy-D-fuconate <=> L-pentonate aldolase Pyruvate + (R)-Lactaldehyde R03105 3-mercaptopyruvate 2.8.1.2 Mercaptopyruvate + Sulfite <=> sulfurtransferase Thiosulfate + Pyruvate R03106 3-mercaptopyruvate 2.8.1.2 Hydrogen cyanide + sulfurtransferase Mercaptopyruvate <=> Thiocyanate + Pyruvate R03145 pyruvate 1.2.5.1 Pyruvate + Ubiquinone + H2O <=> dehydrogenase Acetate + Ubiquinol + CO2 (quinone) R03277 2-dehydro-3- 4.1.2.20 2-Hydroxy-3-oxopropanoate + deoxyglucarate Pyruvate <=> 2-Dehydro-3-deoxy- aldolase D-glucarate R03465 4-(2- 4.1.2.34 (3E)-4-(2-Carboxyphenyl)-2- carboxyphenyl)-2- oxobut-3-enoate + H2O <=> 2- oxobut-3-enoate Carboxybenzaldehyde + Pyruvate aldolase R03502 1D-1-guanidino-3- 2.6.1.56 1D-1-Guanidino-3-amino-1,3- amino-1,3-dideoxy- dideoxy-scyllo-inositol + Pyruvate <=> scyllo-inositol 1D-1-Guanidino-1-deoxy-3- transaminase dehydro-scyllo-inositol + L-Alanine R03528 cysteine-S-conjugate 4.4.1.13 L-Cysteine-S-conjugate + H2O <=> beta-lyase Aryl thiol + Ammonia + Pyruvate R03732 opine dehydrogenase 1.5.1.28 (2S)-2-{[1-(R)- Carboxyethyl]amino}pentanoate + NAD+ + H2O <=> L-Norvaline + Pyruvate + NADH + H+ R03796 oximinotransferase 2.6.3.1 Pyruvate oxime + Acetone <=> Pyruvate + Acetone oxime R03854 2,2-dialkylglycine 4.1.1.64 2,2-Dialkylglycine + Pyruvate <=> decarboxylase Dialkyl ketone + CO2 + L-Alanine (pyruvate) R04152 2- 2.6.1.37 2-Aminoethylphosphonate + aminoethylphosphonate- Pyruvate <=> pyruvate Phosphonoacetaldehyde + L-Alanine transaminase R04187 beta-alanine- 2.6.1.18 L-Alanine + (S)-Methylmalonate pyruvate semialdehyde <=> Pyruvate + L-3- transaminase Aminoisobutanoate R04672 acetolactate synthase 2.2.1.6 (S)-2-Acetolactate + Thiamin diphosphate <=> 2-(alpha- Hydroxyethyl)thiamine diphosphate + Pyruvate R04861 non-enzymatic 3-Sulfinylpyruvate + H2O <=> Sulfite + Pyruvate R04941 cystathionine beta- 4.4.1.8 L-Selenocystathionine + H2O <=> lyase Selenohomocysteine + Ammonia + Pyruvate R05136 trans-o- 4.1.2.45 Salicylaldehyde + Pyruvate <=> hydroxybenzylidene trans-o- pyruvate hydratase- Hydroxybenzylidenepyruvate + aldolase H2O R05298 4-hydroxy-2- 4.1.3.43 Propanal + Pyruvate <=> 4- oxohexanoate Hydroxy-2-oxohexanoic acid aldolase R05538 aldorase 2-Hydroxy-4-(1-oxo-1,3-dihydro- reaction 2H-inden-2-ylidene)-but-2-enoic acid + H2O <=> 2-Formyl-1- indanone + Pyruvate R05544 2-Hydroxy-4-(2-oxo-1,3-dihydro- 2H-inden-1-ylidene)but-2-enoic acid + H2O <=> 1-Formyl-2- indanone + Pyruvate R05553 aminodeoxychorismate 4.1.3.38 4-Amino-4-deoxychorismate <=> lyase 4-Aminobenzoate + Pyruvate R05605 2-dehydro-3-deoxy- 4.1.2.14 2-Dehydro-3-deoxy-6-phospho-D- phosphogluconate 4.1.2.55 gluconate <=> D-Glyceraldehyde aldolase 3-phosphate + Pyruvate R05636 1-deoxy-D-xylulose- 2.2.1.7 Pyruvate + D-Glyceraldehyde 3- 5-phosphate phosphate <=> 1-Deoxy-D- synthase xylulose 5-phosphate + CO2 R05648 4.1.2.- cis-4-(1-Hydroxynaphth-2-yl)-2- oxobut-3-enoate + H2O <=> 1- Hydroxy-2-naphthaldehyde + Pyruvate R05652 taurine-pyruvate 2.6.1.77 Taurine + Pyruvate <=> aminotransferase Sulfoacetaldehyde + L-Alanine R05861 D-amino-acid 1.4.3.3 D-Alanine + H2O + Oxygen <=> oxidase 1.4.3.19 Pyruvate + Ammonia + Hydrogen peroxide R06602 isochorismate lyase 4.2.99.21 Isochorismate <=> Salicylate + Pyruvate R06603 Chorismate <=> Salicylate + Pyruvate R06913 4.2.1.- 2-Hydroxy-3- methylbenzalpyruvate + H2O <=> 3-Methylsalicylaldehyde + Pyruvate R06923 4.2.1.- 2-Hydroxy-3- carboxybenzalpyruvate + H2O <=> 3-Formylsalicylic acid + Pyruvate R06934 4.2.1.- 2-Hydroxy-4- hydroxymethylbenzalpyruvate + H2O <=> 4- Hydroxymethylsalicylaldehyde + Pyruvate R07399 (R)-citramalate 2.3.1.182 Acetyl-CoA + Pyruvate + H2O <=> synthase (R)-2-Methylmalate + CoA R07633 (2R)-sulfolactate 4.4.1.24 3-Sulfolactate <=> Pyruvate + sulfo-lyase HSO3 R07634 L-cysteate sulfo- 4.4.1.25 L-Cysteate + H2O <=> Pyruvate + lyase HSO3 + Ammonia R07685 (Z)-4-(2-Hydroxy-5- sulfonatophenyl)-2-oxo-3- butenoate + 2H2O <=> 5- Sulfosalicylate + Pyruvate R07692 4-(3-Hydroxy-2-naphthyl)-2- oxobut-3-enoic acid + 2H2O <=> 3-Hydroxy-2-naphthoate + Pyruvate R07713 4-(2- 4.1.2.34 (3Z)-4-(2-Carboxyphenyl)-2- carboxyphenyl)-2- oxobut-3-enoate + H2O <=> 2- oxobut-3-enoate Carboxybenzaldehyde + Pyruvate aldolase R08166 2-succinyl-6- 4.2.99.20 2-Succinyl-5-enolpyruvyl-6- hydroxy-2,4- hydroxy-3-cyclohexene-1- cyclohexadiene-1- carboxylate <=> (1R,6R)-6- carboxylate synthase Hydroxy-2-succinylcyclohexa-2,4- diene-1-carboxylate + Pyruvate R08170 4.4.1.- S- (Indolylmethylthiohydroximoyl)- L-cysteine + H2O <=> Indolylmethylthiohydroximate + Pyruvate + Ammonia R08197 arginine-pyruvate 2.6.1.84 L-Arginine + Pyruvate <=> 5- transaminase Guanidino-2-oxopentanoate + L- Alanine R08200 phosphonopyruvate 3.11.1.3 3-Phosphonopyruvate + H2O <=> hydrolase Pyruvate + Orthophosphate R08253 unclear Isoniazid + Pyruvate <=> Isoniazid reaction pyruvate + H2O R08570 2-dehydro-3-deoxy- 4.1.2.51 2-Dehydro-3-deoxy-D-gluconate <=> D-gluconate aldolase 4.1.2.55 D-Glyceraldehyde + Pyruvate R08648 acetolactate synthase 2.2.1.6 Pyruvate + 2-Oxobutanoate <=> (S)-2-Aceto-2-hydroxybutanoate + CO2 R08654 4.4.1.- S-(Phenylacetothiohydroximoyl)- L-cysteine + H2O <=> Phenylacetothiohydroximate + Pyruvate + Ammonia R08660 4.4.1.- S- (Hydroxyphenylacetothiohydroximoyl)- L-cysteine + H2O <=> p- Hydroxyphenylacetothiohydroximate + Pyruvate + Ammonia R08667 4.4.1.- S-(4- Methylthiobutylthiohydroximoyl)- L-cysteine + H2O <=> 4- Methylthiobutylthiohydroximate + Pyruvate + Ammonia R08686 4.4.1.- S-Alkyl-thiohydroximate + H2O <=> Thiohydroximic acid + Pyruvate + Ammonia R08698 spontaneous Dehydroalanine + H2O <=> Pyruvate + Ammonia R08714 2.6.1.- Putrescine + Pyruvate <=> 4- Aminobutyraldehyde + L-Alanine R09048 3 Cadaverine + 4 Pyruvate <=> 17- Oxosparteine + 4 L-Alanine + 3 H2O R09088 Benzoate + Pyruvate <=> Pyruvophenone + CO2 R09238 3.7.1.- cis,cis-2,4-Dihydroxy-5-methyl-6- oxo-2,4-hexadienoate + H2O <=> (S)-Methylmalonate semialdehyde + Pyruvate R09254 phenylalanine(histidine) 2.6.1.58 L-Tyrosine + Pyruvate <=> 3-(4- transaminase Hydroxyphenyl)pyruvate + L- Alanine R09366 cystathionine 4.4.1.1 Se-Methyl-L-selenocysteine + gamma-lyase 4.4.1.13 H2O <=> Pyruvate + Ammonia + Methaneselenol R10147 4-hydroxy- 4.3.3.7 L-Aspartate 4-semialdehyde + tetrahydrodipicolinate Pyruvate <=> (2S,4S)-4-Hydroxy- synthase 2,3,4,5-tetrahydrodipicolinate + H2O R10178 4-aminobutyrate- 2.6.1.96 4-Aminobutanoate + Pyruvate <=> pyruvate Succinate semialdehyde + L- transaminase Alanine R10180 L-tryptophan- 2.6.1.99 L-Tryptophan + Pyruvate <=> pyruvate Indolepyruvate + L-Alanine aminotransferase R10283 4-hydroxy-2- 4.1.3.16 (4S)-4-Hydroxy-2-oxoglutarate <=> oxoglutarate 4.1.3.42 Pyruvate + Glyoxylate aldolase R10487 (S)-dichlorprop 1.14.11.43 (S)-(2,4- dioxygenase (2- Dichlorophenoxy)propanoate + 2- oxoglutarate) Oxoglutarate + Oxygen <=> 2,4- Dichlorophenol + Pyruvate + Succinate + CO2 R10527 (S)-dichlorprop 1.14.11.43 (S)-2-(4-Chloro-2- dioxygenase (2- methylphenoxy)propanoate + 2- oxoglutarate) Oxoglutarate + Oxygen <=> 4- Chloro-2-methylphenol + Pyruvate + Succinate + CO2 R10539 (R)-dichlorprop 1.14.11.44 Mecoprop-P + 2-Oxoglutarate + dioxygenase (2- Oxygen <=> 4-Chloro-2- oxoglutarate) methylphenol + Pyruvate + Succinate + CO2 R10542 (R)-dichlorprop 1.14.11.44 (R)-(2,4- dioxygenase (2- Dichlorophenoxy)propanoate + 2- oxoglutarate) Oxoglutarate + Oxygen <=> 2,4- Dichlorophenol + Pyruvate + Succinate + CO2 R10550 L-threo-3-deoxy- 4.1.2.54 2-Dehydro-3-deoxy-L-galactonate <=> hexylosonate Pyruvate + L-Glyceraldehyde aldolase R10552 tRNA 4- 4.1.3.44 N1-Methylguanine in tRNA(Phe) + demethylwyosine Pyruvate + S-Adenosyl-L- synthase (AdoMet- methionine <=> 4- dependent Demethylwyosine in tRNA(Phe) + L-Methionine + 5'- Deoxyadenosine + CO2 + H2O R10583 Chorismatase 3.3.2.13 Chorismate + H2O <=> (4R,5R)- 4,5-Dihydroxycyclohexa-1(6),2- diene-1-carboxylate + Pyruvate R10597 3-hydroxybenzoate 4.1.3.45 Chorismate <=> 3- synthase Hydroxybenzoate + Pyruvate R10616 2-dehydro-3-deoxy- 4.1.2.51 2-Dehydro-3-deoxy-D-galactonate <=> D-gluconate aldolase 4.1.2.55 Pyruvate + D-Glyceraldehyde R10674 (R)-citramalyl-CoA 4.1.3.46 (3R)-Citramalyl-CoA <=> Acetyl- lyase CoA + Pyruvate R10691 3.7.1.- 2,4-Diketo-3-deoxy-L-fuconate + H2O <=> (S)-Lactate + Pyruvate R10866 1.2.7.- Pyruvate + CoA + Oxidized flavodoxin <=> Acetyl-CoA + CO2 + Reduced flavodoxin R10992 alanine-glyoxylate 2.6.1.44 L-Alanine + 2-Oxobutanoate <=> transaminase Pyruvate + (S)-2-Aminobutanoate R11023 4.4.1.- S-(Hercyn-2-yl)-L-cysteine S-oxide <=> Ergothioneine + Pyruvate + Ammonia R11038 (5-formylfuran-3- 2.6.1.108 (5-Formylfuran-3-yl)methyl yl)methyl phosphate phosphate + L-Alanine <=> [5- transaminase (Aminomethyl)furan-3-yl]methyl phosphate + Pyruvate R11099 2-Iminopropanoate + H2O <=> Pyruvate + Ammonia R11141 3-acetyloctanal 2.2.1.12 Pyruvate + trans-2-Octenal <=> synthase (S)-3-Acetyloctanal + CO2 R11213 2-dehydro-3,6- 4.1.2.58 2-Dehydro-3,6-dideoxy-6-sulfo-D- dideoxy-6- gluconate <=> (2S)-3- sulfogluconate Sulfolactaldehyde + Pyruvate aldolase R11257 maleylpyruvate 3.7.1.23 Maleylpyruvate + H2O <=> hydrolase Maleic acid + Pyruvate
[0239] Microorganisms expressing enzyme(s) as described herein may be provided in various forms, including live forms e.g. in an aqueous solution or in culture medium or in resting forms such as in a freeze dried or tablet form.
[0240] In some embodiments, the method is carried out in culture, with one or more host microorganisms, producing the pathway enzyme(s).
[0241] In some embodiments, there is provided a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase as described herein capable of condensing two aldehyde molecules.
[0242] In some embodiments, there is provided a trans-2-unsaturated aldehyde pathway comprising a condensation step and a dehydration step. In some embodiments, the condensation step comprises the condensation of two aldehyde molecules to a 3-hydroxy aldehyde by using an aldolase. In some embodiments, the dehydration step comprises dehydration of the 3-hydroxy aldehyde to a trans-2-unsaturated aldehyde. In some embodiments, the dehydration step is via spontaneous dehydration. In some embodiments, the dehydration step comprises a dehydratase. In some embodiments, dehydration is aided by dehydratase.
[0243] In some embodiments, there is provided a non-naturally occurring microorganism having a trans-2-unsaturated aldehyde pathway, wherein the microorganism comprises at least one of the following trans-2-unsaturated aldehyde pathway enzymes: an aldolase that catalyzes condensation of two aldehydes to produce 3-hydroxy aldehyde; and a dehydratase that dehydrates the 3-hydroxy aldehyde to trans-2-unsaturated aldehyde (the dehydration step). In some embodiments, the dehydration step is via spontaneous dehydration. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated aldehyde pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified, or naturally-occurring microorganism, or wild-type microorganism. In some embodiments, the trans-2-unsaturated aldehyde is converted to trans-2-unsaturated alcohol or trans-2-unsaturated carboxylic acids by using aldoketoreductases, oxidoreductases, aldehyde reductases or alcohol dehydrogenases. In some embodiments, the microorganism includes at least one exogenous nucleic acid encoding an enzyme from the trans-2-unsaturated aldehyde pathway. In some embodiments, the microorganism further includes a PDC for decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide. In some embodiments, the microorganism expresses an enzyme identified in TABLE 9 and/or TABLE 10 or an active fragment or homologue thereof for producing acetaldehyde. In some embodiments, at least one or all the nucleic acids are exogenous to the host microorganism. In some embodiments, the aldolase is DERA. In some embodiments, the aldolase enzyme is a modified aldolase enzyme comprising an increased enzymatic activity in comparison with a corresponding unmodified or wild-type aldolase enzyme. In some embodiments, the non-naturally occurring microorganism expresses a modified aldolase. In some embodiments, the modified aldolase is a modified DERA. In some embodiments, the microorganism expressing a modified aldolase comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated aldehyde pathway, in comparison with the enzymatic activity of the same enzyme in the wild-type or naturally occurring, or unmodified microorganism. In some embodiments, the non-naturally occurring microorganism is derived from a wild-type or unmodified microorganism and the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated aldehyde pathway, in comparison with the enzymatic activity of the same enzyme in the wild-type microorganism.
[0244] In some embodiments, trans-2-unsaturated aldehyde is produced by direct feeding of precursor aldehydes to cells expressing only aldolase (e.g., DERA or a similar aldolase). In some embodiments, trans-2-unsaturated aldehyde is produced from glucose. In some embodiments, precursor aldehydes are produced by the cell (e.g., via engineered pathways). In some embodiments, the engineered pathways require modification (e.g., expression or overexpression) of at least one gene. In some embodiments, strains (e.g., 2 different strains) are optimized to include at least one gene deletion(s). In some embodiments, acetaldehyde is produced in a cell (e.g., from glucose). In some embodiments, precursor aldehyde molecules (e.g., two precursor aldehydes) are produced from glucose. In some embodiments, precursor aldehyde molecules (e.g., two precursor aldehydes) are fed to the cell. In some embodiments, at least one precursor aldehyde is produced from glucose and at least one precursor aldehyde is fed to the cell. In some embodiments, at least one precursor aldehyde is fed to a cell following production of acetaldehyde from glucose.
[0245] In some embodiments, the trans-2-unsaturated aldehyde is produced by feeding precursor aldehydes to a microbial culture.
[0246] In some embodiments, the aldehyde precursors used for the formation of trans-2-unsaturated aldehyde are produced from glucose by an aldehyde producing pathway.
[0247] In some embodiments, there is provided a pathway for the production of acetaldehyde from glucose. In some embodiments, production of acetaldehyde from glucose is via decarboxylation of pyruvate by pyruvate decarboxylase.
[0248] In some embodiments, there is provided a non-naturally occurring microorganism having a trans-2-unsaturated aldehyde pathway and/or having the ability to produce precursor aldehydes (e.g., aldehydes, acetaldehydes, and butyraldehydes) leading to the production of trans-2-unsaturated aldehyde(s) (e.g., trans-2-hexenal). In some embodiments, the non-naturally occurring microorganism comprises: (a) at least one of the following trans-2-unsaturated aldehyde pathway enzymes: a pyruvate decarboxylase that catalyzes decarboxylation of pyruvate to acetealdehyde, an aspartokinase that catalyzes phosphorylation of L-asparate, a homoserine kinase that catalyzes phosphorylation of L-homoserine to O-phospho-Lhomoserine, a threonine synthase that catalyzes the hydration of O-phospho-Lhomoserine to L-threonine, a threonine desaminase that catalyzes the desamination of L-threonine into 2-ketobutyrate, an isopropylmalate synthase that catalyzes the acetylation of 2-keto butyrate into 2-ethyl malate, an acetohydroxy acid isomeroreductase that catalyzes the formation of 3-ethyl malate from 2-ethylmalate via a 2-ethyl maleate intermediate, an isopropylmalate dehydrogenase that catalyzes the oxidation of 3-ethyl malate into 2-ethyl-3-oxo succinate, and an alphaketoisovalerate decarboxylase that catalyzes the decarboxylation of 2-keto acid (e.g., 2-keto-valerate) into an aldehyde (e.g., butyraldehyde); and (b) at least one of the following enzymes: an aldolase that catalyzes condensation of acetaldehyde and aldehyde (e.g., butyraldehyde) to produce 3-hydroxy aldehyde (e.g., 3-hydroxy hexanal), and a dehydratase that dehydrates the 3-hydroxy aldehyde (e.g., 3-hydroxy hexanal) to trans-2-unsaturated aldehyde (e.g., trans-2-hexenal). In some embodiments, the microorganism comprises an aldolase that is specific for condensation of acetaldehyde and aldehyde to produce 3-hydroxy aldehyde. In some embodiments, the microorganism comprises at least one exogenous nucleic acid encoding an enzyme from said trans-2-unsaturated aldehyde pathway. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified or wild-type microorganism.
[0249] In some embodiments, there is provided a pathway for the production of butyraldehyde from glucose. This can be achieved by over production of L-threonin by overexpression of aspartokinase (thrA), overexpression of homoserine kinase (thrB), and/or overexpression of threonin synthase (thrC). Subsequently threonin can be transformed into butyraldehyde using threonin desaminase (ilvA), isoproylmalate synthase (leuA), isopropylmalate dehydrogenase (leuB), acetohydroxy acid isomeroreductase (leuC, leuD) and alpha-ketoisovalerate decarboxylase (kivD). [Atsumi et al. Non-fermentative pathways for synthesis of branched-chain higher alcohols as biofuels NATURE Vol 451 (2008).]
[0250] In some embodiments, the microorganism further includes a pathway for producing butyraldehyde, wherein the microorganism comprises at least one of the following butyraldehyde pathway enzymes: an aspartokinase that catalyzes phosphorylation of L-asparate, a homoserine kinase that catalyzes phosphorylation of L-homoserine to O-phospho-Lhomoserine, a threonine synthase that catalyzes the hydration of O-phospho-Lhomoserine to L-threonine, a threonine desaminase that catalyzes the desamination of L-threonine into 2-ketobutyrate, an isopropylmalate synthase that catalyzes the acetylation of 2-keto butyrate into 2-ethyl malate, an acetohydroxy acid isomeroreductase that catalyzes the formation of 3-ethyl malate from 2-ethylmalate via a 2-ethyl maleate intermediate, an isopropylmalate dehydrogenase that catalyzes the oxidation of 3-ethyl malate into 2-ethyl-3-oxo succinate, and an alphaketoisovalerate decarboxylase that catalyzes the decarboxylation of 2-keto-valerate into butyraldehyde. In some embodiments, the microorganism expresses an enzyme identified in TABLE 7 or an active fragment or homologue thereof for producing butyraldehyde.
[0251] In some embodiments, the non-naturally occurring microorganism includes at least one modification (e.g., deletion) to an endogenous nucleic acid encoding an enzyme from the trans-2-unsaturated pathway or at least one modification that affects the expression of an enzyme from the trans-2-unsaturated pathway.
[0252] In some embodiments, the non-naturally occurring microorganism includes at least one modification (e.g., deletion) to an endogenous nucleic acid encoding an enzyme effecting production of the trans-2-unsaturated aldehyde or any pathway intermediate.
[0253] In some embodiments, the trans-2-unsaturated aldehyde is converted to trans-2-unsaturated alcohol or trans-2-unsaturated carboxylic acids by using aldoketoreductase, oxidoreductase, aldehyde reductase, or alcohol dehydrogenase, wherein the microorganism includes at least one exogenous nucleic acid encoding an enzyme from said trans-2-unsaturated aldehyde pathway.
[0254] In some embodiments, the microoganism is genetically modified to contain a nucleic acid encoding an alcohol dehydrogenase capable of reducing trans-2-unsaturated aldehydes to trans-2-unsaturated alcohols. In some embodiments, the microoganism is genetically modified to contain a nucleic acid encoding an oxidoreductase capable of oxidizing trans-2-unsaturated aldehydes to trans-2-unsaturated carboxylic acids.
[0255] In some embodiments, a delta lactone pathway is disclosed that comprises: 1) condensation of two aldehyde molecules to a 3-hydroxy aldehyde intermediate using an aldolase enzyme; 2) condensation of the 3-hydroxy aldehyde intermediate and an aldehyde (e.g. acetaldehyde) to a 5,3-dihydroxy aldehyde intermediate using an aldolase enzyme; 3) cyclization of 5,3-dihydroxy aldehyde to form a tetrahydro-2H-pyran-2,4-diol (compound of formula IV(b)); 4) oxidation of tetrahydro-2H-pyran-2,4-diol to a tetrahydro-4-hydroxy-2H-pyran-2-one (compound of formula V); 5) dehydration of the tetrahydro-4-hydroxy-2H-pyran-2-one (compound of formula V) to a 5,6-dihydro-2H-pyran-2-one (compound of formula VI); and 6) reduction of the 5,6-dihydro-2H-pyran-2-one (compound of formula VI) to a delta-lactone (compound of formula VII) using reductase.
[0256] In some embodiments, there is provided a non-naturally occurring microorganism having a delta lactone pathway. The microorganism includes at least one of the following delta lactone pathway enzymes: an aldolase that catalyzes the condensation of two aldehyde molecules to produce 3-hydroxy aldehyde (i.e., step 1); an aldolase that catalyzes condensation of the 3-hydroxy aldehyde intermediate and an aldehyde (e.g. acetaldehyde) to a 5,3-dihydroxy aldehyde intermediate (i.e., step 2); a lactonization enzyme that transforms a 5,3-dihydroxy aldehyde intermediate into a tetrahydro-4-hydroxy-2H-pyran-2-one; a dehydratase that dehydrates the tetrahydro-4-hydroxy-2H-pyran-2-one to a 5,6-dihydro-2H-pyran-2-one; and a reductase that reduces the 5,6-dihydro-2H-pyran-2-one to a delta-lactone. In some embodiments, the microorganism has at least one exogenous nucleic acid encoding an enzyme from said delta-lactone pathway. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the delta lactone pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified, or a naturally occurring microorganism, or wild-type microorganism. In some embodiments, the microorganism further includes a PDC for decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide. In some embodiments, the microorganism expresses an enzyme identified in TABLE 9 and/or TABLE 10, or an active fragment or homologue thereof for producing acetaldehyde. In some embodiments, at least one or all the nucleic acids are exogenous to the host microorganism. In some embodiments, the aldolase is DERA.
[0257] In some embodiments, there is provided a non-naturally occurring microorganism having a delta-lactone pathway. The microorganism includes at least one of the following delta-lactone pathway enzymes: an aldolase that catalyzes condensation of an acetaldehyde and an aldehyde to 3-hydroxy aldehyde (i.e., step 1); an aldolase that catalyzes condensation of the 3-hydroxy aldehyde and an acetaldehyde to 5,3-dihydroxy aldehyde, which undergoes cyclization to form tetrahydro-2H-pyran-2,4-diol (i.e., step 2); an oxidase enzyme that transforms the tetrahydro-2H-pyran-2,4-diol to a tetrahydro-4-hydroxy-2H-pyran-2-one; a dehydratase enzyme that dehydrates the tetrahydro-4-hydroxy-2H-pyran-2-one to a 5,6-dihydro-2H-pyran-2-one. In some embodiments, the microorganism has at least one exogenous nucleic acid encoding an enzyme from said delta-lactone pathway. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the delta lactone pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified, or a naturally occurring microorganism, or wild-type microorganism. In some embodiments, the 5,6-dihydro-2H-pyran-2-one is massoia lactone (e.g., (R)-5,6-Dihydro-6-pentyl-2H-pyran-2-one). In some embodiments the massoia lactone is C-10 massoia lactone. In some embodiments, the massoia lactone is C-12 massoia lactone. In some embodiments, the massoia lactone is C-14 massoia lactone. In some embodiments, the microorganism further includes a PDC for decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide. In some embodiments, the microorganism expresses an enzyme identified in table 3 or an active fragment or homologue thereof for producing acetaldehyde. In some embodiments, at least one or all the nucleic acids are exogenous to the host microorganism. In some embodiments, the aldolase is DERA.
[0258] In some embodiments, the aldolase in step 1 is different from the aldolase in step 2. In some embodiments, the aldolase that catalyzes the condensation of two aldehyde molecules to produce 3-hydroxy aldehyde is different from the aldolase that catalyzes condensation of a 3-hydroxy aldehyde intermediate and an aldehyde (e.g. acetaldehyde) to a 5,3-dihydroxy aldehyde intermediate. In some embodiments, the aldolase in step 1 is the same as the aldolase in step 2. In some embodiments, the aldolase in step 1 and the aldolase in step 2 are both DERA.
[0259] In some embodiments, the delta-lactone is produced by feeding the aldehyde molecules (i.e., precursor aldehydes) to a microbial culture. In some embodiments, the delta-lactone is produced by feeding both aldehyde molecules (i.e., precursor aldehydes) to a microbial culture. In some embodiments, the delta-lactone is produced by feeding at least one aldehyde molecules (i.e., precursor aldehydes) to a microbial culture. In some embodiments, the delta-lactone is produced by feeding one aldehyde molecule (i.e., precursor aldehydes) to a microbial culture.
[0260] In some embodiments, the aldehyde precursors for the formation of delta-lactone are produced from glucose, for example by aldehyde producing pathways. In some embodiments, both aldehyde precursors for the formation of delta-lactone are produced from glucose. In some embodiments, at least one aldehyde precursor for the formation of delta-lactone is produced from glucose. In some embodiments, one aldehyde precursor for the formation of delta-lactone is produced from glucose.
[0261] In some embodiments, there is provided a pathway for the production of acetaldehyde from glucose. In some embodiments, this is achieved by decarboxylation of pyruvate by pyruvate decarboxylase.
[0262] In some embodiments, two aldehyde precursors are fed to the cells (e.g., microbial culture). In some embodiments, two aldehyde precursors are produced from glucose. In some embodiments, at least one aldehyde precursor is produced from glucose and at least one aldehyde precursor is fed to the cell. In some embodiments, one aldehyde precursor is produced from glucose and one aldehyde precursor is fed to the cell.
[0263] In some embodiments, a delta-lactone is produced by feeding precursor aldehydes (e.g., two precursor aldehydes) to cells. In some embodiments, a delta-lactone is produced by feeding precursor aldehydes to cells expressing two engineered aldolases. In some embodiments, the two engineered aldolases are different aldolases. In some embodiments, an aldolase is specific for the first condensation reaction. In some embodiments, the first condensation reaction includes the condensation of two aldehydes. In some embodiments, an aldolase is specific for the condensation of 3-hydroxyaldehyde and aldehyde (i.e., second condensation reaction). In some embodiments, the aldolase specific for the first condensation reaction is different from the aldolase specific for the second condensation reaction. In some embodiments, the aldolases are DERA or derived from DERA. In some embodiments, delta-lactone is produced from glucose. In some embodiments, delta-lactone is produced by producing acetaldehyde in a cell (e.g., from glucose) and feeding at least one aldehyde. In some embodiments, precursor aldehydes are produced by the cell via engineered pathways. In some embodiments, the engineered pathways require modification (e.g., expression or overexpression) of at least one gene. In some embodiments, strains (e.g., 2 different strains) are optimized to include at least one gene deletion(s). In some embodiments, acetaldehyde is produced in a cell (e.g., from glucose). In some embodiments, precursor aldehyde molecules (e.g., two precursor aldehydes) are produced from glucose. In some embodiments, precursor aldehyde molecules (e.g., two precursor aldehydes) are fed to the cell. In some embodiments, at least one precursor aldehyde is produced from glucose and at least one precursor aldehyde is fed to the cell. In some embodiments, at least one precursor aldehyde is fed to a cell following production of acetaldehyde from glucose.
[0264] In some embodiments, the microorganism further includes a pathway for producing hexanal, wherein the microorganism comprises at least one of the hexanal pathway enzymes: an aspartokinase that catalyzes phosphorylation of L-asparate, a homoserine kinase that catalyzes phosphorylation of L-homoserine to O-phospho-Lhomoserine, a threonine synthase that catalyzes the hydration of O-phospho-Lhomoserine to L-threonine, a threonine desaminase that catalyzes the desamination of L-threonine into 2-ketobutyrate, an isopropylmalate synthase that catalyzes the acetylation of 2-keto butyrate into 2-ethyl malate, an acetohydroxy acid isomeroreductase that catalyzes the formation of 3-ethyl malate from 2-ethylmalate via a 2-ethyl maleate intermediate, an isopropylmalate dehydrogenase that catalyzes the oxidation of 3-ethyl malate into 2-ethyl-3-oxo succinate, and a ketoisovalerate decarboxylase that catalyzes decarboxylation of 2-keto-heptanoic acid into hexanal. Decarboxylation of 2-ethyl-3-oxo succinate to 2-ketovalerate may occur spontaneously. In some embodiments, 2-ketovalerate is converted into 2-keto-caproic acid and further into 2-keto-heptanoic acid by the same enzymes (e.g., a hexanal pathway enzyme).
[0265] In some embodiments, there is provided a non-naturally occurring microorganism having a delta-lactone pathway. The microorganism includes at least one of the following delta-lactone pathway enzymes: an aldolase that catalyzes condensation of an acetaldehyde and a hexanal to 3-hydroxy-octanal; an aldolase that catalyzes condensation of the 3-hydroxy-octanal and an acetaldehyde to 5,3-dihydroxy-decanal; a lactonization enzyme and/or a dehydratase enzyme to transform 5,3-dihydroxy-decanal to massoia lactone. In some embodiments, the microorganism has at least one exogenous nucleic acid encoding an enzyme from said delta-lactone pathway. In some embodiments, the microorganism further includes a PDC for decarboxylation of pyruvate to yield acetaldehyde and carbon dioxide. In some embodiments, the microorganism expresses an enzyme identified in TABLE 9 and/or TABLE 10, or an active fragment or homologue thereof for producing acetaldehyde. In some embodiments, at least one or all the nucleic acids are exogenous to the host microorganism. In some embodiments, the aldolase is DERA.
[0266] In some embodiments, the delta-lactone pathway comprises a dehydration step that is spontaneous dehydration. In some embodiments, the dehydration step comprises a dehydratase. In some embodiments, dehydration is a chemically catalyzed dehydration reaction. In some embodiments, dehydration is aided by dehydratase. In some embodiments, the lactonization is spontaneous. In some embodiments, the lactonization is enzymatic. In some embodiments, the lactonization is a non-enzymatic lactonization reaction. In some embodiments, the lactonization is a chemical lactonization reaction.
[0267] In some embodiments, there is provided a pathway for the production of hexanal from glucose. In some embodiments, production of hexanal from glucose can be by at least one of the following: over production of L-threonin, overexpression of aspartokinase (thrA), overexpression of homoserine kinase (thrB), and/or overexpression of threonin synthase (thrC). In some embodiments, threonin can be transformated into hexanal. In some embodiments, threonine is transformed into hexanal using at least one of threonin desaminase (ilvA), isoproylmalate synthase (leuA), isopropylmalate dehydrogenase (leuB), acetohydroxy acid isomeroreductase (leuC, leuD), and alpha-ketoisovalerate decarboxylase (kivD_VLV).
[0268] In some embodiments, there is provided a non-naturally occurring microorganism capable of producing delta-lactone by producing acetaldehyde and other aldehydes from glucose. In some embodiments, the non-naturally occurring microorganism converts the acetaldehyde and aldehyde molecules to delta-lactone using a delta-lactone pathway. In some embodiments, there is provided a non-naturally occurring microorganism capable of producing delta-lactone (e.g., delta-decalactone) by producing acetaldehyde and aldehyde (e.g., hexanal) from glucose and/or converting the acetaldehyde and aldehyde (e.g., hexanal) to delta-lactone (delta-decalactone) using a delta-lactone pathway. The microorganism includes at least one of the following delta-lactone pathway enzymes: a pyruvate decarboxylase that catalyzes decarboxylation of pyruvate to acetealdehyde, an aspartokinase that catalyzes phosphorylation of L-asparate, a homoserine kinase that catalyzes phosphorylation of L-homoserine to O-phospho-Lhomoserine, a threonine synthase that catalyzes the hydration of O-phospho-Lhomoserine to L-threonine, a threonine desaminase that catalyzes the desamination of L-threonine to 2-ketobutyrate, an isopropylmalate synthase that catalyzes the acetylation of 2-keto butyrate to 2-ethyl malate, an acetohydroxy acid isomeroreductase that catalyzes the formation of 3-ethyl malate from 2-ethylmalate via a 2-ethyl maleate intermediate, and an isopropylmalate dehydrogenase that catalyzes the oxidation of 3-ethyl malate to 2-ethyl-3-oxo succinate, and a ketoisovalerate decarboxylase (e.g., engineered enzyme) that catalyzes decarboxylation of 2-keto-acid to aldehyde (e.g., 2-keto-heptanoic acid to hexanal); and (b) at least one of the following enzymes: an aldolase that catalyzes condensation of acetaldehyde and an aldehyde (e.g., hexanal) to produce 3-hydroxy aldehyde (e.g., 3-hydroxyoctanal), an aldolase that catalyzes condensation of the 3-hydroxy aldehyde (e.g., 3-hydroxyoctanal) and acetaldehyde to a 5,3-dihydroxy aldehyde (e.g., a 5,3-dihydroxy decanal intermediate), which undergoes a spontaneous cyclization to form tetrahydro-2H-pyran-2,4-diol (e.g., 6-pentyltetrahydro-2H-pyran-2,4-diol), an oxidase that oxidizes tetrahydro-2H-pyran-2,4-diol (e.g., 6-pentyltetrahydro-2H-pyran-2,4-diol) into tetrahydro-4-hydroxy-2H-pyran-2-one (e.g., 4-hydroxy-6-pentyltetrahydro-2H-pyran-2-one), a dehydratase that dehydrates the tetrahydro-4-hydroxy-2H-pyran-2-one (e.g., 4-hydroxy-6-pentyltetrahydro-2H-pyran-2-one) to 5,6-dihydro-2H-pyran-2-one (e.g., 6-pentyl-5,6-dihydro-2H-pyran-2-one), and a reductase that reduces the 5,6-dihydro-2H-pyran-2-one (e.g., 6-pentyl-5,6-dihydro-2H-pyran-2-one) to a delta-lactone (e.g., delta-decalactone). In some embodiments, decarboxylation of 2-ethyl-3-oxo succinate to 2-ketovalerate occurs spontaneously. In some embodiments, 2-ketovalerate is converted to 2-keto-caproic acid and further to 2-keto-heptanoic acid. In some embodiments, the microorganism has at least one exogenous nucleic acid encoding an enzyme from said delta-lactone pathway.
[0269] In some embodiments, the pathway for aldehyde production is the same, thus involves the same pathway enzymes. For longer aldehydes the product for a first reaction cycle undergoes a second reaction cycle and so forth. Every cycle adds on to the chain length. In some embodiments, the resulting aldehyde is controlled by the co-expressed ketoaldehyde decarboxylase (e.g., GEO175).
[0270] In some embodiments, the non-naturally occurring microorganism includes at least one modification to an endogenous nucleic acid encoding an enzyme from the delta-lactone pathway or affecting the expression of an enzyme from this delta-lactone pathway.
[0271] In some embodiments, the non-naturally occurring microorganism includes at least one modification (e.g., deletion) to an endogenous nucleic acid encoding an enzyme effecting production of the delta lactone or any pathway intermediate.
[0272] In some embodiments, a microorganism is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an aldehyde molecule and a 3-hydroxy-aldehyde molecule to a 5,3-dihydroxyaldehyde.
[0273] In some embodiments, a gamma lactone pathway is disclosed that comprises: 1) condensation of an aldehyde molecule and a pyruvic acid to a 4-hydroxy-2-oxo carboxylic acid using aldolase (e.g. pyruvate-dependent aldolase); 2) reduction of the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid using dehydrogenase or keto-reductase; 3) lactonization of the 2,4-dihydroxy carboxylic acid to a 3-hydroxydihydro-2-(3H)-furanone; 4) dehydration of the 3-hydroxydihydro-2-(3H)-furanone to 2(5H)-furanone (compound of formula XI); and 5) reduction of 2(5H)-furanone (compound of formula XI) to a gamma-lactone (compound of formula XII) using reductase.
[0274] In some embodiments, there is provided a non-naturally occurring microorganism having a gamma-lactone pathway. The microorganism includes at least one of the following gamma-lactone pathway enzymes: an aldolase (e.g. pyruvate-dependent aldolase) that catalyzes condensation of an aldehyde molecule and a pyruvic acid (or pyruvate) to a 4-hydroxy-2-oxo carboxylic acid; a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid; a lactonization enzyme that transforms the 2,4-dihydroxy carboxylic acid to a 3-hydroxydihydro-2-(3H)-furanone; a dehydratase that dehydrates the 3-hydroxydihydro-2-(3H)-furanone to 2(5H)-furanone; and a reductase that reduces the 2(5H)-furanone to a gamma-lactone.
[0275] In some embodiments, there is provided a non-naturally occurring microorganism having a gamma-lactone pathway, wherein the microorganism comprises at least one of the following gamma-lactone pathway enzymes: an aldolase that catalyzes condensation of an aldehyde molecule and a pyruvic acid (or a pyruvate) to a 4-hydroxy-2-oxo carboxylic acid; a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy acid; dehydration (e.g., a dehydration enzyme) of the 2,4-dihydroxy acid to 4-hydroxy-2-ene-acid; a lactonization enzyme that transforms the 4-hydroxy-2-ene acid to 2(5H)-furanone; and a reductase that reduces the 2(5H)-furanone to a gamma-lactone.
[0276] In some embodiments, there is provided a non-naturally occurring microorganism having a gamma-lactone pathway, wherein the microorganism comprises at least one of the following gamma-lactone pathway enzymes: an aldolase (e.g., pyruvate dependent aldolase) that catalyzes condensation of an aldehyde molecule and a pyruvic acid (or pyruvate) to a 4-hydroxy-2-oxo acid; an oxidoreductase that transforms the 4-hydroxy-2-oxo acid to a 2,4-dihydroxy acid; a lactonization enzyme that transforms the 2,4-dihydroxy acid to a 2-hydroxy-gamma-lactone; a dehydratase that dehydrates the 2-hydroxy-gamma-lactone to 5-furan-2(5H)-one; and a reductase that reduces the 5-furan-2(5H)-one to a gamma-lactone (
[0277] In some embodiments, the reductase is enoate reductase. In some embodiments, the microorganism comprises at least one exogenous nucleic acid encoding an enzyme from said gamma-lactone pathway. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the gamma lactone pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified, or a naturally occurring microorganism, or wild-type microorganism.
[0278] In some embodiments, the microorganism further comprises modification to overproduce pyruvic acid. In some embodiments, the microorganism further includes a pathway for producing heptanal, wherein the microorganism comprises at least one of the following heptanal pathway enzymes: an aspartokinase that catalyzes phosphorylation of L-asparate, a homoserine kinase that catalyzes phosphorylation of L-homoserine to O-phospho-Lhomoserine, a threonine synthase that catalyzes the hydration of O-phospho-Lhomoserine to L-threonine, a threonine desaminase that catalyzes the desamination of L-threonine into 2-ketobutyrate, an isopropylmalate synthase that catalyzes the acetylation of 2-keto butyrate into 2-ethyl malate, an acetohydroxy acid isomeroreductase that catalyzes the formation of 3-ethyl malate from 2-ethylmalate via a 2-ethyl maleate intermediate, and an isopropylmalate dehydrogenase that catalyzes the oxidation of 3-ethyl malate into 2-ethyl-3-oxo succinate. Decarboxylation of 2-ethyl-3-oxo succinate to 2-ketovalerate may occur spontaneously. 2-ketovalerate is converted into 2-keto-caproic acid, into 2-keto-heptanoic acid, and further into 2-keto-octanoic acid by the same enzymes (e.g., a heptanal pathway enzyme), and an engineered ketoisovalerate decarboxylase that catalyzes decarboxylation of 2-keto-octanoic acid into heptanal.
[0279] In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase (e.g. pyruvate-dependent aldolase) capable of condensing an aldehyde molecule and a pyruvic acid (or pyruvate) to 4-hydroxy-2-oxo carboxylic acid.
[0280] In some embodiments, the gamma-lactone pathway comprises a dehydration step that is spontaneous dehydration. In some embodiments, the dehydration step comprises a dehydratase. In some embodiments, dehydration is a chemically catalyzed dehydration reaction. In some embodiments, the lactonization is spontaneous. In some embodiments, the lactonization is enzymatic. In some embodiments, the lactonization is a non-enzymatic lactonization reaction. In some embodiments, the lactonization is a chemically catalyzed lactonization reaction.
[0281] In some embodiments, the gamma-lactone is produced by feeding the aldehyde molecule (i.e., precursor aldehyde) to a microbial culture (e.g., fed to the cells). In some embodiments, the precursor aldehyde is produced from glucose. In some embodiments, the precursor aldehyde is fed to the cell. In some embodiments, the pyruvate and/or pyruvic acid is produced from glucose. In some embodiments, the pyruvate and/or pyruvic acid is fed to the cell. In some embodiments, both the aldehyde molecule and the pyruvate and/or pyruvic acid is produced from glucose. In some embodiments, both the aldehyde molecule and the pyruvate and/or pyruvic acid is fed to the cell. In some embodiments, at least one of the aldehyde molecule and/or at least one of the pyruvate or pyruvic acid is fed to the cell. In some embodiments, at least one of the aldehyde molecule and/or at least one of the pyruvate or pyruvic acid is produced from glucose.
[0282] In some embodiments, the aldehyde molecule (i.e., aldehyde precursor) for the formation of the gamma-lactone are produced from glucose by aldehyde producing pathways. In some embodiments, there is provided a pathway for the production of heptanal from glucose. In some embodiments, production of heptanal from glucose comprises at least one of over production of L-threonin, overexpression of aspartokinase (thrA), overexpression of homserine kinase (thrB), and overexpression of threonin synthase (thrC). In some embodiments, threonin is transformated into hexanal by at least one of threonin desaminase (ilvA), isoproylmalate synthase (leuA), isopropylmalate dehydrogenase (leuB), acetohydroxy acid isomeroreductase (leuC, leuD), and alpha-ketoisovalerate decarboxylase (geo175).
[0283] In some embodiments, there is provided a non-naturally occurring microorganism capable of producing pyruvate and aldehyde in a cell. In some embodiments, the non-naturally occurring microorganism produces pyruvate and aldehyde and has a gamma-lactone pathway.
[0284] In some embodiments, a microorganism strain is capable of producing pyruvate and aldehyde precursor in a cell (e.g., from glucose). In some embodiments, there is provided a non-naturally occurring microorganism capable of producing pyruvate and aldehyde (e.g., heptanal and/or having a gamma-lactone pathway for production of gamma-lactone (e.g., gamma-decalactone). The microorganism comprises at least one of the following gamma-lactone pathway enzymes: a) enzymes for production of aldehyde (e.g., heptanal): an aspartokinase that catalyzes phosphorylation of L-asparate, a homoserine kinase that catalyzes phosphorylation of L-homoserine to O-phospho-Lhomoserine, a threonine synthase that catalyzes the hydration of O-phospho-Lhomoserine to L-threonine, a threonine desaminase that catalyzes the desamination of L-threonine into 2-ketobutyrate, an isopropylmalate synthase that catalyzes the acetylation of 2-keto butyrate into 2-ethyl malate, an acetohydroxy acid isomeroreductase that catalyzes the formation of 3-ethyl malate from 2-ethylmalate via a 2-ethyl maleate intermediate, an isopropylmalate dehydrogenase that catalyzes the oxidation of 3-ethyl malate into 2-ethyl-3-oxo succinate, and a ketoisovalerate decarboxylase (e.g., engineered enzyme) that catalyzes decarboxylation of 2-keto-acid to aldehyde (e.g., 2-keto-octanoic acid to heptanal); and (b) at least one of the following enzymes:. b) enzymes for production of gamma-lactone (e.g., gamma-decalactone): an aldolase (e.g. pyruvate-dependent aldolase) that catalyzes condensation of an aldehyde molecule (e.g., heptanal) and pyruvic acid to a 4-hydroxy-2-oxo carboxylic acid (e.g., 4-hydroxy-2-oxo decanoic acid); a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid (e.g., 4-hydroxy-2-oxo decanoic acid to 2,4-dihydroxy decanoic acid); a lactonization enzyme that transforms the 2,4-dihydroxy carboxylic acid (e.g., 2,4-dihydroxy decanoic acid) to a 3-hydroxydihydro-2-(3H)-furanone (e.g., 5-hexyl-3-hydroxydihydrofuran-2(3H)-one); a dehydratase that dehydrates the 3-hydroxydihydro-2-(3H)-furanone to 2(5H)-furanone (e.g., 5-hexyl-3-hydroxydihydrofuran-2(3H)-one to 5-hexylfuran-2(5H)-one); and a reductase that reduces the 2(5H)-furanone to a gamma-lactone (e.g., gamma-decalactone). In some embodiments, the microorganism has at least one exogenous nucleic acid encoding an enzyme from said gamma-lactone pathway. In some embodiments, decarboxylation of 2-ethyl-3-oxo succinate to 2-ketovalerate happens spontaneously. In some embodiments, 2-ketovalerate is converted into 2-keto-caproic acid, 2-keto acid (e.g., 2-keto-heptanoic acid and further into 2-keto-octanoic acid) by the same enzymes. In some embodiments, an engineered ketoisovalerate decarboxylase catalyzes decarboxylation of 2-keto acid to aldehyde (e.g., 2-keto-octanoic acid into heptanal).
[0285] In some embodiments, the non-naturally occurring microorganism includes at least one modification to an endogenous nucleic acid encoding an enzyme from the gamma-lactone pathway or affecting the expression of an enzyme from this gamma-lactone pathway.
[0286] In some embodiments, the non-naturally occurring microorganism includes at least one modification/deletion to an endogenous nucleic acid encoding an enzyme that has an effect on production of the gamma lactone or any pathway intermediate.
[0287] Also provided herein is a method of producing enantiopure (R)-configuration of the delta-lactone, the gamma-lactone, and/or the compound of formula II comprising culturing a non-naturally occurring microorganism as described herein or performing the biosynthetic process as described herein.
[0288] In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing two aldehyde molecules to 3-hydroxy aldehyde. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing two acetaldehyde molecules to 3-hydroxybutanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and formaldehyde to 3-hydroxy-propanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a propionaldehyde to 3-hydroxy-pentanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a butyraldehyde to 3-hydroxy-hexanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a pentaldehyde to 3-hydroxy-heptanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a hexaldehyde to 3-hydroxy-octanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a heptaldehyde to 3-hydroxy-nonanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a octaldehyde to 3-hydroxy-decanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a nonaldehyde to 3-hydroxy-undecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a decaldehyde to 3-hydroxy-dodecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a undecaldehyde to 3-hydroxy-tridecanal.
[0289] In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an aldehyde molecule and a 3-hydroxy aldehyde molecule to 5,3-dihydroxy aldehyde. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde molecule and a 3-hydroxybutanal molecule to 5,3-dihydroxyhexanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxy-propanal molecule to 5,3-dihydroxypentanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxypentanal molecule to 5,3-dihydroxyheptanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxy-hexanal to 5,3-dihydroxy-octanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxy-heptanal molecule to 5,3-dihydroxynonanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxy-octanal molecule to 5,3-dihydroxydecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxynonanal molecule to 5,3-dihydroxyundecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxydecanal molecule to 5,3-dihydroxydodecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxy-undecanal molecule to 5,3-dihydroxytridecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxydodecanal molecule to 5,3-dihydroxytetradecanal. In some embodiments, a microorganism used in a method according to the present disclosure is a microorganism which is genetically modified so as to contain a nucleic acid molecule encoding an aldolase capable of condensing an acetaldehyde and a 3-hydroxytridecanal molecule to 5,3-dihydroxypentadecanal.
[0290] In some embodiments, the microoganism is genetically modified to contain a nucleic acid encoding an alcohol dehydrogenase capable of reducing trans-2-unsaturated aldehydes to trans-2-unsaturated alcohols. In some embodiments, the microoganism is genetically modified to contain a nucleic acid encoding an oxidoreductase capable of oxidizing trans-2-unsaturated aldehydes to trans-2-unsaturated carboxylic acids (e.g., gene ydcW, GI: 1742352; aldB, GI: 85676455). [Gruez et al. Crystal structure and kinetics identify Escherichia coli YdcW gene product as a medium-chain aldehyde dehydrogenase J Mol Biol. 2004, Oct. 8; 343(1):29-41]. In some embodiments, the microorganism is genetically modified to contain a nucleic acid encoding a PDC capable of decarboxylating pyruvate to yield acetaldehyde and carbon dioxide. See, TABLE 9.
[0291] When reference is made to at least one exogenous nucleic acid being included in a microorganism, it is to be understood that this refers to the referenced encoding nucleic acids or biochemical activities and not the number of separate nucleic acids introduced into the host organism. Such exogenous nucleic acids may be introduced into the host organism on separate nucleic acid molecules, on polycistronic nucleic acid molecules, or a combination thereof. For example, where two or more exogenous nucleic acids encoding different enzymatic activities are introduced into a host organism, the two or more exogenous nucleic acids maybe introduced as a single nucleic acid, for example, on a single plasmid, on separate plasmids, maybe integrated into the host chromosome at a single site or multiple sites, and still be considered as two or more exogenous nucleic acids.
[0292] Depending on the host microorganism selected, nucleic acids for some or all of the trans-2-unsaturated aldehyde pathway enzymes or the delta-lactone pathway enzymes or the gamma-lactone pathway enzymes described herein may be introduced into the host organism. If the host microorganism endogenously expresses one or more of the pathway genes then it may not be necessary to introduce these genes, but only those nucleic acids encoding enzyme(s) in the pathway for which the microorganism is deficient. Where a host microorganism is selected that expresses one or more of the pathway genes, the microorganism may be engineered such that the gene encoding the enzyme is overexpressed and/or genes encoding enzymes or proteins of competing pathways may be deleted.
[0293] The host microorganism may be engineered to increase co-factor pools of NADH and/or NADPH to improve metabolic flux. In some embodiments, if E. coli is to be used as the host organism, glucosephosphate isomerase (pgi) gene may be deleted to divert flux towards the pentose phosphate pathway to increase NADPH pools. Other strategies may involve switching the endogenous NADH-dependent glyceraldehyde-3-phosphate dehydrogenase (GAPDH) to the host E. coli strain with an exogenous NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase derived from Clostridium acetobutylicum. In another method, an NADH kinase (Pos5P) maybe introduced from S. cerevisiae into the host E. coli strain. The latter was successfully used to increase several products that are produced through NADPH-dependent pathways [Lee, W.-H., Kim, M.-D., Jin, Y.-S., & Seo, J.-H. (2013). Engineering of NADPH regenerators in Escherichia coli for enhanced biotransformation. Applied Microbiology and Biotechnology. 97(7):2761-72].
[0294] If E. coli is chosen as the host organism, NADH pools may be increased by limiting competing pathways though the deletion of genes encoding NADH-dependent enzymes, including but not limited to: alcohol dehydrogenases (adhE; eutG; adhP; yjgB; yqhD), lactate dehydrogenase (ldhA), and pyruvate-formate lyase (pflB).
[0295] Host microorganisms may be selected from, and the non-naturally occurring microorganisms generated in, for example, bacteria, yeast, fungus or any of a variety of other microorganisms may be used as a host organism.
[0296] In some embodiments, bacterial species may include: Escherichia coli, Bacillus subtilis, Bacillus licheniformis, Bacillus cereus, Bacillus megaterium, Bacillus brevis, Bacillus pumilus, Corynebacterium glutamicum, Zymomonas mobilis, Clostridium acetobutylicum, Clostridium butylicum, Clostridium kluyveri, Clostridium autoethanogenum, Moorella thermoacetica, Clostridium aceticum, Clostridium beijerinckii, Clostridium saccharoperbutylacetonicum, Clostridium perfringens, Clostridium dificile, Clostridium botulinum, Clostridium tyrobutyricum, Clostridium tetanomorphum, Clostridium tetani, Clostridium propionicum, Clostridium aminobutyricum, Clostridium subterminale, Clostridium sticklandii, Ralstonia eutropha, Mycobacterium bovis, Mycobacterium tuberculosis, Porphyromonas gingivalis, Pseudomonas jluorescens, Pseudomonas putida, Pseudomonas aeruginosa, Pseudomonas carboxidovorans (Oligotropha carboxidovorans), Pseudomonas stutzeri, Klebsiella pneumonia, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillhs succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Gluconobacter oxydans, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Citrobacter freundii, Citrobacter amalonaticus, Acinetobacter calcoaceticus, Acinetobacter baylyi, Thermotoga maritima, Halobacterium salinarum, Serratia marcescens, Rhodospirillum rubrum, Ideonella sp., Rhodobacter capsulatus, Methylococcus capsulatus, Methylosinus trichosporium, Methylobacterium extorquens, Methylocystis GB25, Methylotrophus capsulatus, Methylomonas sp. 16a, and Pyrococcus furiosus.
[0297] In some embodiments, yeasts or fungi may include: Saccharomyces cerevisiae, Schizosaccharomyces pombe, Saccharomycopsis crataegensis, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Pichia stipitis, Pichia pastoris, Rhizopus arrhizus, Rhizopus oryzae, Yarrowia lipoiytica, Issatchenkia orientalis, Issatchenkia occidentalis, Candida lambica, Candida sorboxylosa, Candida zemplinina, Candida geochares, Pichia membranifaciens, Zygosaccharomyces kombuchaensis, Candida sorbosivorans, Candida vanderwaltii, Candida sorbophila, Zygosaccharomyces bisporus, Zygosaccharomyces lentus, Saccharomyces bayanus, Saccharomyces bulderi, Debaryomyces castellii, (Candida boidinii, Candida etchellsii, Pichiajadinii, Pichia anomala, and Penicillium chrysogenum.
[0298] In some embodiments, cyanobacteria may include: Acaryochloris marina MBIC 11017, Anabaena sp. PCC 7120, Anabaena variabilis ATCC 29413, Agmenellum quadruplicatum, Chlorobium tepidum TLS, Cyanothece sp. ATCC 51142, Gloeobacter violaceus PCC 7421, Microcystis aeruginosa NIES-843, Nostoc punctiforme ATCC 29133, Prochlorococcus marinus MED4, Prochlorococcus marinus MIT9313, Prochlorococcus marinus SS120, Prochlorococcus marinus str. AS9601, Prochlorococcus marinus str. MIT 9211, Prochlorococcus marinus str. MIT 9215, Prochlorococcus marinus str. MIT 9301, Prochlorococcus marinus str. MIT 9303, Prochlorococcus marinus str. MIT 9312, Prochlorococcus marinus str. MIT 9515, Prochlorococcus marinus str. NATL1A, Prochlorococcus marinus sfr. NATL2A, Rhodopseudomonas palustris CGA009, Synechococcus elongatus PCC 6301, Synechococcus elongatus PCC 7942, Synechococcus sp. CC9311, Synechococcus sp. CC9605, Synechococcus sp. CC9902, Synechococcus sp. JA-2-3B, Synechococcus sp. JA-3-3Ab, Synechococcus sp. PCC 7002, Synechococcus sp. RCC307, Synechococcus sp. WH 7803, Synechococcus sp. WH8102, Synechocystis sp. PCC 6803, Thermosynechococcus elongatus BP-1, and Trichodesmium erythraeum IMS 101.
[0299] In some embodiments, algae may include: Botryococcus braunii, Chlamydomonas reinhardii, Chlorella sp., Crypthecodinium cohnii, Cylindrotheca sp., Dunaliella primolecta, Isochtysis sp., Monallanthus salina, Nannochloris sp., Nannochloropsis sp., Neochloris oleoabundans, Nitzschia sp., Phaeodactylum tricornutum, Schizochytrium sp., and Tetraselmis suteica.
[0300] In some embodiments, the host microorganism is not particularly restricted and the enzymatic activity or activities may be incorporated into any suitable host organism using methods, for example, as described herein. In some embodiments, the host is selected from bacteria, yeast, algae, cyanobacteria, fungi, or a plant cell, or any combination thereof. In some embodiments, the non-naturally occurring microorganism of the present disclosure or the process according to the present disclosure comprises a host microorganism. In some embodiments, the host microorganism is selected from a bacteria, yeast, algae, cyanobacteria, fungi, or a plant cell, or any combination thereof.
[0301] E. coli and S. cerevisiae are particularly useful host organisms since they are well characterized microorganisms suitable for genetic engineering. Further, acetaldehyde is a natural metabolite of both E. coli and S. cerevisiae present in the central carbon metabolism of both species.
[0302] A nucleic acid molecule encoding enzymes as described herein may be used alone or as part of a vector. The nucleic acid molecules may include expression control sequences operably linked to the polynucleotide comprised in the nucleic acid molecule. These expression control sequences may be suited to ensure transcription and synthesis of a translatable RNA in bacteria or fungi. Expression refers to the transcription of the heterologous DNA sequence, preferably into a translatable mRNA. Regulatory elements ensuring expression in fungi and bacteria encompass promoters, enhancers, termination signals, targeting signals and the like. Promoters for use in connection with the nucleic acid molecule may be homologous or heterologous with regard to its origin and/or with regard to the gene to be expressed. Suitable promoters are for instance promoters which lend themselves to constitutive expression. Promoters which are only activated at a point in time determined by external influences may also be used. Artificial and/or chemically inducible promoters may be used. Chemically inducible promoters may include but is not limited to: IPTG-inducible promoters such as T7 or Ptrc, or tetracycline-inducible promoters such as P.sub.LtetO-1.
[0303] An overview of different expression systems is for instance contained in Bitter et al. (Methods in Enzymology 153 (1987), 516-544) and in Sawers et al. (Applied Microbiology and Biotechnology 46 (1996), 1-9), Billman-Jacobe (Current Opinion in Biotechnology 7 (1996), 500-4), Hockney (Trends in Biotechnology 12 (1994), 456-463), Griffiths et al., (Methods in Molecular Biology 75 (1997), 427-440). An overview of yeast expression systems is for instance given by Hensing et al. (Antonie van Leuwenhoek 67 (1995), 261-279), Bussineau et al. (Developments in Biological Standardization 83 (1994), 13-19), Gellissen et al. (Antonie van Leuwenhoek 62 (1992), 79-93, Fleer (Current Opinion in Biotechnology 3 (1992), 486-496), Vedvick (Current Opinion in Biotechnology 2 (1991), 742-745) and Buckholz (Bio/Technology 9 (1991), 1067-1072).
[0304] Expression vectors have been widely described in the literature. As a rule, they contain not only a selection marker gene and a replication-origin ensuring replication in the host selected, but also a bacterial or viral promoter, and in most cases a termination signal for transcription. Between the promoter and the termination signal there is in general at least one restriction site or a polylinker which enables the insertion of a coding DNA sequence. The DNA sequence naturally controlling the transcription of the corresponding gene may be used as the promoter sequence, if it is active in the selected host organism. However, this sequence may also be exchanged for other promoter sequences. It is possible to use promoters ensuring constitutive expression of the gene and inducible promoters which permit a deliberate control of the expression of the gene. Bacterial and viral promoter sequences possessing these properties are described in detail in the literature. Regulatory sequences for the expression in microorganisms, including E. coli and S. cerevisiae, are described in the literature. Promoters permitting a particularly high expression of a downstream sequence are for instance the T7 promoter [Studier et al., Methods in Enzymology 185 (1990), 60-89], lacUV5, trp, trp-lacUV5 [DeBoer et al., in Rodriguez and Chamberlin (Eds), Promoters, Structure and Function; Praeger, New York, (1982), 462-481; DeBoer et al., Proc. Natl. Acad. Sci. USA (1983), 21-25], Ip1, rac [Boros et al., Gene 42 (1986), 97-100]. Termination signals for transcription are also described in the literature.
[0305] Inducible promoters which may provide higher polypeptide yields than constitutive promoters may be used. Suitably, in certain embodiments, a two-stage process may be used: the host cells are first cultured under optimum conditions up to a relatively high cell density; and transcription is then induced.
[0306] When two or more exogenous encoding nucleic acids are to be co-expressed, both nucleic acids may be inserted, for example, into one expression vector or into separate expression vectors. For single vector expression, the encoding nucleic acids may be operationally linked to a common expression control sequence or linked to different expression control sequences, such as one inducible promoter and one constitutive promoter.
[0307] In some embodiments, the present disclosure is directed to a gene encoding at least one aldolase (e.g., DERA) or at least one enzyme of the present disclosure, a recombinant vector containing the gene, and/or a recombinant microorganism containing said gene or recombinant vector.
[0308] As used herein, the term vector means a DNA construct containing a DNA sequence operably linked to a suitable control sequence capable of effecting the expression of the DNA in a suitable host. The vector may be a plasmid, a phage particle, or simply a potential genomic insert. Once incorporated into a suitable host, the vector may replicate and function independently of the host genome, or may in some instances, integrate into the genome itself. In the present specification, plasmid and vector are sometimes used interchangeably because most vector is a type of plasmid which is replicated independently.
[0309] It is to be understood that in some embodiments, a non-naturally occurring microorganism that produces a pathway intermediate or product, may be used in combination with another organism (or other organisms) expressing downstream or upstream pathway enzyme(s) to produce a desired product. For example, a wild-type or engineered organism may be used to produce and accumulate pyruvate, aldehydes, and/or 3-hydroxyaldehydes. These intermediates may then be used as a substrate for another engineered organism expressing one or more of the trans-2-unsaturated aldehyde pathway genes and/or the delta-lactone pathway genes and/or the gamma-lactone pathway genes.
[0310] In some embodiments, a microorganism as provided herein may optionally be engineered to delete one or more byproduct or alternative pathways. In some embodiments, the non-naturally occurring microorganism may be engineered to delete one or more genes encoding an enzyme that utilizes pyruvate. In some embodiments, the non-naturally occurring microorganism comprises deletion of one or more genes encoding an enzyme that utilizes pyruvate. In some embodiments, the non-naturally occurring microorganism comprises deletion of one or more genes encoding an enzyme capable of reacting with an acetaldehyde molecule, a pyruvate, or an aldehyde precursor. In some embodiments, the non-naturally occurring microorganism comprises deletion of one or more genes encoding an alcohol dehydrogenase, a lactate dehydrogenase, or a pyruvate formate lyase.
[0311] In some embodiments, one or more genes encoding an alcohol dehydrogenase, dihydroxy acid dehydratase, threonine transporter, aldehyde dehydrogenase, a lactate dehydrogenase or a pyruvate formate lyase are deleted from a host microorganism. In some embodiments, a deleted gene may be an alcohol dehydrogenase gene, a lactate dehydrogenase gene, and/or a pyruvate formate lyase gene. In some embodiments, the host microorganism is E. coli and one or more genes that are deleted is selected from aldB, poxB, yahK, deoC, paoA, paoB, paoC, ilvD, rhtA, dkgA pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB. Other genes native to E. coli and homologous to one or more of aldB, poxB, yahK, deoC, paoA, paoB, paoC, ilvD, rhtA, dkgA, pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB may also be deleted. In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB. In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG adhP, and yjgB. In some embodiments the microorganism comprising one or more gene deletions selected from aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG adhP, and yjgB can be used for producing trans-2-unsaturated aldehydes by feeding precursors (e.g., trans-2-hexenal production by feeding acetaldehyde and butyraldehyde). In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from ilvD, rhtA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB. In some embodiments the microorganism comprising one or more gene deletions selected from ilvD, rhtA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB can be used for producing trans-2-unsaturated aldehydes from glucose (e.g., trans-2-hexenal production from glucose (i.e., internal production of the precursors)).
[0312] In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from dkgA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R,) adhE, yqhD, eutG, adhP, and yjgB. In some embodiments the microorganism comprising one or more gene deletions selected from dkgA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG, adhP, and yjgB, can be used for producing delta-lactone by feeding aldehyde precursors (e.g., delta-decalatone production by feeding acetaldehyde and hexanal). In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from ilvD, rhtA, dkgA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB. In some embodiments the microorganism comprising one or more gene deletions selected from ilvD, rhtA, dkgA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB can be used for producing delta-lactones from glucose (e.g., delta-decalactone production from glucose (i.e., internal production of the precursors)).
[0313] In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from dkgA, aldB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG, adhP, and, yjgB. In some embodiments the microorganism comprising one or more gene deletions selected from dkgA, aldB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG, adhP, and, yjgB can be used for producing gamma-lactone by feeding precursor(s) (e.g., gamma-decalatone production by feeding heptanal (pyruvate can be produced by the cells and/or be additionally fed)). In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from ilvD, rhtA, dkgA, aldB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB ldhA, adhE, yqhD, eutG, adhP, and yjgB. In some embodiments the microorganism comprising one or more gene deletions selected from ilvD, rhtA, dkgA, aldB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB IdhA, adhE, yqhD, eutG, adhP, and yjgB can be used for producing gamma-lactones from glucose (e.g., gamma-decalactone production from glucose (i.e., internal production of the precursors). In some embodiments, the host microorganism is E. coli and the one or more genes that is deleted is selected from pflB, ldhA, adhE. In some embodiments the microorganism comprising one or more gene deletions selected from pflB, ldhA, adhE can be used for producing gamma-lactones by feeding only the precursor alkyl aldehyde (e.g., heptanal) and internal production of pyruvate from glucose.
[0314] Multiple sequence alignment algorithms (such as ClustalW) may be used to identify aldehyde reductases and alcohol dehydrogenase that share similar function to adhE which catalyzes reduction of acetaldehyde to ethanol. Aldehyde reductases or alcohol dehydrogenases that are native to E. coli that show activity on aldehydes include but are not limited to sequence data found in the TABLE 12 below.
TABLE-US-00013 TABLE 12 Gene GenBank name Accession GI Organism yahK P75691.1 2492774 Escherichia coli yqhD Q46856.1 3025295 Escherichia coli yjgB AAA97166.1 537111 Escherichia coli gldA BAE77365.1 85676115 Escherichia coli ybbO BAE76272.1 85674632 Escherichia coil yghA BAE77062.1 85675809 Escherichia coli adhP BAA15126.1 1742410 Escherichia coli fucO BAE76871.1 85675618 Escherichia coil eutG BAA16331.1 1799879 Escherichia coli yiaY YP_026233.1 49176377 Escherichia coli eutE NP_416950.1 16130380 Escherichia coil betA NP_414845.1 16128296 Escherichia coli
[0315] The activity of the aldehyde reductases and alcohol dehydrogenases described herein on the trans-2-unsaturated aldehydes may be determined. In some embodiments, one or more of the aldehyde reductases and alcohol dehydrogenases described herein that show substrate preference and activity towards trans-2-unsaturated aldehydes may be overexpressed in the host organism to improve production of trans-2-unsaturated alcohols. Sequence similarity search to identify homologues derived from other organisms to the native aldehyde reductases and alcohol dehydrogenases in E. coli that show activity on trans-2-unsaturated aldehydes may be performed.
[0316] In some embodiments, pyruvate used according to embodiments of the present disclosure is produced from renewable feedstock (such as glucose). In some embodiments, the host organism is provided with a feedstock of sugars. Such sources include, for example, sugars such as glucose, xylose, arabinose, glycerol, galactose, mannose, fructose, starch, and any combination thereof. Glucose may be obtained from various carbohydrate-containing sources including conventional bio-renewable sources such as corn (maize), wheat, potato, cassava and rice as well as alternative sources such as energy crops, plant biomass, agricultural wastes, forestry residues, sugar processing residues and plant-derived household wastes. Sources of carbohydrate include renewable feedstocks and biomass, e.g. cellulosic biomass, hemicellulosic biomass, and lignin feedstocks.
[0317] In some embodiments, the trans-2-unsaturated aldehyde process, or the delta-lactone process, or the gamma-lactone process comprises a fermentation process. In some embodiments, the fermentation process comprises a sugar-based fermentation process. In some embodiments, the sugar-based fermentation process comprises feeding sugar, feeding precursors, feeding sugar and precursors, feeding at least one aldehyde molecule (i.e., aldehyde precursor), feeding sugar and an aldehyde precursor, feeding only aldehyde precursors, feeding pyruvate and/or pyruvic acid, or any combination thereof. In some embodiments, the fermentation is partially anaerobic, substantially, or fully anaerobic.
[0318] In some embodiments, the fermentation is carried out in a single vessel. In some embodiments, the fermentation is a two-phase process. In some embodiments, the two-phase process comprises a strain growth phase and/or a production phase.
[0319] Bio-renewable feedstock sources that may be used in accordance with the present disclosure include any renewable organic matter that includes a source of carbohydrates. These include, for example, grasses, trees (hardwood and softwood), vegetation and crop residues. Other sources may include, for example, waste materials (e.g., spent paper, green waste, municipal waste, etc.). Suitable carbohydrates, including glucose, may be isolated from biorenewable materials. See, for example, Centi and van Santen, Catalysis for Renewables, Wiley-VCH, Weinheim 2007; Kamm, Gruber and Kamm, Biorefineries-Industrial Processes and Products, Wiley-VCH, Weinheim 2006; Shang-Tian Yang, Bioprocessing for Value-Added Products from Renewable Resources New Technologies and Applications, Elsevier B. V. 2007; Furia, Starch in the Food Industry, Chapter 8, CRC Handbook of Food Additives 2nd Edition CRC Press, 1973. See also chapters devoted to Starch, Sugar and Syrups within Kirk-Othmer Encyclopedia of Chemical Technology 5th Edition, John Wiley and Sons 2001. Processes to convert starch to glucose have been reported. See, for example, Schenck, Glucose and Glucose containing Syrups in Ullmann's Encyclopedia of Industrial Chemistry, Wiley-VCH 2009. Furthermore, methods to convert cellulose to glucose have been described. See, for example, Centi and van Santen, Catalysis for Renewables, Wiley-VCH, Weinheim 2007; Kamm, Gruber and Kamm, Biorefineries-Industrial Processes and Products, Wiley-VCH, Weinheim 2006; Shang-Tian Yang, Bioprocessing for Value-Added Products from Renewable Resources New Technologies and Applications, Elsevier B. V. 2007.
[0320] Alternative carbon sources may be crude glycerol obtained from biodiesel production plants, lactic acid obtained from degradation of waste poly-lactic acid, lactose or cheese whey permeate obtained from dairy industry, glucosamine obtained from chitin rich waste. The carbon sources may also be fatty acids and their esters (e.g., monoglycerides, diglycerides and triglycerides) obtained from plants or plant products such as canola oil, coconut oil, corn oil, olive oil, palm oil, safflower oil, peanut oil, soybean oil, sesame oil, sunflower oil and any combination thereof.
[0321] In some embodiments, the processes as provided may be carried out in a fermenter.
[0322] The engineered organism may be cultivated in a variety of reactor systems, and the process may be carried out in different modes of operations. The most commonly used bioreactor is a stirred tank bioreactor or aerated fermenter. The fermenter is equipped with sterile air supply, the mixing of bubble dispersion is achieved by mechanical agitation, and the temperature may be maintained using a jacket or coil that circulates steam or cooling water. For aerated vessels, high height/diameter ratio (>3) may be chosen to increase the contact time between the bubbles and liquid phase. Other variations of bioreactors are airlift bioreactor where mixing is achieved without mechanical agitation, and packed bed or fluidized bed bioreactors which are used when the biocatalyst is immobilized.
[0323] The fermentation may be carried out in three different modes: batch, fed-batch and continuous mode. A standard batch bioreactor is considered a closed system. In batch mode, all the media components are added to bioreactor while ensuring the sterility. Once the medium has been prepared, the bioreactor is inoculated with an appropriate inoculum and the fermentation is allowed to proceed until the end without any changes to the medium, i.e., without feeding of any additional components. Components such as acid and/or base can, however, be added to maintain the pH, and air/oxygen may be added to maintain the dissolved oxygen levels. In batch fermentation biomass and product concentration change over time until the fermentation is complete. The cells undergo classical lag-phase, exponential growth-phase, stationary phase growth, followed by death phase.
[0324] A variation of the batch mode is fed-batch mode where the nutrients including the carbon source is added to the fermenter as the process progresses.
[0325] In addition to batch or fed-batch mode, continuous mode of fermentation may also be used. A continuous system is considered to be open system in contrast to the batch mode. In continuous mode, defined production medium is added continuously to the bioreactor and equal amount of bioreactor contents are removed at the same rate. Continuous operation may be carried out in a chemostat where the vessel contents, including the cells are removed, or in a bioreactor that uses perfusion culture, which allows recycling of the viable cells back to the bioreactor, allowing high cell densities to be achieved.
[0326] The commonly used fermenter designs and different operation modes are very well-established in the literature [Biochemical Engineering Fundamentals, 2nd Ed. J. E. Bailey and D. F. Ollis, McGraw Hill, New York, 1986; Development of Sustainable Bioprocesses: Modeling and Assessment, E. Heinzle, A. P. Biwer and C. L. Cooney, John Wiley & Sons, Ltd., 2006; Bioprocess Engineering: Basic Concepts, 2nd Ed., M. L. Shuler and F. Kargi, Prentice Hall, 2001]. Batch, fed-batch or continuous fermentation procedures may be employed.
[0327] In some embodiments, processes as provided herein are carried out in substantially anaerobic conditions. Substantially anaerobic when used in reference to a culture or growth condition means that, in some embodiments, the amount of oxygen is less than about 10% of saturation for dissolved oxygen in liquid media. In some embodiments, the term includes sealed chambers of liquid or solid medium maintained with an atmosphere less than about 1% oxygen. In some embodiments, the processes are conducted under substantially aerobic conditions. As used herein the term substantially aerobic when used in reference to a culture or growth condition means that, in some embodiments, that the amount of oxygen is equal to or greater than about 10% of saturation for dissolved oxygen in liquid media. In some embodiments, the term includes sealed chambers of liquid or solid medium maintained with an atmosphere greater than about 1% oxygen.
[0328] Various components may be added to the culture medium to support growth of the microorganism and/or the metabolic processes described herein, including, for example, nutrients, pH modifiers, osmoprotectants.
[0329] The organisms may be grown in any suitable medium for growth such as Luria-Bertani broth, Terrific broth or yeast extract-peptone-dextrose (YPD) medium. For production, depending up on the choice of the host, synthetic minimal media such as M9 minimal medium, yeast synthetic minimal medium, yeast nitrogen base, BG-11, or variations thereof may be used. A suitable minimal medium must contain at least one carbon source, at least one nitrogen source, salts, cofactors, buffers, and other components required to grow and maintain the recombinant microorganism. The carbon source may be one or more of the carbon sources described previously, the nitrogen source may be an ammonium salt or nitrate salt including but not limited to (NH.sub.4).sub.2SO.sub.4, NH.sub.4Cl, (NH.sub.4).sub.2HPO.sub.4, NH.sub.4OH, KNO.sub.3, NaNO.sub.3. The medium may be supplemented with complex or organic nitrogen sources such as urea, yeast extract, casamino acids, peptone, tryptone, soy flour, corn steep liquor, or casein hydrolysate. The minimal medium may be supplied with trace metals including but not limited to H.sub.3BO.sub.3, MnCl.sub.2, ZnSO.sub.4, Na.sub.2MoO.sub.4, CuSO.sub.4, Co(NO.sub.3).sub.2, CuCl.sub.2, ZnCl.sub.2, CoCl.sub.2, FeCl.sub.3, KI. The minimal medium may be supplemented with vitamins and/or non-vitamin compounds including but not limited to biotin, pantothanate, folic acid, inositol, nicotinic acid, p-aminobenzoic acid, pyridoxine, riboflavin, thiamine, cyanocobalamin, citric acid, ethylenediamine tetraacetic acid (EDTA), ferric ammonium citrate. The medium may be supplied by carbon dioxide either by direct sparging or in the form of NaHCO.sub.3, or Na.sub.2CO.sub.3.
[0330] Depending upon the host organism used the minimal medium may suitably have a pH range between about pH 2.0 to about pH 10.0, between about pH 4.0 to about pH 10.0, between about pH 2.0 to about pH 8.0, between about pH 4.0 to about pH 8.0, between about pH 5.0 to about pH 8.0, between about pH 5.0 to about pH 7.0. Depending upon the host organism used the minimal medium may suitably have a pH of about 2.0, a pH of about 2.5, a pH of about 3.0, a pH of about 3.5, a pH of about 4.0, a pH of about 4.5, a pH of about 5.0, a pH of about 5.5, a pH of about 6.0, a pH of about 6.5, a pH of about 7.0, a pH of about 7.5, a pH of about 8.0, a pH of about 8.5, a pH of about 9.0, a pH of about 9.5, or a pH of about 10.0.
[0331] The fermentation may be carried out in temperature ranging from about 25 C. to about 42 C. The fermentation may be carried out in temperature ranging from about 30 C. to about 40 C., from about 33 C. to about 38 C., from about 35 C. to about 38 C., from about 35 C. to about 37 C., from about 36 C. to about 38 C., from about 36 C. to about 37 C., from about 35 C. to about 42 C., from about 25 C. to about 38 C., from about 27 C. to about 38 C., from about 29 C. to about 38 C. In some embodiments, the fermentation may be carried out at about 37 C. In some embodiments, the fermentation may be carried out at about 38 C. In some embodiments, the fermentation may be carried out at about 36 C. In some embodiments, the fermentation may be carried out at about 25 C., at about 28 C., at about 30 C., at about 32 C., at about 34 C., at about 35 C., at about 39 C., at about 40 C., at about 41 C., at about 42 C. Higher temperatures may be used if the host organism chosen is thermophilic where the cultivation temperature may be as high as about 80 C. In some embodiments, the fermentation may be carried out at least about 42 C. In some embodiments, the fermentation may be carried out in temperature ranging from about 42 C. to about 80 C.
[0332] The fermentation may be carried out under aerobic, microaerobic, or anaerobic conditions. It may also be carried out under two different phases involving aerobic growth-phase and a microaerobic or anaerobic production phase. In some embodiments, the fermentation is carried out under partially anaerobic conditions. In some embodiments, the fermentation is carried out under fully anaerobic conditions. Sterile air or oxygen may be introduced to maintain the desired dissolved oxygen levels in the medium.
[0333] Product, intermediate and byproduct formation may be analyzed by methods such as HPLC (High Performance Liquid Chromatography) equipped with a refractive index and/or photodiode array detector(s), GC-MS (Gas Chromatography-Mass Spectroscopy), GC-FID (Gas Chromatography-Flame Ionization Detector) and LC-MS (Liquid Chromatography-Mass Spectroscopy). Individual enzymatic activities from the exogenous DNA sequences may also be assayed.
[0334] The amount of product in the medium may be determined by using, for example, High Performance Liquid Chromatography (HPLC), Gas Chromatography (GC), Liquid Chromatography-Mass Spectrometry (LC-MS), and Gas Chromatography-Mass Spectrometry (GC-MS).
[0335] In some embodiments, processes as disclosed herein further include purifying the product of the processes. Such methods of purification may include, for example, liquid extraction, filtration, distillation or evaporation. Isolation of compound from the fermentation broth depends on the final purity of the compound required. The separation techniques may include: centrifugation, microfiltration, ultrafiltration, nano-filtration, evaporation, crystallization, distillation, and ion-exchange. Typical downstream processing operation may include a series of processes including separation of cells using centrifugation or microfiltration, removal of additional solids in the broth using ultrafiltration, removal of salts from the broth using nanofiltration, ion-exchange, or evaporative crystallization, and purification using distillation.
[0336] Microorganisms as described herein may be produced to secrete the resulting product, whether by choosing a host organism with a secretory signal corresponding to the product or by engineering the host organism to provide for the same. For example, membrane-bound transporter proteins may be overexpressed in the host organism to improve the secretion of the products to the fermentation broth, including but not limited to yhjX gene encoding a pyruvate-inducible inner membrane protein and putative transporter which belongs to the major facilitator superfamily of proteins, or phoE, phoF and phoC genes encoding porin E, porin F and porin C, respectively, which are responsible for membrane transport of aldehydes. The product may be recovered from the culture medium. In some embodiments, the product may be extracted from the microorganism. In some embodiments, the microorganisms may be ruptured and the culture medium or lysate may be centrifuged to remove particulate cell debris, and the membrane and soluble protein fractions may be separated if necessary.
[0337] In some embodiments, the present disclosure provides a pathway for producing trans-2-unsaturated aldehydes using aldehyde as a precursor. A general pathway is shown in
[0338] In some embodiments, the present disclosure provides a pathway for producing delta-lactones using aldehydes as a precursor. A general pathway is shown in
[0339] In some embodiments, the present disclosure provides a pathway for producing gamma-lactones using aldehyde and pyruvate as precursors. A general pathway is shown in
[0340] In some embodiments, the aldehyde is selected from formaldehyde, acetaldehyde, propionaldehyde, n-butyraldehyde, iso-butyraldehyde, hexanal, n-pentanal (valeraldehyde), caproaldehyde, crotonaldehyde, n-heptaldhyde, n-octanal, n-nonylaldehyde, phenylacetaldehyde, benzaldehyde, p-tolualdehyde, salicylaldehyde, vanillin, piperonal, 2-ethyl-2-hex-enal, 2-ethylhexaldehyde, dodecyl aldehyde, undecaldehyde, decaldehyde, nonaldehyde, octaldehyde, heptaldehyde, hexaldehyde, pentaldehyde, butyraldehyde, or any combination thereof.
[0341] In some embodiments, the aldehyde used in the methods described herein is a compound represented by formula I:
##STR00013##
wherein, R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0342] In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is an integer. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 1. In some embodiments, the present disclosure relates to any one of compounds disclosed herein, wherein n is 2. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 3. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 4. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 5. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 6. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 7. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 8. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 9. In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein n is 10.
[0343] In some embodiments, the intermediate in the trans-2-unsaturated aldehyde pathway or the lactones pathways is a 3-hydroxy aldehyde compound represented by formula II:
##STR00014##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0344] In some embodiments, there is provided a process comprising reacting acetaldehyde and an aldehyde of formula RCHO, wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, in the presence of an aldolase enzyme, to form the 3-hydroxy aldehyde compound of formula II, wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the aldolase enzyme is specific for the condensation of an acetaldehyde and an aldehyde molecule. In some embodiments, the aldolase enzyme is a modified aldolase enzyme comprising an increased enzymatic activity in comparison with a corresponding unmodified or wild-type aldolase enzyme.
[0345] In some embodiments, the 3-hydroxy aldehyde is 3-hydroxy-propanal, 3-hydroxy-butanal, 3-hydroxy-pentanal, 3-hydroxy-hexanal, 3-hydroxy-heptanal, 3-hydroxy-octanal, 3-hydroxy-nonanal, 3-hydroxy-decanal, 3-hydroxy-undecanal, 3-hydroxy-dodecanal, 3-hydroxy-tridecanal, or any combination thereof.
[0346] In some embodiments, the 3-hydroxy aldehyde comprises 3-hydroxy-propanal, 3-hydroxy-butanal, 3-hydroxy-pentanal, 3-hydroxy-hexanal, 3-hydroxy-heptanal, 3-hydroxy-octanal, 3-hydroxy-nonanal, 3-hydroxy-decanal, 3-hydroxy-undecanal, 3-hydroxy-dodecanal, 3-hydroxy-tridecanal, and any combination thereof.
[0347] In some embodiments, the 3-hydroxy aldehyde compound of formula II is in enantiomeric excess. In some embodiments, the enantiomer of 3-hydroxy aldehyde produced in excess is (R)-3-hydroxy aldehyde. In some embodiments, the enantiomer of 3-hydroxy aldehyde produced in excess is (S)-3-hydroxy aldehyde. In some embodiments, the 3-hydroxy aldehyde compound of formula II comprises (R)-3-hydroxy-propanal, (R)-3-hydroxy-butanal, (R)-3-hydroxy-pentanal, (R)-3-hydroxy-hexanal, (R)-3-hydroxy-heptanal, (R)-3-hydroxy-octanal, (R)-3-hydroxy-nonanal, (R)-3-hydroxy-decanal, (R)-3-hydroxy-undecanal, (R)-3-hydroxy-dodecanal, (R)-3-hydroxy-tridecanal, and any combination thereof.
[0348] In some embodiments, the 3-hydroxy aldehyde compound of formula II contains at least about 50% of a compound of formula II in the (R)-configuration. In some embodiments, the product of the method of the present disclosure contains at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, at least about 61%, at least about 62%, at least about 63%0, at least about 64%, at least about 650%, at least about 660%, at least about 670%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula II in the (R)-configuration. For example, the product is free of undesired byproduct or starting material. For example, the impurities (e.g., undesired byproduct, starting material, or the (S)-configuration of compound of formula II) present in the (R)-configuration of the compound of formula II is less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, or less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0349] In some embodiments, a trans-2-unsaturated aldehyde pathway is disclosed herein that comprises condensation of two aldehyde molecules to a 3-hydroxy aldehyde intermediate using an enzyme from class aldolases, and spontaneous dehydration of the 3-hydroxy aldehyde intermediate to alpha-beta unsaturated aldehyde.
[0350] In some embodiments, the present disclosure provides a process comprising a dehydration step to dehydrate the compound of formula II to form a trans-2-unsaturated aldehyde compound.
[0351] In some embodiments, the trans-2-unsaturated aldehyde described herein is a compound represented by formula III:
##STR00015##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0352] In some embodiments, the trans-2-unsaturated aldehyde is selected from trans-prop-2-enal, trans-2-butenal, trans-2-pentenal, trans-2-hexenal, trans-2-heptenal, trans-2-octenal, trans-2-nonenal, trans-2-decenal, trans-2-undecenal, trans-2-dodecenal, trans-2-tridecenal, and any combination thereof.
[0353] In some embodiments, the trans-2-unsaturated aldehyde comprises trans-prop-2-enal, trans-2-butenal, trans-2-pentenal, trans-2-hexenal, trans-2-heptenal, trans-2-octenal, trans-2-nonenal, trans-2-decenal, trans-2-undecenal, trans-2-dodecenal, trans-2-tridecenal, and any combination thereof.
[0354] In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is 2-propenal, wherein R is hydrogen. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-butenal, wherein n is 1. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-pentenal, wherein n is 2. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-hexenal, wherein n is 3. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-heptenal, wherein n is 4. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-octenal, wherein n is 5. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-nonenal, wherein n is 6. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-decenal, wherein n is 7. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-undecenal, wherein n is 8. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-dodecenal, wherein n is 9. In some embodiments, the trans-2-unsaturated aldehyde compound of formula III is trans-2-tridecenal, wherein n is 10.
[0355] In some embodiments, the trans-2-unsaturated aldehydes may be converted to trans-2-unsaturated alcohols. In some embodiments, the trans-2-unsaturated aldehydes may be converted to trans-2-unsaturated alcohols by using alcohol dehydrogenase or an enzyme having alcohol dehydrogenase activity. In some embodiments, trans-prop-2-enal is converted to trans-prop-2-enol. In some embodiments, trans-2-butenal is converted to trans-2-butenol. In some embodiments, trans-2-pentenal is converted to trans-2-pentenol. In some embodiments, trans-2-hexenal is converted to trans-2-hexenol. In some embodiments, trans-2-heptenal is converted to trans-2-heptenol. In some embodiments, trans-2-octenal is converted to trans-2-octenol. In some embodiments, trans-2-nonenal is converted to trans-2-nonenol. In some embodiments, trans-2-decenal is converted to trans-2-decenol. In some embodiments, trans-2-undecenal is converted to trans-2-undecenol. In some embodiments, trans-2-dodecenal is converted to trans-2-dodecenol. In some embodiments, trans-2-tridecenal is converted to trans-2-tridecenol.
[0356] Alcohol dehydrogenase (ADH) is an enzyme that catalyzes reduction of aldehydes and/or ketones into alcohols. Alcohol dehydrogenase is also known as aldehyde reductase, ADH, NAD-dependent alcohol dehydrogenase, NADH-alcohol dehydrogenase, primary alcohol dehydrogenase, aldehyde reductase (NADPH), NADP-alcohol dehydrogenase, NADP-aldehyde reductase, NADP-dependent aldehyde reductase, NADPH-aldehyde reductase, NADPH-dependent aldehyde reductase, and alcohol dehydrogenase (NADP).
[0357] In some embodiments, the trans-2-unsaturated aldehydes may be converted to trans-2-unsaturated carboxylic acids. In some embodiments, the trans-2-unsaturated aldehydes may be converted to trans-2-unsaturated carboxylic acids by using oxidoreductase. In some embodiments, trans-prop-2-enal is converted to trans-prop-2-enoic acid. In some embodiments, trans-2-butenal is converted to trans-2-butenoic acid. In some embodiments, trans-2-pentenal is converted to trans-2-pentenoic acid. In some embodiments, trans-2-hexenal is converted to trans-2-hexenoic acid. In some embodiments, trans-2-heptenal is converted to trans-2-heptenoic acid. In some embodiments, trans-2-octenal is converted to trans-2-octenoic acid. In some embodiments, trans-2-nonenal is converted to trans-2-nonenoic acid. In some embodiments, trans-2-decenal is converted to trans-2-decenoic acid. In some embodiments, trans-2-undecenal is converted to trans-2-undecenoic acid. In some embodiments, trans-2-dodecenal is converted to trans-2-dodecenoic acid. In some embodiments, trans-2-tridecenal is converted to trans-2-tridecenoic acid.
[0358] The reduction of trans-2-unsaturated aldehydes to trans-2-unsaturated alcohols or trans-2-unsaturated carboxylic acids may be carried out by using appropriate alcohol dehydrogenase (ADH), aldo-ketoreductases, oxidoreductase, or aldehyde reductase using a reducing equivalent as cofactor, which, in some embodiments, may be NADH or NADPH. In some embodiments, the ADH, AKR, oxidoreductase, or aldehyde reductase is substantially specific towards the trans-2-unsaturated aldehydes and does not act on acetaldehyde, thereby substantially avoiding or eliminating the production of ethanol as a side product.
[0359] In some embodiments, an acetaldehyde and a butyraldehyde undergo condensation to a 3-hydroxy-hexanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-hexanal intermediate is dehydrated to trans-2-hexenal. In some embodiments, an acetaldehyde and a formaldehyde undergo condensation to a 3-hydroxy-propanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-propanal intermediate is dehydrated to trans-prop-2-enal. In some embodiments, two acetaldehyde molecules undergo condensation to a 3-hydroxy-butanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-butanal intermediate is dehydrated to trans-2-butenal. In some embodiments, an acetaldehyde and a propionaldehyde undergo condensation to a 3-hydroxy-pentanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-pentanal intermediate is dehydrated to trans-2-pentenal. In some embodiments, an acetaldehyde and a pentaldehyde undergo condensation to a 3-hydroxy-heptanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-heptanal intermediate is dehydrated to trans-2-heptenal. In some embodiments, an acetaldehyde and a hexaldehyde undergo condensation to a 3-hydroxy-octanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-octanal intermediate is dehydrated to trans-2-octenal. In some embodiments, an acetaldehyde and a heptaldehyde undergo condensation to a 3-hydroxy-nonanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-nonanal intermediate is dehydrated to trans-2-nonenal. In some embodiments, an acetaldehyde and an octaldehyde undergo condensation to a 3-hydroxy-decanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-decanal intermediate is dehydrated to trans-2-decenal. In some embodiments, an acetaldehyde and a nonaldehyde undergo condensation to a 3-hydroxy-undecanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-undecanal intermediate is dehydrated to trans-2-undecenal. In some embodiments, an acetaldehyde and a decaldehyde undergo condensation to a 3-hydroxy-dodecanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-dodecanal intermediate is dehydrated to trans-2-dodecenal. In some embodiments, an acetaldehyde and an undecaldehyde undergo condensation to a 3-hydroxy-tridecanal intermediate in the presence of an enzyme aldolase. In some embodiments, the 3-hydroxy-tridecanal intermediate is dehydrated to trans-2-tridecenal.
[0360] In some embodiments, any of the pathways disclosed herein may further comprise addition of alcohol dehydrogenase to the alpha-beta unsaturated aldehyde to generate alpha-beta unsaturated alcohols. In some embodiments, any of the aforementioned pathways may further comprise addition of oxidoreductase to the alpha-beta unsaturated aldehyde to generate alpha-beta unsaturated carboxylic acid. In some embodiments, the aldolase is DERA
[0361] In some embodiments, the intermediate 3-hydroxy aldehyde produced by any one of the pathway disclosed herein is in enantiomeric excess. In some embodiments, the enantiomer of 3-hydroxy aldehyde produced in excess is (R)-3-hydroxy aldehyde. In some embodiments, the enantiomer of 3-hydroxy aldehyde produced in excess is (S)-3-hydroxy aldehyde.
[0362] In some embodiments, the present disclosure relates to the production of delta-lactones by using aldolases, as illustrated in
[0363] In some embodiments, it is the object of the present disclosure to provide with improved processes that provide higher specificity and higher activity. The present disclosure differs from WO2007068498 at least in that two different aldolases are used to produce delta-lactones. Advantages of the present disclosure include, but it is not limited to, the use of renewable resources, clean production, less pollution and less energy intensive processes in biological systems. In some embodiments, enzyme screening or protein engineering may be used to identify DERA or DERA like enzymes that are highly specific, for example for hexenal and acetaldehyde condensation to produce 3-hydroxy octanal (See,
[0364] In some embodiments, a delta lactone pathway is disclosed that comprises: 1) condensation of two aldehyde molecules to a 3-hydroxy aldehyde intermediate using an aldolase enzyme; 2) condensation of the 3-hydroxy aldehyde intermediate and an aldehyde (e.g. acetaldehyde) to a 5,3-dihydroxy aldehyde intermediate using an aldolase enzyme; 3) cyclization of 5,3-dihydroxy aldehyde to form a tetrahydro-2H-pyran-2,4-diol (compound of formula IV(b)); 4) oxidation of tetrahydro-2H-pyran-2,4-diol to a tetrahydro-4-hydroxy-2H-pyran-2-one (compound of formula V); 5) dehydration of the tetrahydro-4-hydroxy-2H-pyran-2-one (compound of formula V) to a 5,6-dihydro-2H-pyran-2-one (compound of formula VI); and 6) reduction of the 5,6-dihydro-2H-pyran-2-one (compound of formula VI) to a delta-lactone (compound of formula VII) using reductase.
[0365] In some embodiments, the dehydration step is spontaneous. In some embodiments, the dehydration step is by using dehydratase. In some embodiments, the lactonization is spontaneous. In some embodiments, the lactonization is enzymatic. In some embodiments, the lactonization is a non-enzymatic lactonization reaction. In some embodiments, the lactonization is a chemical lactonization reaction. In some embodiments, the reduction step comprises NADH or NADPH. In some embodiments, the aldolase enzyme is deoxyribosephosphate (DERA). In some embodiments, the aldolase in step 1 is different from the aldolase in step 2 (
[0366] In some embodiments, the present disclosure provides a process of making a 5, 3-dihydroxy aldehyde compound by condensing a 3-hydroxy aldehyde compound of formula II and an acetaldehyde in the presence of an aldolase.
[0367] In some embodiments, the intermediate 5,3-dihydroxy aldehyde compound is represented by formula IV:
##STR00016##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0368] In some embodiments, the aldolase enzyme is specific for the condensation of the compound of formula II and an acetaldehyde molecule to form a compound of formula IV. In some embodiments, the aldolase enzyme that is specific for the condensation of the compound of formula II and an acetaldehyde molecule to form a compound of formula IV is different from the aldolase enzyme that is specific for the condensation of an acetaldehyde and an aldehyde molecule. In some embodiments, the aldolase enzyme that is specific for the condensation of the compound of formula II and an acetaldehyde molecule to form a compound of formula IV is the same as the aldolase enzyme that is specific for the condensation of an acetaldehyde and an aldehyde molecule. In some embodiments, the aldolase enzyme that is specific for the condensation of the compound of formula II and an acetaldehyde molecule to form a compound of formula IV is a modified aldolase enzyme comprising an increased enzymatic activity in comparison with a corresponding unmodified or naturally occurring or wild-type aldolase enzyme.
[0369] In some embodiments, the 5,3-dihydroxy aldehyde is 5,3-dihydroxypentanal, 5,3-dihydroxyhexanal, 5,3-dihydroxyheptanal, 5,3-dihydroxyoctanal, 5,3-dihydroxynonanal, 5,3-dihydroxydecanal, 5,3-dihydroxyundecanal, 5,3-dihydroxydodecanal, 5,3-dihydroxytridecanal, 5,3-dihydroxytetradecanal, 5,3-dihydroxypentadecanal, or any combination thereof.
[0370] In some embodiments, the 5,3-dihydroxy aldehyde comprises 5,3-dihydroxypentanal, 5,3-dihydroxyhexanal, 5,3-dihydroxyheptanal, 5,3-dihydroxyoctanal, 5,3-dihydroxynonanal, 5,3-dihydroxydecanal, 5,3-dihydroxyundecanal, 5,3-dihydroxydodecanal, 5,3-dihydroxytridecanal, 5,3-dihydroxytetradecanal, 5,3-dihydroxypentadecanal, and any combination thereof.
[0371] In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxypentanal, wherein R is hydrogen. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxyhexanal, wherein n is 1. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxyheptanal, wherein n is 2. In some embodiments, the trans-2-unsaturated aldehyde compound of formula IV is 5,3-dihydroxyoctanal, wherein n is 3. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxynonanal, wherein n is 4. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxydecanal, wherein n is 5. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxyundecanal, wherein n is 6. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxydodecanal, wherein n is 7. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxytridecanal, wherein n is 8. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxytetradecanal, wherein n is 9. In some embodiments, the 5,3-dihydroxy aldehyde compound of formula IV is 5,3-dihydroxypentadecanal, wherein n is 10.
[0372] In some embodiments, the compound of formula IV (i.e., 5,3-dihydroxy aldehyde) undergoes cyclization to a tetrahydro-2H-pyran-2,4-diol compound of formula IV(b). In some embodiments, the hemi-acetal intermediate, tetrahydro-2H-pyran-2,4-diol, is a compound represented by formula IV(b),
##STR00017##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0373] In some embodiments, the compound of formula IV(b) undergoes oxidation to a tetrahydro-4-hydroxy-2H-pyran-2-one. In some embodiments, the oxidation comprises an enzymatic oxidation. In some embodiments, the oxidation is an enzymatic oxidation. In some embodiments, the delta lactone intermediate, tetrahydro-4-hydroxy-2H-pyran-2-one, is a compound represented by formula V:
##STR00018##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0374] In some embodiments, the compound of formula V undergoes dehydration to form a compound of formula VI. In some embodiments, the dehydration comprises dehydratase. In some embodiments, the delta lactone is a compound represented by formula VI:
##STR00019##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0375] In some embodiments, the delta lactone disclosed herein is in enantiomeric excess. In some embodiments, the enantiomer of delta lactone produced in excess is (R)-delta lactone. In some embodiments, the enantiomer of delta lactone produced in excess is (S)-delta lactone. In some embodiments, the compound of formula VI is in enantiomeric excess.
[0376] In some embodiments, the delta-lactone of formula VI is massoia lactone, C-10 massoia lactone (5,6-dihydro-6-pentyl-2H-pyran-2-one), C-12 massoia lactone (5,6-dihydro-6-heptyl-2H-pyran-2-one), C-14 massoia lactone (5,6-dihydro-6-nonyl-2H-pyran-2-one), 5,6-dihydro-2H-pyran-2-one, 5,6-dihydro-6-methyl-2H-pyran-2-one, 5,6-dihydro-6-hexyl-2H-pyran-2-one, 5,6-dihydro-6-ethyl-2H-pyran-2-one, 5,6-dihydro-6-propyl-2H-pyran-2-one, 5,6-dihydro-6-butyl-2H-pyran-2-one, 5,6-dihydro-6-decyl-2H-pyran-2-one, 5,6-dihydro-6-octyl-2H-pyran-2-one, or any combination thereof.
[0377] In some embodiments, the delta-lactone of formula VI comprises massoia lactone, C-10 massoia lactone (5,6-dihydro-6-pentyl-2H-pyran-2-one), C-12 massoia lactone (5,6-dihydro-6-heptyl-2H-pyran-2-one), C-14 massoia lactone (5,6-dihydro-6-nonyl-2H-pyran-2-one), 5,6-dihydro-2H-pyran-2-one, 5,6-dihydro-6-methyl-2H-pyran-2-one, 5,6-dihydro-6-hexyl-2H-pyran-2-one, 5,6-dihydro-6-ethyl-2H-pyran-2-one, 5,6-dihydro-6-propyl-2H-pyran-2-one, 5,6-dihydro-6-butyl-2H-pyran-2-one, 5,6-dihydro-6-decyl-2H-pyran-2-one, 5,6-dihydro-6-octyl-2H-pyran-2-one, and any combination thereof.
[0378] In some embodiments, the delta-lactone of formula VI is (R)-5,6-dihydro-2H-pyran-2-one, (R)-massoia lactone, (R)-massoia lactone, (R)-5,6-dihydro-6-pentyl-2H-pyran-2-one, (R)-5,6-dihydro-6-heptyl-2H-pyran-2-one, (R)-5,6-dihydro-6-nonyl-2H-pyran-2-one, (R)-5,6-dihydro-2H-pyran-2-one, (R)-5,6-dihydro-6-methyl-2H-pyran-2-one, (R)-5,6-dihydro-6-hexyl-2H-pyran-2-one, (R)-5,6-dihydro-6-ethyl-2H-pyran-2-one, (R)-5,6-dihydro-6-propyl-2H-pyran-2-one, (R)-5,6-dihydro-6-butyl-2H-pyran-2-one, (R)-5,6-dihydro-6-decyl-2H-pyran-2-one, (R)-5,6-dihydro-6-octyl-2H-pyran-2-one, or any combination thereof.
[0379] In some embodiments, the delta-lactone of formula VI comprises (R)-5,6-dihydro-2H-pyran-2-one, (R)-massoia lactone, (R)-massoia lactone, (R)-5,6-dihydro-6-pentyl-2H-pyran-2-one, (R)-5,6-dihydro-6-heptyl-2H-pyran-2-one, (R)-5,6-dihydro-6-nonyl-2H-pyran-2-one, (R)-5,6-dihydro-2H-pyran-2-one, (R)-5,6-dihydro-6-methyl-2H-pyran-2-one, (R)-5,6-dihydro-6-hexyl-2H-pyran-2-one, (R)-5,6-dihydro-6-ethyl-2H-pyran-2-one, (R)-5,6-dihydro-6-propyl-2H-pyran-2-one, (R)-5,6-dihydro-6-butyl-2H-pyran-2-one, (R)-5,6-dihydro-6-decyl-2H-pyran-2-one, (R)-5,6-dihydro-6-octyl-2H-pyran-2-one, and any combination thereof.
[0380] Massoia lactones are 10, 12 and 14 carbon chain compounds, also referred to as the C-10, C-12 and C-14 massoia lactones, respectively, that possess characteristic ,-unsaturated -lactone moieties. Massoia lactones may have substitution at the C6 position of the ,-unsaturated -lactone structures with chains of variable length containing five, seven or nine carbons.
[0381] In some embodiments, the 5,6-dihydro-2H-pyran-2-one, compound of formula VI undergoes reduction to a compound of formula VII. In some embodiments, the reduction comprises a reductase. In some embodiments, the reduction is by using a reductase. In some embodiments, the delta-lactone is a compound represented by formula VII:
##STR00020##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0382] In some embodiments, the delta-lactone compound of formula VII is delta-valerolactone, wherein R is hydrogen. In some embodiments, delta-lactone compound of formula VII is delta-hexalactone, wherein n is 1. In some embodiments, the delta-lactone compound of formula VII is delta-heptalactone, wherein n is 2. In some embodiments, the delta-lactone compound of formula VII is delta-octalactone, wherein n is 3. In some embodiments, the delta-lactone compound of formula VII is delta-nonalactone, wherein n is 4. In some embodiments, the delta-lactone compound of formula VII is delta-decalactone, wherein n is 5. In some embodiments, the delta-lactone compound of formula VII is delta-undecalactone, wherein n is 6. In some embodiments, the delta-lactone compound of formula VII is delta-dodecalactone, wherein n is 7. In some embodiments, the delta-lactone compound of formula VII is delta-tridecalactone, wherein n is 8. In some embodiments, the delta-lactone compound of formula VII is delta-tetradecalactone, wherein n is 9. In some embodiments, the delta-lactone compound of formula VII is delta-pentadecalactone, wherein n is 10.
[0383] In some embodiments, the delta-lactone of formula VII is delta-valerolactone, delta-hexalactone, delta-heptalactone, delta-octalactone, delta-nonalactone, delta-decalactone, delta-undecalactone, delta-dodecalactone, delta-tridecalactone, delta-tetradecalactone, delta-pentadecalactone, or any combination thereof.
[0384] In some embodiments, the delta-lactone of formula VII comprises delta-valerolactone, delta-hexalactone, delta-heptalactone, delta-octalactone, delta-nonalactone, delta-decalactone, delta-undecalactone, delta-dodecalactone, delta-tridecalactone, delta-tetradecalactone, delta-pentadecalactone, and any combination thereof.
[0385] In some embodiments, the delta lactone disclosed herein is in enantiomeric excess. In some embodiments, the enantiomer of delta lactone produced in excess is (R)-delta lactone. In some embodiments, the enantiomer of delta lactone produced in excess is (S)-delta lactone. In some embodiments, the compound of formula VII is in enantiomeric excess.
[0386] In some embodiments, the delta-lactone of formula VII is (R)-delta-hexalactone, (R)-delta-heptalactone, (R)-delta-octalactone, (R)-delta-nonalactone, (R)-delta-decalactone, (R)-delta-undecalactone, (R)-delta-dodecalactone, (R)-delta-tridecalactone, (R)-delta-tetradecalactone, (R)-delta-pentadecalactone, or any combination thereof.
[0387] In some embodiments, the delta-lactone of formula VII comprises (R)-delta-hexalactone, (R)-delta-heptalactone, (R)-delta-octalactone, (R)-delta-nonalactone, (R)-delta-decalactone, (R)-delta-undecalactone, (R)-delta-dodecalactone, (R)-delta-tridecalactone, (R)-delta-tetradecalactone, (R)-delta-pentadecalactone, and any combination thereof.
[0388] In some embodiments, the delta-lactone of formula VII comprises (S)-delta-hexalactone, (S)-delta-heptalactone, (S)-delta-octalactone, (S)-delta-nonalactone, (S)-delta-decalactone, (S)-delta-undecalactone, (S)-delta-dodecalactone, (S)-delta-tridecalactone, (S)-delta-tetradecalactone, (S)-delta-pentadecalactone, and any combination thereof.
[0389] In some embodiments, a massoia lactone pathway comprises: condensation of an acetaldehyde and a hexanal to 3-hydroxy-octanal by using aldolase DERA; condensation of the 3-hydroxy-octanal and an acetaldehyde to 5,3-dihydroxy-decanal by using aldolase DERA; and cyclization of 5,3-dihydroxy-decanal followed by oxidation and dehydration to form massoia lactone. In some embodiments, the massoia lactone is (R)-massoia lactone. In some embodiments the dehydration is spontaneous. In some embodiments, the dehydration is via a dehydratase. In some embodiments, the oxidation is spontaneous. In some embodiments, the oxidation is via an enzymatic oxidation.
[0390] In some embodiments, a gamma lactone pathway is disclosed that comprises: 1) condensation of an aldehyde molecule and a pyruvic acid to a 4-hydroxy-2-oxo carboxylic acid (compound of formula VIII) using aldolase (e.g. pyruvate-dependent aldolase); 2) reduction of the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid (compound of formula IX) using dehydrogenase or keto-reductase; 3) lactonization of the 2,4-dihydroxy carboxylic acid to a 3-hydroxydihydro-2(3H)-furanone (compound of formula X); 4) dehydration (e.g. spontaneous dehydration or dehydratase) of the 3-hydroxydihydro-2(3H)-furanone (compound of formula X) to 2(5H)-furanone (compound of formula XI); and 5) reduction of 2(5H)-furanone (compound of formula XI) to a gamma-lactone (compound of formula XII) using reductase.
[0391] In some embodiments, the present disclosure discloses a process of producing gamma-lactone. In some embodiments, condensation of an aldehyde molecule and a pyruvic acid in the presence of an aldolase enzyme results in a 4-hydroxy-2-oxo carboxylic acid compound. In some embodiments, the aldolase enzyme is specific for the condensation of the pyruvic acid and an aldehyde molecule. In some embodiments, the aldolase enzyme (e.g., DERA) is a modified aldolase enzyme. In some embodiments, the modified aldolase enzyme comprises an increased enzymatic activity in comparison with a corresponding unmodified, naturally occurring, or wild-type aldolase enzyme. In some embodiments, a gamma-lactone intermediate, 4-hydroxy-2-oxo carboxylic acid, is a compound represented by formula VIII:
##STR00021##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0392] In some embodiments, the compound of formula VIII is reduced to 2,4-dihydroxy carboxylic acid. In some embodiments, the compound of formula VIII is reduced to 2,4-dihydroxy carboxylic acid in the presence of dehydrogenase and/or a keto-reductase. In some embodiments, a gamma-lactone intermediate, 2,4-dihydroxy carboxylic acid, is a compound represented by formula IX:
##STR00022##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0393] In some embodiments, the 2,4-dihydroxy carboxylic acid compound of formula IX undergoes lactonization to form a 3-hydroxydihydro-2(3H)-furanone (e.g., a compound of formula X). In some embodiments, a gamma-lactone intermediate, 3-hydroxydihydro-2(3H)-furanone, is a compound represented by formula X:
##STR00023##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0394] In some embodiments, the 3-hydroxydihydro-2(3H)-furanone compound of formula X undergoes dehydration to form 2(5H)-furanone (e.g., compound of formula XI). In some embodiments, a gamma-lactone intermediate, 2(5H)-furanone, is a compound represented by formula XI:
##STR00024##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, dehydration occurs spontaneously. In some embodiments, dehydration comprises dehydratase.
[0395] In some embodiments, 2(5H)-furanone compound of formula XI is reduced to a gamma-lactone. In some embodiments, the reduction of 2(5H)-furanone compound of formula XI to gamma-lactone is in the presence of a reductase. In some embodiments, the gamma-lactone is a compound represented by formula XII:
##STR00025##
wherein R is hydrogen or C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0396] In some embodiments, the gamma-lactone compound of formula XII is gamma-butyrolactone, wherein R is hydrogen. In some embodiments, the gamma-lactone compound of formula XII is gamma-valerolactone, wherein n is 1. In some embodiments, gamma-lactone compound of formula XII is gamma-hexalactone, wherein n is 2. In some embodiments, the gamma-lactone compound of formula XII is gamma-heptalactone, wherein n is 3. In some embodiments, the gamma-lactone compound of formula XII is gamma-octalactone, wherein n is 4. In some embodiments, the gamma-lactone compound of formula XII is gamma-nonalactone, wherein n is 5. In some embodiments, the gamma-lactone compound of formula XII is gamma-decalactone, wherein n is 6. In some embodiments, the gamma-lactone compound of formula XII is gamma-undecalactone, wherein n is 7. In some embodiments, the gamma-lactone compound of formula XII is gamma-dodecalactone, wherein n is 8. In some embodiments, the gamma-lactone compound of formula XII is gamma-tridecalactone, wherein n is 9. In some embodiments, the gamma-lactone compound of formula XII is gamma-tetradecalactone, wherein n is 10.
[0397] In some embodiments, the gamma lactone disclosed herein is in enantiomeric excess. In some embodiments, the enantiomer of gamma lactone produced in excess is (R)-gamma lactone. In some embodiments, the enantiomer of gamma lactone produced in excess is (S)-gamma lactone. In some embodiments, the compound of formula XII is in enantiomeric excess.
[0398] In some embodiments, the gamma-lactone of formula XII is (R)-gamma-hexalactone, (R)-gamma-heptalactone, (R)-gamma-octalactone, (R)-gamma-nonalactone, (R)-gamma-decalactone, (R)-gamma-undecalactone, (R)-gamma-dodecalactone, (R)-gamma-tridecalactone, (R)-gamma-tetradecalactone, (R)-gamma-valerolactone, (R)-gamma-butyrolactone, or any combination thereof.
[0399] In some embodiments, the gamma-lactone of formula XII comprises (R)-gamma-hexalactone, (R)-gamma-heptalactone, (R)-gamma-octalactone, (R)-gamma-nonalactone, (R)-gamma-decalactone, (R)-gamma-undecalactone, (R)-gamma-dodecalactone, (R)-gamma-tridecalactone, (R)-gamma-tetradecalactone, (R)-gamma-butyrolactone, (R)-gamma-valerolactone, and any combination thereof.
[0400] In some embodiments, a gamma lactone pathway is disclosed that comprises, but not necessarily in this order: condensation of an aldehyde molecule and a pyruvate to a 2-keto-4-hydroxy acid using aldolase (e.g. pyruvate class II aldolase, Bphl, HpaI); reduction of the 2-keto-4-hydroxy acid to 2,4-dihydroxy acid using dehydrogenase or keto-reductase; dehydration of the 2,4-dihydroxy acid to 4-hydroxy-2-ene-acid; lactonization of the 4-hydroxy-2-ene acid to 2(5H)-furanone (compound of formula XI); and reduction of 2(5H)-furanone (compound of formula XI) to a gamma-lactone (compound of formula XII) using reductase.
[0401] In some embodiments, a gamma lactone pathway is disclosed that comprises: 1) condensation of a heptanal molecule and a pyruvate (or pyruvic acid) to a 2-keto-4-hydroxydecanoic acid using pyruvate dependent aldolase (e.g., Bphl/HpaI aldolase); 2) reduction of the 2-keto-4-hydroxydecanoic acid to 2,4-dihydroxy-decanoic acid using keto-reductase and NADH/NADPH; 3) dehydration of the 2,4-dihydroxy-decanoic acid to 4-hydroxy-2-decenoic acid 4) lactonization of the 4-hydroxy-2-decenoic acid to 5-hexyl-furanone; and 5) reduction of 5-hexyl-furanone to a gamma-decalactone using enoate reductase.
[0402] In some embodiments, the lactonization may be spontaneous, chemical, enzymatic, non-enzymatic, or any combination thereof.
[0403] In some embodiments, the dehydration step is spontaneous. In some embodiments, the dehydration step is In some embodiments, the dehydration step is by using dehydratase. In some embodiments, the lactonization is spontaneous. In some embodiments, the lactonization is enzymatic. In some embodiments, the lactonization is a non-enzymatic lactonization reaction. In some embodiments, the lactonization is a chemical lactonization reaction. In some embodiments, the reduction step comprises NADH or NADPH. In some embodiments, the aldolase enzyme is deoxyribosephosphate (DERA).
[0404] In some embodiments, the gamma lactone disclosed herein is in enantiomeric excess. In some embodiments, the enantiomer of gamma lactone produced in excess is (R)-gamma lactone. In some embodiments, the enantiomer of gamma lactone produced in excess is (S)-gamma lactone.
[0405] An example of a reductase enzyme is an enoate-reductase capable of hydrogenating the alpha, beta carbon-carbon double bond at the alpha, beta position next to a carboxylic acid group into a carbon-carbon single bond. Example of enzymes having alpha, beta enoate reductase activity may be found in US applications 20070117191 and 20070254341. In some embodiments, the enoate reductase is a 2-enoate reductase, a NADH-dependent fumarate reductase, a succinate dehydrogenase, a coumarate reductase, a beta-nitroacrylate reductase, a methylacetate reductase, a NADPH 2-enoyl CoA reductase, enoyl-[acyl-carrier protein] reductase, N-ethylmaleimide reductase, crotonobetaine reductase, or a gamma-butyrobetaine reductase.
[0406] Enzymes belonging to the ketoreductase (KRED) or carbonyl reductase class (EC1.1.1.184) are useful for the synthesis of optically active alcohols from the corresponding prostereoisomeric ketone substrates and by stereospecific reduction of corresponding racemic aldehyde and ketone substrates. KREDs typically convert a ketone or aldehyde substrate to the corresponding alcohol product, but may also catalyze the reverse reaction, oxidation of an alcohol substrate to the corresponding ketone/aldehyde product. The reduction of ketones and aldehydes and the oxidation of alcohols by enzymes such as KRED may require a co-factor, most commonly reduced nicotinamide adenine dinucleotide (NADH) or reduced nicotinamide adenine dinucleotide phosphate (NADPH), and nicotinamide adenine dinucleotide (NAD) or nicotinamide adenine dinucleotide phosphate (NADP) for the oxidation reaction. NADH and NADPH serve as electron donors, while NAD and NADP serve as electron acceptors. It is frequently observed that ketoreductases and alcohol dehydrogenases accept either the phosphorylated or the non-phosphorylated co-factor (in its oxidized and reduced state).
[0407] KRED enzymes may be found in a wide range of bacteria and yeasts (for reviews: Kraus and Waldman, Enzyme catalysis in organic synthesis Vols. 1&2.VCH Weinheim 1995; Faber, K., Biotransformations in organic chemistry, 4th Ed. Springer, Berlin Heidelberg New York. 2000; Hummel and Kula Eur. J. Biochem. 1989 184:1-13). Several KRED gene and enzyme sequences have been reported, e.g., Candida magnoliae (Genbank Acc. No. JC7338; GI:11360538) Candida parapsilosis (Genbank Acc. No. BAA24528.1; GI:2815409), Sporobolomyces salmonicolor (Genbank Acc. No. AF 160799; GI:6539734).
[0408] The reduction of 2-keto-4-hydroxy aldehyde to 2,4-dihydroxy aldehyde may be carried out by using appropriate alcohol dehydrogenase (ADH), aldo-ketoreductases, oxidoreductase, or aldehyde reductase using a reducing equivalent as cofactor, which in some embodiments, may be NADH or NADPH. In some embodiments, the ADH, AKR, oxidoreductase, or aldehyde reductase, however, is substantially specific towards 2-keto-4-hydroxy aldehyde and does not act on acetaldehyde, thereby substantially avoiding or eliminating the production of ethanol as a side product.
[0409] In some embodiments, the present disclosure relates to a method of producing trans-2-unsaturated aldehyde from aldehydes and aldolases comprising at least one of the following trans-2-unsaturated aldehyde pathway enzymes: an aldolase enzyme that catalyzes condensation of two aldehyde molecules to produce 3-hydroxy aldehyde; and a dehydratase that dehydrates the 3-hydroxy aldehyde to trans-2-unsaturated aldehyde. In some embodiments, the at least one of the trans-2-unsaturated aldehyde pathway enzymes is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0410] In some embodiments, the present disclosure relates to a method of producing trans-2-unsaturated aldehyde from aldehydes and aldolases comprising an aldolase enzyme that catalyzes condensation of two aldehyde molecules to produce 3-hydroxy aldehyde. In some embodiments the method of producing trans-2-unsaturated aldehyde comprises a dehydratase that dehydrates the 3-hydroxy aldehyde to trans-2-unsaturated aldehyde. In some embodiments, the aldolase enzyme is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0411] In some embodiments, the present disclosure relates to a method of producing delta-lactones from aldehydes and aldolases comprising at least one of the following delta-lactone pathway enzymes: an aldolase enzyme that catalyzes condensation of two aldehyde molecules to produce a 3-hydroxy aldehyde (i.e., step 1); an aldolase enzyme that catalyzes condensation of the 3-hydroxy aldehyde and an aldehyde molecule to a 5,3-dihydroxy aldehyde (i.e., step 2); an oxidase that oxidizes of tetrahydro-2H-pyran-2,4-diol to a tetrahydro-4-hydroxy-2H-pyran-2-one; a dehydratase that dehydrates the tetrahydro-4-hydroxy-2H-pyran-2-one to a 5,6-dihydro-2H-pyran-2-one; and a reductase that reduces the 5,6-dihydro-2H-pyran-2-one to a delta-lactone. In some embodiments, the aldolase in step 1 is different from the aldolase in step 2. In some embodiments, the at least one of the delta-lactone pathway enzymes is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0412] In some embodiments, the present disclosure relates to a method of producing delta-lactones from aldehydes and aldolases comprising the following delta-lactone pathway enzymes: an aldolase enzyme that catalyzes condensation of two aldehyde molecules to produce a 3-hydroxy aldehyde (i.e., step 1); and, an aldolase enzyme that catalyzes condensation of the 3-hydroxy aldehyde and an aldehyde molecule to a 5,3-dihydroxy aldehyde (i.e., step 2). In some embodiments, the aldolase in step 1 is different from the aldolase in step 2. In some embodiments, the method further comprises at least one of the following delta-lactone pathway enzymes: an oxidase that oxidizes tetrahydro-2H-pyran-2,4-diol to a tetrahydro-4-hydroxy-2H-pyran-2-one; a dehydratase that dehydrates the tetrahydro-4-hydroxy-2H-pyran-2-one to a 5,6-dihydro-2H-pyran-2-one; and a reductase that reduces the 5,6-dihydro-2H-pyran-2-one to a delta-lactone. In some embodiments, the at least one of the delta-lactone pathway enzymes of any one of the abovementioned steps is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0413] In some embodiments, the present disclosure relates to a method of producing gamma-lactones from an aldehyde molecule, a carboxylic acid, and aldolase comprising at least one of the following gamma-lactone pathway enzymes: an aldolase enzyme that catalyzes condensation of an aldehyde molecule and a pyruvic acid to a 4-hydroxy-2-oxo carboxylic acid; a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid; a lactonization enzyme that transforms the 2,4-dihydroxy carboxylic acid to a 3-hydroxydihydro-2-(3H)-furanone; a dehydratase that dehydrates the 3-hydroxydihydro-2-(3H)-furanone to 2(5H)-furanone; and a reductase that reduces the 2(5H)-furanone to a gamma-lactone. In some embodiments, the at least one of the gamma-lactone pathway enzymes is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0414] In some embodiments, the present disclosure relates to a method of producing gamma-lactones from an aldehyde molecule, a carboxylic acid, and aldolase comprising an aldolase enzyme that catalyzes condensation of an aldehyde molecule and a pyruvic acid to a 4-hydroxy-2-oxo carboxylic acid. In some embodiments, the method further comprises at least one of the following gamma-lactone pathway enzymes: a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid; a lactonization enzyme that transforms the 2,4-dihydroxy carboxylic acid to a 3-hydroxydihydro-2-(3H)-furanone; a dehydratase that dehydrates the 3-hydroxydihydro-2-(3H)-furanone to 2(5H)-furanone; and a reductase that reduces the 2(5H)-furanone to a gamma-lactone. In some embodiments, the at least one of the enzymes is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0415] In some embodiments, the present disclosure relates to a method of producing gamma-lactones from an aldehyde, a pyruvate, and aldolase comprising at least one of the following gamma-lactone pathway enzymes: an aldolase that catalyzes condensation of an aldehyde molecule and a pyruvate to a 4-hydroxy-2-oxo carboxylic acid; a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid; a dehydratase that dehydrates 2,4-dihydroxy carboxylic acid to 4-hydroxy-2-ene acid; a lactonization enzyme that transforms the 4-hydroxy-2-ene acid to 2(5H)-furanone; and a reductase that reduces the 2(5H)-furanone to a gamma-lactone. In some embodiments, the at least one of the gamma-lactone pathway enzymes is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0416] In some embodiments, the present disclosure relates to a method of producing gamma-lactones from an aldehyde, a pyruvate, and an aldolase comprising an aldolase that catalyzes condensation of an aldehyde molecule and a pyruvate to a 4-hydroxy-2-oxo carboxylic acid. In some embodiments, the method further comprises at least one of the following gamma-lactone pathway enzymes: a dehydrogenase or a keto-reductase that reduces the 4-hydroxy-2-oxo carboxylic acid to 2,4-dihydroxy carboxylic acid; a dehydratase that dehydrates 2,4-dihydroxy carboxylic acid to 4-hydroxy-2-ene acid; a lactonization enzyme that transforms the 4-hydroxy-2-ene acid to 2(5H)-furanone; and a reductase that reduces the 2(5H)-furanone to a gamma-lactone. In some embodiments, the at least one of the enzymes is partially purified, is purified, is a modified enzyme, or any combinations thereof.
[0417] In some embodiments, the aldolase is a deoxyribose-5-phosphate aldolase DERA enzyme. In some embodiments, the DERA enzyme is modified. In some embodiments, the aldolase comprises an amino acid sequence of SEQ ID NO: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20, or an active fragment, or a homologue thereof. In some embodiments, the aldolase comprises at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% amino acid sequence identity to any one of SEQ ID NOs: 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
[0418] In some embodiments, an exogenous nucleic acid encoding the aldolase comprises a nucleotide sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the exogenous nucleic acid encoding the aldolase comprises a nucleotide sequence that is at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% nucleotide sequence identity to any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0419] In some embodiments, the modified DERA enzyme comprises at least one mutation, wherein the at least one mutation corresponds to or is at an amino acid position selected from R190, T12, and S238 of SEQ ID NO: 18. In some embodiments, the DERA enzyme comprises at least one mutation selected from R190K, R190I, R190F, R190A, R190L, R190M, T12A, and S238A of SEQ ID NO: 18. In some embodiments, the modified DERA enzyme comprises mutations corresponding to each or at each amino acid position selected from R190, T12, and S238 of SEQ ID NO: 18. In some embodiments, the modified DERA enzyme comprises mutations at each amino acid position corresponding to or selected from R190, T12, and S238 of SEQ ID NO: 18
[0420] In some embodiments, the method or the process of the present disclosure is performed in a culture. In some embodiments, the culture is a microbial culture. In some embodiments, the aldehyde molecules according to the method or the process of the present disclosure are fed to the culture. In some embodiments, the aldehyde molecules according to the method or the process of the present disclosure are produced from glucose. In some embodiments, at least one aldehyde molecule is produced from glucose and the other aldehyde molecule is fed to the culture.
[0421] In some embodiments, the method or the process of the present disclosure comprises expressing at least one of the enzymes in a host cell. In some embodiments, the host cell is a microbial cell. In some embodiments, the host cell is a fungal or bacterial cell. In some embodiments, the microbial host cell is a transformed microbial host cell selected from the group consisting of Comamonas sp., Corynebacterium sp., Brevibacterium sp., Rhodococcus sp., Azotobacter sp., Citrobacter sp., Enterobacter sp., Clostridium sp., Klebsiella sp., Salmonella sp., Lactobacillus sp., Aspergillus sp., Saccharomyces sp., Yarrowia sp., Zygosaccharomyces sp., Pichia sp., Khlyveromyces sp., Candida sp., Hansenula sp., Dunaliella Debaryomyces sp., Mucor sp., Torulopsis sp., Methylobacteria sp., Bacillus sp., Escherichia sp., Pseudomonas sp., Rhizobium sp., and Streptomyces sp. In some embodiments, the microbial host cell is Escherichia coli. In some embodiments, the microbial cell is a viable cell. In some embodiments, the microbial cell produces a crude cell lysate. In some embodiments, crude cell lysate is purified. In some embodiments, the microbial cell comprises one or more gene deletions to increase the availability of aldehyde and/or pyruvate. In some embodiments, the microbial cell comprises one or more gene deletions encoding an alcohol dehydrogenase, a lactate dehydrogenase, or a pyruvate formate lyase.
[0422] In some embodiments, the present disclosure relates to a method of producing delta-lactone comprising a non-naturally occurring microorganism for producing delta-lactone from precursor aldehyde molecules in the presence of aldolases. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the delta-lactone pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified, naturally occurring, or wild-type microorganism. In some embodiments, the aldolases are two aldolases. In some embodiments, one aldolase is specific for the condensation of an acetaldehyde and an aldehyde molecule and the other aldolase is specific for the condensation of 3-hydroxy aldehyde and an acetaldehyde molecule. In some embodiments, the two aldolases are two different aldolases. In some embodiments, the two aldolases are the same aldolase. In some embodiments, the two aldolases are DERA, or a variant, or homologue thereof.
[0423] In some embodiments, the present disclosure relates to a method of producing gamma-lactone comprising a non-naturally occurring microorganism for producing gamma-lactone from a precursor aldehyde molecule in the presence of aldolases. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the gamma-lactone pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified, naturally occurring, or wild-type microorganism.
[0424] In some embodiments, the present disclosure relates to a method of producing trans-2-unsaturated aldehyde comprising a non-naturally occurring microorganism for producing trans-2-unsaturated aldehyde from precursor aldehyde molecules in the presence of aldolases. In some embodiments, the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated aldehyde pathway in comparison with the enzymatic activity of the same enzyme in a corresponding unmodified or wild-type microorganism.
[0425] In some embodiments, the precursor aldehyde molecules are two aldehyde molecules. In some embodiments, the precursor aldehyde molecule is one aldehyde molecule. In some embodiments, the two aldehyde molecules are fed to a microbial culture. In some embodiments, the one aldehyde molecule is fed to a microbial culture. In some embodiments, at least one of the aldehyde molecule, the pyruvate, or pyruvic acid is fed to a microbial culture. In some embodiments, the aldehyde molecule is produced from glucose via an aldehyde producing pathway. In some embodiments, at least one of the two aldehyde molecules is produced from glucose and at least one of the two aldehyde molecules is fed to a microbial culture. In some embodiments, at least one of the two aldehyde molecules is acetaldehyde. In some embodiments, the acetaldehyde is produced from glucose via decarboxylation of pyruvate by pyruvate decarboxylase.
[0426] In some embodiments, the method or the process of the present disclosure comprises a non-naturally occurring enzyme. In some embodiments, the non-naturally occurring enzyme comprises at least one modified aldolase enzyme. In some embodiments, the modified aldolase enzyme comprises an increased activity towards an aldehyde condensation reaction in comparison to an unmodified aldolase enzyme. In some embodiments, the modified aldolase enzyme is a modified deoxyribose-5-phosphate aldolase (DERA) enzyme.
[0427] In some embodiments, the present disclosure relates to a non-naturally occurring microorganism capable of synthesizing delta-lactone from aldehydes and aldolases. In some embodiments, the non-naturally occurring microorganism is derived from a wild-type or unmodified microorganism and the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the delta-lactone pathway, in comparison with the enzymatic activity of the same enzyme in the wild-type microorganism.
[0428] In some embodiments, the present disclosure relates to a non-naturally occurring microorganism capable of synthesizing gamma-lactone from an aldehyde, a pyruvate, and aldolases. In some embodiments, the non-naturally occurring microorganism is derived from a wild-type or unmodified microorganism and the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the gamma-lactone pathway, in comparison with the enzymatic activity of the same enzyme in the wild-type microorganism.
[0429] In some embodiments, the present disclosure relates to a non-naturally occurring microorganism capable of synthesizing trans-2-unsaturated aldehyde from aldehydes and aldolases. In some embodiments, the non-naturally occurring microorganism is derived from a wild-type or unmodified microorganism and the non-naturally occurring microorganism comprises an increased enzymatic activity of at least one enzyme in the trans-2-unsaturated aldehyde pathway, in comparison with the enzymatic activity of the same enzyme in the wild-type microorganism.
[0430] In some embodiments, the non-naturally occurring microorganism comprises one or more gene deletions encoding enzymes that consume aldehyde and/or pyruvate. In some embodiments, the one or more gene deletions is selected from an alcohol dehydrogenase, a lactate dehydrogenase, or a pyruvate formate lyase.
[0431] In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG adhP, and yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from ilvD, rhtA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from dkgA aldB poxB ybbO yahK deoC paoA/B/C (yagT/S/R) adhE yqhD eutG adhP and yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from ilvD, rhtA, dkgA, aldB, poxB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB, ldhA, adhE, yqhD, eutG, adhP, and yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from dkgA, aldB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), adhE, yqhD, eutG, adhP, and, yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from ilvD, rhtA, dkgA, aldB, ybbO, yahK, deoC, paoA/B/C (yagT/S/R), pflB IdhA, adhE, yqhD, eutG, adhP and yjgB in E. coli. In some embodiments, the one or more genes that is deleted corresponds to one or more genes selected from pflB, ldhA, adhE in E. coli.
[0432] In some embodiments, the present disclosure relates to a recombinant vector comprising a gene encoding DERA enzyme, and/or encoding KDC, and/or encoding BFD, and/or encoding decarboxylase. In some embodiments, the present disclosure relates to an expression vector comprising a nucleic acid sequence corresponding to any SEQ ID NO disclosed in the present disclosure or corresponding to any enzyme disclosed in the present disclosure. In some embodiments, a host cell comprises the expression vector. In some embodiments, the host cell is a microbial cell.
[0433] In some embodiments, the present disclosure relates to an isolated non-naturally occurring microorganism comprising a gene encoding a DERA enzyme, and/or an aldolase, and/or any enzyme disclosed in the present disclosure, and/or encoding a KDC, and/or encoding a BFD, and/or encoding a decarboxylase.
[0434] In some embodiments, a non-naturally occurring microorganism is obtained by introducing a recombinant vector into a host microorganism.
[0435] In some embodiments, the present disclosure relates to a method of preparing a modified enzyme, comprising: (a) subjecting a deoxyribonucleic acid (DNA) sequence encoding the enzyme to random or site directed mutagenesis; (b) expressing the modified DNA sequence obtained in (a) in a host cell; and (c) screening for host cells expressing the modified enzyme. In some embodiments, the enzyme has improved aldehyde condensation activity. In some embodiments, the enzyme is an aldolase. In some embodiments, the aldolase is DERA. In some embodiments, DERA comprises SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the modified DNA sequence is expressed by transforming a suitable host cell with the modified DNA sequence and culturing the host cell obtained in (b) under suitable conditions for expressing the modified DNA sequence. In some embodiments, host cells screened in (c) may be subjected to a second mutagenesis treatment, and/or to rescreening, and/or to reisolation, and/or to recloning.
[0436] In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein R is hydrogen.
[0437] In some embodiments, the present disclosure relates to any one of the compounds disclosed herein, wherein R is C.sub.nH.sub.2n+1, and each n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[0438] In some embodiments, the trans-2-unsaturated aldehyde of the methods of the present disclosure has a percent of theoretical yield of not less than about 3%, not less than about 4%, not less than about 5%, not less than about 6%, not less than about 7%, not less than about 8%, not less than about 9%, not less than about 10%, not less than about 11%, not less than about 12%, not less than about 13%, not less than about 14%, not less than about 15%, not less than about 16%, not less than about 17%, not less than about 18%, not less than about 19%, not less than about 20%, not less than about 22%, not less than about 25%, not less than about 27%, not less than about 30%, not less than about 32%, not less than about 35%, not less than about 37%, not less than about 40%, not less than about 42%, not less than about 45%, not less than about 47%, not less than about 50%, not less than about 52%, not less than about 55%, not less than about 57%, not less than about 60%, not less than about 65%, not less than about 70%, not less than about 75%, not less than about 80%, not less than about 85%, not less than about 90%, or not less than about 95%.
[0439] In some embodiments, the delta-lactone of the methods of the present disclosure has a percent of theoretical yield of not less than about 1.5%, not less than about 2%, not less than about 2.5%, not less than about 3%, not less than about 4%, not less than about 5%, not less than about 6%, not less than about 7%, not less than about 8%, not less than about 9%, not less than about 10%, not less than about 11%, not less than about 12%, not less than about 13%, not less than about 14%, not less than about 15%, not less than about 16%, not less than about 17%, not less than about 18%, not less than about 19%, not less than about 20%, not less than about 22%, not less than about 25%, not less than about 27%, not less than about 30%, not less than about 32%, not less than about 35%, not less than about 37%, not less than about 40%, not less than about 42%, not less than about 45%, not less than about 47%, not less than about 50%, not less than about 52%, not less than about 55%, not less than about 57%, not less than about 60%, not less than about 65%, not less than about 70%, not less than about 75%, not less than about 80%, not less than about 85%, not less than about 90%, or not less than about 95%.
[0440] In some embodiments, the gamma-lactone of the methods of the present disclosure has a percent of theoretical yield of not less than about 1.5%, not less than about 2%, not less than about 2.5%, not less than about 3%, not less than about 4%, not less than about 5%, not less than about 6%, not less than about 7%, not less than about 8%, not less than about 9%, not less than about 10%, not less than about 11%, not less than about 12%, not less than about 13%, not less than about 14%, not less than about 15%, not less than about 16%, not less than about 17%, not less than about 18%, not less than about 19%, not less than about 20%, not less than about 22%, not less than about 25%, not less than about 27%, not less than about 30%, not less than about 32%, not less than about 35%, not less than about 37%, not less than about 40%, not less than about 42%, not less than about 45%, not less than about 47%, not less than about 50%, not less than about 52%, not less than about 55%, not less than about 57%, not less than about 60%, not less than about 65%, not less than about 70%, not less than about 75%, not less than about 80%, not less than about 85%, not less than about 90%, or not less than about 95%.
[0441] In some embodiments, the trans-2-unsaturated aldehyde from the methods of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure. 1H NMR and gas chromatography may be used to characterize the desired trans-2-unsaturated aldehyde product. For example, the trans-2-unsaturated aldehyde is free of undesired byproduct or starting material. For example, the impurities (e.g., byproduct and starting material) in the trans-2-unsaturated aldehyde product is less than about 25% (e.g., less than about 20%, less than about 18%, less than about 15%, less than about 13%, less than about 10%, less than about 8%, less than about 5%, less than about 3%, less than about 2%, less than about 1.5%, or less than about 1%).
[0442] In some embodiments, the delta-lactone from the method of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure. 1H NMR and gas chromatography may be used to characterize the desired delta-lactone product. For example, the delta-lactone is free of undesired byproduct or starting material. For example, the impurities (e.g., byproduct and starting material) in the delta-lactone product is less than about 25% (e.g., less than about 20%, less than about 18%, less than about 15%, less than about 13%, less than about 10%, less than about 8%, less than about 5%, less than about 3%, less than about 2%, less than about 1.5%, or less than about 1%).
[0443] In some embodiments, the gamma-lactone from the methods of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure. 1H NMR and gas chromatography may be used to characterize the desired delta-lactone product. For example, the gamma-lactone is free of undesired byproduct or starting material. For example, the impurities (e.g., byproduct and starting material) in the gamma-lactone product is less than about 25% (e.g., less than about 20%, less than about 18%, less than about 15%, less than about 13%, less than about 10%, less than about 8%, less than about 5%, less than about 3%, less than about 2%, less than about 1.5%, or less than about 1%).
[0444] In some embodiments, the compound of formula III of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure.
[0445] In some embodiments, the compound of formula VI of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure.
[0446] In some embodiments, the compound of formula VII of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure.
[0447] In some embodiments, the compound of formula XII of the present disclosure is at least about 45%, at least about 47%, at least about 50%, at least about 52%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% pure.
[0448] In some embodiments, the trans-2-unsaturated aldehyde product of the method of the present disclosure contains at least about 80% of a compound of formula III. In some embodiments, the product of the methods of the present disclosure contains at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula III. For example, the product is free of undesired byproduct or starting material. For example, the impurities in the trans-2-unsaturated aldehyde compound of formula III is less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0449] In some embodiments, the delta-lactone product of the method of the present disclosure contains at least about 80% of a compound of formula VI. In some embodiments, the product of the method of the present disclosure contains at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula VI. For example, the product is free of undesired byproduct or starting material. For example, the impurities in the delta-lactone compound of formula VI is less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0450] In some embodiments, the delta-lactone product of the method of the present disclosure contains at least about 80% of a compound of formula VII. In some embodiments, the product of the method of the present disclosure contains at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula VII. For example, the product is free of undesired byproduct or starting material. For example, the impurities in the delta-lactone compound of formula VII is less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0451] In some embodiments, the gamma-lactone product of the method of the present disclosure contains at least about 80% of a compound of formula XII. In some embodiments, the product of the method of the present disclosure contains at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula XII. For example, the product is free of undesired byproduct or starting material. For example, the impurities in the gamma-lactone compound of formula XII is less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0452] In some embodiments, the delta-lactone product of the method of the present disclosure contains at least about 50% of a compound of formula VI in the (R)-configuration. In some embodiments, the product of the method of the present disclosure contains at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula VI in the (R)-configuration. For example, the product is free of undesired byproduct or starting material. For example, the impurities (e.g., undesired byproduct, starting material, or the (S)-configuration of compound of formula VI) in the delta-lactone compound of formula VI in the (R)-configuration is less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, or less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0453] In some embodiments, the delta-lactone product of the method of the present disclosure contains at least about 50% of a compound of formula VII in the (R)-configuration. In some embodiments, the product of the method of the present disclosure contains at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula VII in the (R)-configuration. For example, the product is free of undesired byproduct or starting material. For example, the impurities (e.g., undesired byproduct, starting material, or the (S)-configuration of compound of formula VII) in the delta-lactone compound of formula VII in the (R)-configuration is less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, or less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0454] In some embodiments, the gamma-lactone product of the method of the present disclosure contains at least about 50% of a compound of formula XII in the (R)-configuration. In some embodiments, the product of the method of the present disclosure contains at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98.5%, at least about 99%, or at least about 99.5% of a compound of formula X in the (R)-configuration. For example, the product is free of undesired byproduct or starting material. For example, the impurities (e.g., undesired byproduct, starting material, or the (S)-configuration of compound of formula XII) in the gamma-lactone compound of formula XII in the (R)-configuration is less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, or less than about 20% (e.g., less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11%, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1.5%, less than about 1%, or less than about 0.5%).
[0455] It will be appreciated that the methods disclosed herein are suitable for both large-scale and small-scale preparations of the desired compounds. In some embodiments of the methods described herein, compounds of formula III, or compounds of formula VI, or compounds of formula VII, or compounds of formula XII may be prepared on a large scale, for example on an industrial production scale rather than on an experimental/laboratory scale. For example, the methods described herein allow for the preparation of batches of at least about 1 g, or at least about 5 g, or at least about 10 g, or at least about 100 g, or at least about 1 kg, or at least about 10 kg, or at least about 100 kg, or at least about 500 kg, or at least about 700 kg, or at least about 1000 kg, or at least about 2000 kg, or at least about 2500 kg, or at least about 5000 kg, or at least about 10000 kg of product.
[0456] In some embodiments, the overall yield of the compounds produced by the pathway of the present disclosure is equal to or higher than the overall yield of the compounds produced via a fatty acid oxidation pathway. For example, in some embodiments, the overall yield of a trans-2-unsaturated aldehyde produced via the pathway of the present disclosure is equal to or higher than the overall yield of the trans-2-unsaturated aldehyde produced via a fatty acid oxidation pathway. In some embodiments, the sugar based fermentation process provides a higher yield of the trans-2-aldehyde than a fatty acid based process.
[0457] In some embodiments, the overall yield of a trans-2-unsaturated aldehyde compound of formula III according to the method of the present disclosure is equal to or higher than the overall yield of the trans-2-unsaturated aldehyde compound of formula III produced via a fatty acid oxidation pathway. In some embodiments, the overall yield of the trans-2-unsaturated aldehyde according to the present disclosure is about or at least about 1.1 times, about or at least about 1.2 times, about or at least about 1.3 times, about or at least about 1.4 times, about or at least about 1.5 times, about or at least about 1.6 times, about or at least about 1.7 times, about or at least about 1.8 times, about or at least about 1.9 times, about or at least about 2 times, about or at least about 2.1 times, about or at least about 3 times, about or at least about 4 times, about or at least about 5 times the overall yield of the trans-2-unsaturated aldehyde produced via a fatty acid oxidation pathway. In some embodiments, the overall yield of the trans-2-unsaturated aldehyde according to the present disclosure is between about 1.1 and about 2 times, between about 1.5 and about 2.5 times, between about 1.2 to about 2.1 times, between about 1.8 to about 2.2 times, between about 1.1 and about 2.5 times, or between about 1.1 and about 3 times the overall yield of the trans-2-unsaturated aldehyde produced via a fatty acid oxidation pathway.
[0458] In some embodiments, the theoretical yield of a trans-2-unsaturated aldehyde compound of formula III according to the method of the present disclosure is equal to or at least about 0.045 moles, equal to or at least about 0.050 moles, equal to or at least about 0.055 moles, equal to or at least about 0.056 moles, equal to or at least about 0.057 moles, equal to or at least about 0.058 moles, equal to or at least about 0.059 moles, equal to or at least about 0.060 moles, equal to or at least about 0.065 moles, equal to or at least about 0.070 moles, equal to or at least about 0.075 moles, equal to or at least about 0.080 moles, equal to or at least about 0.085 moles, equal to or at least about 0.090 moles, equal to or at least about 0.095 moles, equal to or at least about 0.096 moles, equal to or at least about 0.097 moles, equal to or at least about 0.098 moles, equal to or at least about 0.099 moles, equal to or at least about 0.1 moles, equal to or at least about 0.11 moles, equal to or at least about 0.12 moles, or equal to or at least about 0.13 moles of trans-2-unsaturated aldehyde per mole of carbon. In some embodiments, the theoretical yield of a trans-2-unsaturated aldehyde compound of formula III according to the method of the present disclosure is between about 0.055 and about 0.12 moles, between about 0.056 and about 0.11 moles, between about 0.060 and about 0.11 moles, between about 0.070 and about 0.12 moles, or between about 0.075 and about 0.11 moles of trans-2-unsaturated aldehyde per mole of carbon.
[0459] In some embodiments, the overall yield of a delta-lactone compound of formula VI and/or of formula VII according to the methods of the present disclosure is equal to or at least about 0.25 times, equal to or at least about 0.28 times, equal to or at least about 0.30 times, equal to or at least about 0.35 times, equal to or at least about 0.40 times, equal to or at least about 0.45 times, equal to or at least about 0.50 times, equal to or at least about 0.55 times, equal to or at least about 0.60 times, equal to or at least about 0.65 times, equal to or at least about 0.70 times, equal to or at least about 0.75 times, equal to or at least about 0.80 times, equal to or at least about 0.81 times, equal to or at least about 0.82 times, equal to or at least about 0.83 times, equal to or at least about 0.84 times, equal to or at least about 0.85 times, equal to or at least about 0.86 times, equal to or at least about 0.87 times, equal to or at least about 0.88 times, equal to or at least about 0.90 times, equal to or at least about 1 time, or equal to or at least about two times the overall yield of the delta-lactone produced via a fatty acid oxidation pathway.
[0460] In some embodiments, the theoretical yield of a delta-lactone compound of formula VI and/or of formula VII according to the methods of the present disclosure is equal to or at least about 0.030 moles, equal or at least about 0.035 moles, equal to or at least about 0.040 moles, equal to or at least about 0.041 moles, equal to or at least about 0.042 moles, equal to or at least about 0.043 moles, equal to or at least about 0.044 moles, equal to or at least about 0.045 moles, equal to or at least about 0.046 moles, equal to or at least about 0.047 moles, equal to or at least about 0.048 moles, equal to or at least about 0.049 moles, equal to or at least about 0.050 moles, equal to or at least about 0.055 moles, equal to or at least about 0.060 moles, equal to or at least about 0.065 moles, equal to or at least about 0.070 moles, equal to or at least about 0.080 moles, equal to or at least about 0.090 moles, or equal to or at least about 0.1 moles of delta-lactone per mole of carbon. In some embodiments, the theoretical yield of a delta-lactone compound of formula VI and/or of formula VII according to the methods of the present disclosure is between about 0.035 and about 0.048 moles, between about 0.030 and about 0.050 moles, between about 0.040 and about 0.048 moles, between about 0.045 and about 0.055 moles, or between about 0.020 and about 0.060 moles of delta-lactone per mole of carbon.
[0461] In some embodiments, the overall yield of a gamma-lactone compound of formula XII according to the methods of the present disclosure is equal to or at least about 0.25 times, equal to or at least about 0.28 times, equal to or at least about 0.30 times, equal to or at least about 0.35 times, equal to or at least about 0.40 times, equal to or at least about 0.45 times, equal to or at least about 0.50 times, equal to or at least about 0.55 times, equal to or at least about 0.60 times, equal to or at least about 0.65 times, equal to or at least about 0.70 times, equal to or at least about 0.75 times, equal to or at least about 0.80 times, equal to or at least about 0.81 times, equal to or at least about 0.82 times, equal to or at least about 0.83 times, equal to or at least about 0.84 times, equal to or at least about 0.85 times, equal to or at least about 0.86 times, equal to or at least about 0.87 times, equal to or at least about 0.88 times, equal to or at least about 0.90 times, equal to or at least about 1 time, or equal to or at least about two times the gamma-lactone produced via a fatty acid oxidation pathway.
[0462] In some embodiments, the theoretical yield of a gamma-lactone compound of formula XII according to the methods of the present disclosure is equal to or at least about 0.030 moles, equal or at least about 0.035 moles, equal to or at least about 0.040 moles, equal to or at least about 0.041 moles, equal to or at least about 0.042 moles, equal to or at least about 0.043 moles, equal to or at least about 0.044 moles, equal to or at least about 0.045 moles, equal to or at least about 0.046 moles, equal to or at least about 0.047 moles, equal to or at least about 0.048 moles, equal to or at least about 0.049 moles, equal to or at least about 0.050 moles, equal to or at least about 0.055 moles, equal to or at least about 0.060 moles, equal to or at least about 0.065 moles, equal to or at least about 0.070 moles, equal to or at least about 0.080 moles, equal to or at least about 0.090 moles, or equal to or at least about 0.1 moles of delta-lactone per mole of carbon. In some embodiments, the theoretical yield of a gamma-lactone compound of formula XII according to the methods of the present disclosure is between about 0.035 and about 0.048 moles, between about 0.030 and about 0.050 moles, between about 0.040 and about 0.048 moles, between about 0.045 and about 0.055 moles, or between about 0.020 and about 0.060 moles of gamma-lactone per mole of carbon.
[0463] In some embodiments, the trans-2-unsaturated aldehyde process, or the delta-lactone process, or the gamma-lactone process is cell-free. In some embodiments, the trans-2-unsaturated aldehyde process, or the delta-lactone process, or the gamma-lactone process is a biotransformation process.
Genetic Engineering Technologies
[0464] The technologies for deriving the genetically engineered (e.g., non-naturally occurring) microorganism from a wild-type microorganism may be used to genetically modify any enzymes in the wild-type microorganism that may be involved in the trans-2-unsaturated aldehyde pathway, the delta-lactone pathway, and/or the gamma-lactone pathway, and thereby derive the genetically engineered microorganism therefrom.
[0465] Increase or decrease an enzymatic activity: the target gene, which is an enzyme that directly or indirectly affects the yield and/or selectivity of the trans-2-unsaturated aldehyde pathway, the delta-lactone pathway, and/or the gamma-lactone pathway, may have its enzymatic activity increased or decreased. When the target encodes an enzyme that contributes to the biosynthesis of the trans-2-unsaturated aldehyde, the delta-lactone, and/or the gamma-lactone, the present disclosure uses genetic engineering technologies to increase the enzymatic activity of the enzyme. The increase of an enzymatic activity of a target gene (encoding the enzyme) in a genetically engineered microorganism may be achieved in one of three ways: by either replacing the native enzyme with an exogenous enzyme which is more active than the native enzyme encoded by the target gene, by enhancing the expression level of the target gene, or both. The exogenous enzyme may be an ortholog, a homolog, or an up-mutant of the target gene. When the target gene is overexpressed in the genetically engineered microorganism, the enzyme encoded by the target gene may be produced in a larger quantity. Thus the genetically engineered microorganism can have an increased enzymatic activity of the target gene. The up-mutant can have point mutations, deletions or insertions.
Expression
[0466] In some embodiments of the present disclosure, a DNA sequence encoding an enzyme of the present disclosure, or a mutated DNA sequence encoding a variant or modified enzyme (e.g., aldolase, DERA) prepared by methods described herein, or any alternative methods known in the art, can be expressed, in enzyme form, using an expression vector which typically includes control sequences encoding a promoter, operator, ribosome binding site, translation initiation signal, and, optionally, a repressor gene or various activator genes.
[0467] In some embodiments, the recombinant expression vector carrying the DNA sequence encoding an enzyme of the present disclosure may be any vector which may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, a bacteriophage or an extrachromosomal element, minichromosome or an artificial chromosome. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.
[0468] In some embodiments, in the vector, the DNA sequence should be operably connected to a suitable promoter sequence. The promoter may be any DNA sequence which shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell.
[0469] The expression vector of the present disclosure may also comprise a suitable transcription terminator and, in eukaryotes, polyadenylation sequences operably connected to the DNA sequence encoding a variant of the present disclosure. Termination and polyadenylation sequences may suitably be derived from the same sources as the promoter.
[0470] The vector may further comprise a DNA sequence enabling the vector to replicate in a host cell. Examples of such sequences are the origins of replication of plasmids pUC19, pACYC177, pUB110, pE194, pAMB1 and pIJ702.
[0471] The vector may also comprise a selectable marker, e.g., a gene the product of which complements a defect in the host cell, such as the dal genes from B. subtilis or B. licheniformis, or one which confers antibiotic resistance such as ampicillin, kanamycin, chloramphenicol or tetracyclin resistance.
[0472] In some embodiments, intracellular expression may be advantageous in some respects, e.g., when using certain bacteria as host cells. In some embodiments, the expression is extracellular. The parent enzyme (e.g., aldolase, DERA) may in itself comprise a preregion permitting secretion of the expressed enzyme into the culture medium. In some embodiments, this preregion may be replaced by a different preregion or signal sequence, convenient accomplished by substitution of the DNA sequences encoding the respective preregions.
[0473] The procedures used to ligate the DNA construct of the present disclosure encoding an enzyme of the present disclosure, the promoter, terminator and other elements, respectively, and to insert them into suitable vectors containing the information necessary for replication, are well known to persons skilled in the art (Sambrook et al. (1989)).
[0474] A cell of the present disclosure either comprising a DNA construct or an expression vector of the disclosure as defined herein is advantageously used as a host cell in the production of an enzyme of the present disclosure. The cell may be transformed with the DNA construct of the present disclosure encoding a variant, or a wild-type, conveniently by integrating the DNA construct in the host chromosome. This integration is generally considered to be an advantage as the DNA sequence is more likely to be stably maintained in the cell. Integration of the DNA constructs into the host chromosome may be performed according to conventional methods, e.g., by homologous or heterologous recombination. Alternatively, the cell may be transformed with an expression vector as described herein in connection with the different types of host cells.
[0475] The cell of the present disclosure may be a cell of a higher organism such as a mammal or an insect. In some embodiments the cell is a microbial cell, e.g., a bacterial or a fungal (including yeast) cell.
[0476] Examples of suitable bacteria are gram-positive bacteria such as Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Bacillus stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus circulars, Bacillus lautus, Bacillus megaterium, Bacillus thuringiensis, or Streptomyces lividans, or Streptomyces murinus, or gram-negative bacteria such as E. coli. The transformation of the bacteria may for instance be effected by protoplast transformation or by using competent cells in a manner known in the art.
[0477] The yeast organism may be selected from a species of Saccharomyces or Schizosaccharomyces, e.g., Saccharomyces cerevisiae. The filamentous fungus may belong to a species of Aspergillus, e.g., Aspergillus oryzae, Aspergillus niger or Aspergillus nidulans. Fungal cells may be transformed by a process involving protoplast formation and transformation of the protoplasts followed by regeneration of the cell wall in a manner known in the art.
[0478] In some embodiments, the present disclosure relates to a method of producing an enzyme of the present disclosure, or a variant thereof, which method comprises cultivating a host cell as described above under conditions conducive to the production of the variant and recovering the variant from the cells and/or culture medium.
[0479] The medium used to cultivate the cells may be any conventional medium suitable for growing a host cell and obtaining expression of the enzyme of the disclosure or a variant thereof. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g., in catalogues of the American Type Culture Collection).
[0480] The enzyme of the present disclosure, or a variant thereof secreted from the host cells may conveniently be recovered from the culture medium by well-known procedures including separating the cells from the medium by centrifugation or filtration, and precipitating proteinaceous components of the medium by means of a salt such as ammonium sulphate, followed by chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like.
Methods
[0481] Growth of E. Coli according to the methods of the present disclosure may include at least two phases: seed growth and fermentation. The seed growth phase, as described further below, may proceed in one or more seed culture stages (e.g., two stages or three stages).
[0482] A seed culture is first grown by inoculating seed medium with a sample from a stock culture (e.g., a working cell bank (WCB)). A sample of this seed culture is used either to inoculate a second seed culture or to inoculate a relatively large fermentation culture. Such seed cultures are typically carried out to allow the quantity of the microorganism from a stored culture (e.g., WCB) to be exponentially increased (scaled-up). Seed cultures may also be used to rejuvenate relatively dormant microbes in stored cultures. As is well understood in the art, at least one seed culture (e.g., two or three cultures or stages) may be used to scale-up the quantity of bacteria (e.g., E. coli) for inoculation into the fermentation medium.
[0483] The number of seed cultures (or stages) used depends on, for example, the size and volume of the fermentation step. For example, the culture process may involve two seed cultures: a first seed culture is grown from an inoculation of a stock (stage one seed culture), a sample of this seed culture is used to inoculate a second seed culture (stage two seed culture), and a sample from this second culture is used to inoculate a fermentation culture (fermentation stage). In some embodiments, the first and/or second seed cultures are grown in M9 media. In some embodiments, the cultures are cultured under pH controlled conditions. In some embodiments, a pH 7 is maintained with 5% ammonium hydroxide. In some embodiments, the cultures are cultured under uncontrolled pH conditions.
[0484] In stage one, a culture of E. Coli is suspended in seed medium and is incubated at a temperature between about 30-40 C., preferably at 371 deg. C. In stage two, a sample of the stage one seed medium is used to inoculate a stage two seed medium for further growth. After inoculation, the stage two medium is incubated at a temperature between about 30-40 C., preferably at 371 C. Preferably, growth in seed media at any stage does not result in cell lysis before inoculation of fermentation media. Additional growth in a third (fourth, etc.) stage seed culture may also be carried out.
[0485] All references cited within this disclosure are hereby incorporated by reference in their entirety. It should be appreciated that any patent, publication, or other disclosure material, in whole or in part, that is incorporated by reference herein is incorporated only to the extent that the incorporated material does not conflict with definitions, statements, or other disclosure material set forth in this disclosure. As such, and to the extent necessary, the disclosure as explicitly set forth herein supersedes any conflicting material incorporated herein by reference. Certain embodiments are further described in the following examples. These embodiments are provided as examples only and are not intended to limit the scope of the claims in any way.
[0486] It will be understood that numerous modifications thereto will appear to those skilled in the art. Accordingly, the above description and accompanying drawings should be taken as illustrative of the present disclosure and not in a limiting sense. It will further be understood that it is intended to cover any variations, uses, or adaptations of the present disclosure following, in general, the principles of the present disclosure and including such departures from the present disclosure as come within known or customary practice within the art to which the present disclosure pertains and as may be applied to the essential features herein before set forth, and as follows in the scope of the appended claims.
[0487] The following examples are provided to further illustrate the advantages and features of the present disclosure, but are not intended to limit the scope of the disclosure. While they are typical of those that may be used, other procedures, methodologies, or techniques may alternatively be used.
Examples
[0488] The following specific examples are illustrative and non-limiting. The examples described herein reference and provide non-limiting support to the various embodiments described in the preceding sections.
[0489] The strains and plasmids constructed and used in the examples herein include those listed in TABLE 13.
TABLE-US-00014 TABLE 13 Strain designation Genotype Wild type (K-12 MG1655) E. coli MG1655 Ardra008 E. coli MG1655 adhE, ldhA, pflB yqhD, eutG, adhP yjgB:: cmR + pArdra002
TABLE-US-00015 DNA parts and plasmids Description Empty vector pBluescript II KS(+) pArdra002 pBluescript II KS(+) expressing PDC, BH1352, PA1127 each under own promoter
[0490] Gene deletions were preformed using the lamda-red protocol and deletion primers provided within the publication (Baba, T., et al., Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection. Mol Syst Biol, 2006. 2: p. 2006 0008).
[0491] The gene and protein sequences of BH1352 (DERA Bacillus halodurans), PA1127 (Akr Pseudomonas aeruginosa PAO1), PDC from Zymomonas mobilis, pyruvate dependent aldolase (Eda Escherichia coli K-12 MG1655), 4-hydroxy-2-oxovalerate aldolase (MphE Escherichia coli K-12 MG1655), 4-hydroxy-2-oxovalerate aldolase (Paraburkholderia xenovorans LB400), 4-hydroxy-2-oxoheptanedioate aldolase (HpcH/HpaI Escherichia coli ATCC8739), L-Threonine dehydratase ilvA (Escherichia coli K-12 MG1655), alpha-ketoisovalerate decarboxylase (kivD Lactococcus lactis lactis KF147), 2-isopropylmalate synthase (leuA Escherichia coli K-13 MG1655), 3-isopropylmalate dehydrogenase (leuB Escherichia coli K-12 MG1655), Isopropylmalate dehydratase (leuC Escherichia coli K-12 Mg1655), Isopropylmalate dehydratase (leuD Escherichia coli K-12 Mg1655), aspartate kinase/homoserine dehydrogenase (thra Eschrichia coli MG1655), homoserine kinase (thrB Escherichia coli MG1655), threonine synthase (thrC Escherichia coli MG1655), hemi-acetal oxidase (zwf Escherichia coli), the DERA sequences, the BFD and KDC sequences are shown in TABLE 14.
TABLE-US-00016 TABLE14 SEQ Name IDNO Genesequence PA1127 atgagcgttgaaagcattcgcatcgagggtatcgacacgccggtctcgcg 34 (Akr catcggcctcggcacctgggccatcggcggctggatgtggggcggcgctg Pseudomonas acgacgcgacgtcggtggaaaccatccggcgtgcggtggaatccgggatc aeruginosa aacctgatcgacaccgcgccggtctatggcttcggccattccgaagaggt PAO1) cgtcggcaaggccttgcagggcctgcgcgacaaggcggtgatcgccacca aggcggcgctggagtggagcgacgcgggcatccaccgcaacgcctccgcc gcacgcatccgccgggaggtcgaggactcgctgcggcggctgaagaccga tcgtatcgacctgtaccagattcactggccggacccgctggtggcgcacg aggaaaccgccggcgaactggagcgcctgcgccgcgacggcaagatcctc gccatcggcgtgagcaactattcgccggaacagatggacgggttccgcca gttcgctccgctggccagcgtgcagccaccctacaacctgttcgagcgcg ccatcgacgccgacgtgctgccctacgccgagcgtaacggcatcgtcgtg ctggcctacggagcgctgtgccgcggcctgctttccggacggatgaacgc cgagacccgcttcgatggcgacgacctgcgcaagtccgacccgaagttcc agcagccccgcttcgcccagtacctggcagcggtcgcgcaactggaggaa ctggctcgcgagcgctatggcaagtcggtgctggccctggccatccgctg gattctcgatcgcggccctacggtggcgctgtggggggcgcgcaagccgg agcagttgaacggcatcgccgacgccttcggctggcgcctggacgacgag gccatggcccgcatcgagcggatcctcgccgagaccatccaggatccggt cggtcccgagttcatggcgccgcccagccgcaacgcctaa PDC atgagttatactgtcggtacctatttagcggagcggcttgtccagattgg 75 Z.mobilis tctcaagcatcacttcgcagtcgcgggcgactacaacctcgtccttcttg ZM4= acaacctgcttttgaacaaaaacatggagcaggtttattgctgtaacgaa ATCC31821 ctgaactgcggtttcagtgcagaaggttatgctcgtgccaaaggcgcagc agcagccgtcgttacctacagcgtcggtgcgctttccgcatttgatgcta tcggtggcgcctatgcagaaaaccttccggttatcctgatctccggtgct ccgaacaacaatgatcacgctgctggtcacgtgttgcatcacgctcttgg caaaaccgactatcactatcagttggaaatggccaagaacatcacggccg ccgctgaagcgatttacaccccggaagaagctccggctaaaatcgatcac gtgattaaaactgctcttcgtgagaagaagccggtttatctcgaaatcgc ttgcaacattgcttccatgccctgcgccgctcctggaccggcaagcgcat tgttcaatgacgaagccagcgacgaagcttctttgaatgcagcggttgaa gaaaccctgaaattcatcgccaaccgcgacaaagttgccgtcctcgtcgg cagcaagctgcgcgcagctggtgctgaagaagctgctgtcaaatttgctg atgctctcggtggcgcagttgctaccatggctgctgcaaaaagcttcttc ccagaagaaaacccgcattacatcggcacctcatggggtgaagtcagcta tccgggcgttgaaaagacgatgaaagaagccgatgcggttatcgctctgg ctcctgtcttcaacgactactccaccactggttggacggatattcctgat cctaagaaactggttctcgctgaaccgcgttctgtcgtcgttaacggcat tcgcttccccagcgtccatctgaaagactatctgacccgtttggctcaga aagtttccaagaaaaccggtgcattggacttcttcaaatccctcaatgca ggtgaactgaagaaagccgctccggctgatccgagtgctccgttggtcaa cgcagaaatcgcccgtcaggtcgaagctcttctgaccccgaacacgacgg ttattgctgaaaccggtgactcttggttcaatgctcagcgcatgaagctc ccgaacggtgctcgcgttgaatatgaaatgcagtggggtcacattggttg gtccgttcctgccgccttcggttatgccgtcggtgctccggaacgtcgca acatcctcatggttggtgatggttccttccagctgacggctcaggaagtc gctcagatggttcgcctgaaactgccggttatcatcttcttgatcaataa ctatggttacaccatcgaagttatgatccatgatggtccgtacaacaaca tcaagaactgggattatgccggtctgatggaagtgttcaacggtaacggt ggttatgacagcggtgctggtaaaggcctgaaggctaaaaccggtggcga actggcagaagctatcaaggttgctctggcaaacaccgacggcccaaccc tgatcgaatgcttcatcggtcgtgaagactgcactgaagaattggtcaaa tggggtaagcgcgttgctgccgccaacagccgtaagcctgttaacaagct cctctag Pyruvate atgaaaaactggaaaacaagtgcagaatcaatcctgaccaccggcccggt 28 dependent tgtaccggttatcgtggtaaaaaaactggaacacgcggtgccgatggcaa aldolase aagcgttggttgctggtggggtgcgcgttctggaagtgactctgcgtacc (Eda gagtgtgcagttgacgctatccgtgctatcgccaaagaagtgcctgaagc Escherichia gattgtgggtgccggtacggtgctgaatccacagcagctggcagaagtca coliK-12 ctgaagcgggtgcacagttcgcaattagcccgggtctgaccgagccgctg MG1655) ctgaaagctgctaccgaagggactattcctctgattccggggatcagcac tgtttccgaactgatgctgggtatggactacggtttgaaagagttcaaat tcttcccggctgaagctaacggcggcgtgaaagccctgcaggcgatcgcg ggtccgttctcccaggtccgtttctgcccgacgggtggtatttctccggc taactaccgtgactacctggcgctgaaaagcgtgctgtgcatcggtggtt cctggctggttccggcagatgcgctggaagcgggcgattacgaccgcatt actaagctggcgcgtgaagctgtagaaggcgctaagctgtaa 4-hydroxy- atgaacggtaaaaaactttatatctcggacgtcacattgcgtgacggtat 29 2-oxovalerate gcacgccattcgtcatcagtattcgctggaaaacgttcgccagattgcca aldolase aagcactggacgatgcccgcgtggattcgattgaagtggcccacggcgac (MphE ggtttgcaaggttccagctttaactatggtttcggcgcacatagcgacct Escherichia tgaatggattgaagcggcggcggatgtggtgaagcacgccaaaatcgcga coliK-12 cgttgttgctgccaggaatcggcactattcacgatctgaaaaatgcctgg MG1655) caggctggcgcgcgggtggttcgtgtggcaacgcactgtaccgaagctga tgtttccgcccagcatattcagtatgcccgcgagctcggaatggacaccg ttggttttctgatgatgagccatatgaccacgccggagaatctcgccaag caggcaaagctgatggaaggctacggtgcgacctgtatttatgtggtgga ttctggcggtgcgatgaacatgagcgatatccgtgaccgtttccgcgccc tgaaagcagagctgaaaccagaaacgcaaactggcatgcacgctcaccat aacctgagtcttggcgtggcgaactctatcgcggcggtggaagagggctg cgaccgaatcgacgccagcctcgcgggaatgggcgcgggcgcaggtaacg caccgctggaagtgtttattgccgccgcggataaactgggctggcagcat gggaccgatctctatgcgttaatggatgccgccgacgacctggtgcgtcc gttgcaggatcgaccggtacgagtcgatcgcgaaacgctggcgctgggat acgctggtgtttactcgagcttcctgcgtcactgtgaaacggcggcggcg cgttatggcttaagtgcggtggatattctcgttgagctgggcaaacgccg gatggttggcggccaggaggatatgatcgttgacgtggcgctggatctgc gcaacaacaaataa 4-hydroxy- atgaagctagaaggcaaaaaagtcaccgtccacgacatgacgctgcgcga 80 2-oxovalerate cggcatgcaccccaagcgccaccagatgacgctggagcaaatgaaatcca aldolase tcgcctgcggcctggatgccgcgggcatcccgctgatcgaagtcacccac (Paraburkholderia ggcgacggcctgggcggctcctccgtcaactacggctttccggcgcacag xenovorans cgacgaggaatacctgggcgccgtgattccgttgatgaagcaggccaagg LB400) tcagtgccctgctcttgcccggcatcggcaccgtcgaacacctgaagatg gccaaggacctgggcgtgaacaccatccgcgtggccacccactgcaccga agccgatgtgtcggagcagcacatcacccaatcgcgcaagctgggtctgg acaccgtgggctttttgatgatggcgcacatggccagcccagaaaagctg gtcagccaggcactcttgatgcaaggctacggcgccaactgcatctacgt caccgactcggccggctacatgctgcctgacgacgtgaaagcgcgcctga gtgccgtgcgtgccgcgctcaaacccgaaaccgagttgggctttcacggc catcacaacctggccatgggcgtcgccaactcgatcgccgcgatcgaggc cggggccacccgcatcgatgccgctgccgctggcctgggtgccggcgccg gcaacacgccgatggaggtgttcatcgccgtatgcgcgcgcatggggatc gaaaccggagtcgatgtgttcaagatccaggacgtggccgaagacctggt ggtgccgatcatggaccatgtcatccgcatcgaccgcgactc 4-hydroxy- atggaaaacagttttaaagcggcgctgaaagcaggccgcccgcagatcgg 81 2-oxoheptane attatggctggggctgagtagcagttacagcgcagagttactggccggag dioate caggattcgactggttgttgatcgacggtgaacacgcgccgaataacgtg aldolase caaaccgtgctcacccagctacaggcgattgcgccctaccccagtcagcc (HpcH/HpaI agtggtacgcccatcgtggaacgatccggtgcaaatcaaacaactgctgg Escherichia acgtcggcacacaaaccttgctggtgccgatggtacaaaacgctgacgaa coli gcccgtgaagcggtacgcgccacccgttatccccccgccggtattcgcgg ATCC8739) tgtgggcagtgcgctggcccgcgcctcgcgctggaatcgtattcctgatt acctgcaaaaagccaacgatcaaatgtgcgtgctggtgcagatcgaaacg cgtgaggcaatgaagaacttaccgcagattctggacgtggaaggcgtcga cggcgtgtttatcggcccggcggatctgagcgccgatatgggttatgccg gtaatccgcagcacccggaagtacaggccgccattgagcaggcgatcgtg cagatccgtgaatcgggcaaagcgccggggatcctgatcgccaatgagca actggcaaaacgctatctggaactgggcgcgctgtttgtcgccgtcggcg ttgacaccaccctgctcgcccgcgccgctgaagcgctggcagcacggttt ggtgcgcaggccaccgccgtgaagcccggcgtgtattaa Threonine atggctgactcgcaacccctgtccggtgctccggaaggtgccgaatattt 50 dehydratase aagagcagtgctgcgcgcgccggtttacgaggcggcgcaggttacgccgc ilvA tacaaaaaatggaaaaactgtcgtcgcgtcttgataacgtcattctggtg (Escherichia aagcgcgaagatcgccagccagtgcacagctttaagctgcgcggcgcata coliK-12 cgccatgatggcgggcctgacggaagaacagaaagcgcacggcgtgatca MG1655) ctgcttctgcgggtaaccacgcgcagggcgtcgcgttttcttctgcgcgg ttaggcgtgaaggccctgatcgttatgccaaccgccaccgccgacatcaa agtcgacgcggtgcgcggcttcggcggcgaagtgctgctccacggcgcga actttgatgaagcgaaagccaaagcgatcgaactgtcacagcagcagggg ttcacctgggtgccgccgttcgaccatccgatggtgattgccgggcaagg cacgctggcgctggaactgctccagcaggacgcccatctcgaccgcgtat ttgtgccagtcggcggcggcggtctggctgctggcgtggcggtgctgatc aaacaactgatgccgcaaatcaaagtgatcgccgtagaagcggaagactc cgcctgcctgaaagcagcgctggatgcgggtcatccggttgatctgccgc gcgtagggctatttgctgaaggcgtagcggtaaaacgcatcggtgacgaa accttccgtttatgccaggagtatctcgacgacatcatcaccgtcgatag cgatgcgatctgtgcggcgatgaaggatttattcgaagatgtgcgcgcgg tggcggaaccctctggcgcgctggcgctggcgggaatgaaaaaatatatc gccctgcacaacattcgcggcgaacggctggcgcatattctttccggtgc caacgtgaacttccacggcctgcgctacgtctcagaacgctgcgaactgg gcgaacagcgtgaagcgttgttggcggtgaccattccggaagaaaaaggc agcttcctcaaattctgccaactgcttggcgggcgttcggtcaccgagtt caactaccgttttgccgatgccaaaaacgcctgcatctttgtcggtgtgc gcctgagccgcggcctcgaagagcgcaaagaaattttgcagatgctcaac gacggcggctacagcgtggttgatctctccgacgacgaaatggcgaagct acacgtgcgctatatggtcggcggacgtccatcgcatccgttgcaggaac gcctctacagcttcgaattcccggaatcaccgggcgcgctgctgcgcttc ctcaacacgctgggtacgtactggaacatttctttgttccactatcgcag ccatggcaccgactacgggcgcgtactggcggcgttcgaacttggcgacc atgaaccggatttcgaaacccggctgaatgagctgggctacgattgccac gacgaaaccaataacccggcgttcaggttctttttggcgggttag Alpha- atgtatacagtaggagattacctattagaccgattacacgagttaggaat 69 ketoisovalerate tgaagaaatttttggagtccctggagactataacttacaatttttagatc decarboxylase aaattatttcccgcaaggatatgaaatgggtcggaaatgctaatgaatta (kivD aatgcttcttatatggctgatggctatgctcgtactaaaaaagctgccgc Lactococcus atttcttacaacctttggagtaggtgaattgagtgcagttaatggattag lactis caggaagttacgccgaaaatttaccagtagtagaaatagtgggatcacct lactis acatcaaaagtccaaaatgaaggaaaatttgttcatcatacgctggctga KF147) cggtgattttaaacactttatgaaaatgcacgaacctgttacagcagctc gaactttactgacagcagaaaatgcaaccgttgaaattgaccgagtactt tctgcactactaaaagaaagaaaacctgtctatatcaacttaccagttga tgttgctgctgcaaaagcagagaaaccctcactccctttgaaaaaagaaa atccaacttcaaatacaagtgaccaagagattttgaataaaattcaagaa agcttgaaaaatgccaaaaaaccaatcgtgattacaggacatgaaataat tagctttggcttagaaaatacagtcactcaatttatttcaaagacaaaac tccctattacgacattaaactttggaaaaagttcagttgatgaaactctc ccttcatttttaggaatctataatggtaaactctcagagcctaatcttaa agaattcgtggaatcagccgacttcatcctgatgcttggagttaaactca cagactcttcaacaggagcatttacccatcatttaaatgaaaataaaatg atttcactgaacatagacgaaggaaaaatatttaacgaaagcatccaaaa ttttgattttgaatccctcatctcctctctcttagacctaagcggaatag aatacaaaggaaaatatatcgataaaaagcaagaagactttgttccatca aatgcgcttttatcacaagaccgcctatggcaagcagttgaaaacctaac tcaaagcaatgaaacaatcgttgctgaacaagggacatcattctttggcg cttcatcaattttcttaaaaccaaagagtcattttattggtcaaccctta tggggatcaattggatatacattcccagcagcattaggaagccaaattgc agataaagaaagcagacaccttttatttattggtgatggttcacttcaac ttacagtgcaagaattaggattagcaatcagagaaaaaattaatccaatt tgctttattatcaataatgatggttatacagtcgaaagagaaattcatgg accaaatcaaagctacaatgatattccaatgtggaattactcaaaattac cagaatcatttggagcaacagaagaacgagtagtctcgaaaatcgttaga actgaaaatgaatttgtgtctgtcatgaaagaagctcaagcagatccaaa tagaatgtactggattgagttagttttggcaaaagaagatgcaccaaaag tactgaaaaaaatgggtaaactatttgctgaacaaaataaatcataa 2- atgagccagcaagtcattattttcgataccacattgcgcgacggtgaaca 63 isopropylmalate ggcgttacaggcaagcttgagtgtgaaagaaaaactgcaaattgcgctgg synthase cccttgagcgtatgggtgttgacgtgatggaagtcggtttccccgtctct (leuA tcgccgggcgattttgaatcggtgcaaaccatcgcccgccaggttaaaaa Escherichia cagccgcgtatgtgcgttagctcgctgcgtggaaaaagatatcgacgtgg coliK-12 cggccgaatccctgaaagtcgccgaagccttccgtattcatacctttatt MG1655) gccacttcgccaatgcacatcgccaccaagctgcgcagcacgctggacga ggtgatcgaacgcgctatctatatggtgaaacgcgcccgtaattacaccg atgatgttgaattttcttgcgaagatgccgggcgtacacccattgccgat ctggcgcgagtggtcgaagcggcgattaatgccggtgccaccaccatcaa cattccggacaccgtgggctacaccatgccgtttgagttcgccggaatca tcagcggcctgtatgaacgcgtgcctaacatcgacaaagccattatctcc gtacatacccacgacgatttgggcctggcggtcggaaactcactggcggc ggtacatgccggtgcacgccaggtggaaggcgcaatgaacgggatcggcg agcgtgccggaaactgttccctggaagaagtcatcatggcgatcaaagtt cgtaaggatattctcaacgtccacaccgccattaatcaccaggagatatg gcgcaccagccagttagttagccagatttgtaatatgccgatcccggcaa acaaagccattgttggcagcggcgcattcgcacactcctccggtatacac caggatggcgtgctgaaaaaccgcgaaaactacgaaatcatgacaccaga atctattggtctgaaccaaatccagctgaatctgacctctcgttcggggc gtgcggcggtgaaacatcgcatggatgagatggggtataaagaaagtgaa tataatttagacaatttgtacgatgctttcctgaagctggcggacaaaaa aggtcaggtgtttgattacgatctggaggcgctggccttcatcggtaagc agcaagaagagccggagcatttccgtctggattacttcagcgtgcagtct ggctctaacgatatcgccaccgccgccgtcaaactggcctgtggcgaaga agtcaaagcagaagccgccaacggtaacggtccggtcgatgccgtctatc aggcaattaaccgcatcactgaatataacgtcgaactggtgaaatacagc ctgaccgccaaaggccacggtaaagatgcgctgggtcaggtggatatcgt cgctaactacaacggtcgccgcttccacggcgtcggcctggctaccgata ttgtcgagtcatctgccaaagccatggtgcacgttctgaacaatatctgg cgtgccgcagaagtcgaaaaagagttgcaacgcaaagctcaacacaacga aaacaacaaggaaaccgtgtga 3- Atgtcgaagaattaccatattgccgtattgccgggggacggtattggtcc 64 isopropylmalate ggaagtgatgacccaggcgctgaaagtgctggatgccgtgcgcaaccgct dehydrogenase ttgcgatgcgcatcaccaccagccattacgatgtaggcggcgcagccatt (leuB gataaccacgggcaaccactgccgcctgcgacggttgaaggttgtgagca Escherichia agccgatgccgtgctgtttggctcggtaggcggcccgaagtgggaacatt coliK-12 taccaccagaccagcaaccagaacgcggcgcgctgctgcctctgcgtaag MG1655) cacttcaaattattcagcaacctgcgcccggcaaaactgtatcaggggct ggaagcattctgtccgctgcgtgcagacattgccgcaaacggcttcgaca tcctgtgtgtgcgcgaactgaccggcggcatctatttcggtcagccaaaa ggccgcgaaggtagcggacaatatgaaaaagcctttgataccgaggtgta tcaccgttttgagatcgaacgtatcgcccgcatcgcgtttgaatctgctc gcaagcgtcgccacaaagtgacgtcgatcgataaagccaacgtgctgcaa tcctctattttatggcgggagatcgttaacgagatcgccacggaataccc ggatgtcgaactggcgcatatgtacatcgacaacgccaccatgcagctga ttaaagatccatcacagtttgacgttctgctgtgctccaacctgtttggc gacattctgtctgacgagtgcgcaatgatcactggctcgatggggatgtt gccttccgccagcctgaacgagcaaggttttggactgtatgaaccggcgg gcggctcggcaccagatatcgcaggcaaaaacatcgccaacccgattgca caaatcctttcgctggcactgctgctgcgttacagcctggatgccgatga tgcggcttgcgccattgaacgcgccattaaccgcgcattagaagaaggca ttcgcaccggggatttagcccgtggcgctgccgccgttagtaccgatgaa atgggcgatatcattgcccgctatgtagcagaaggggtgtaa Isopropylmalate atggctaagacgttatacgaaaaattgttcgacgctcacgttgtgtacga 65 dehydratase agccgaaaacgaaaccccactgttatatatcgaccgccacctggtgcatg (leuC aagtgacctcaccgcaggcgttcgatggtctgcgcgcccacggtcgcccg Escherichia gtacgtcagccgggcaaaaccttcgctaccatggatcacaacgtctctac coliK-12 ccagaccaaagacattaatgcctgcggtgaaatggcgcgtatccagatgc Mg1655) aggaactgatcaaaaactgcaaagaatttggcgtcgaactgtatgacctg aatcacccgtatcaggggatcgtccacgtaatggggccggaacagggcgt caccttgccggggatgaccattgtctgcggcgactcgcataccgccaccc acggcgcgtttggcgcactggcctttggtatcggcacttccgaagttgaa cacgtactggcaacgcaaaccctgaaacagggccgcgcaaaaaccatgaa aattgaagtccagggcaaagccgcgccgggcattaccgcaaaagatatcg tgctggcaattatcggtaaaaccggtagcgcaggcggcaccgggcatgtg gtggagttttgcggcgaagcaatccgtgatttaagcatggaaggtcgtat gaccctgtgcaatatggcaatcgaaatgggcgcaaaagccggtctggttg caccggacgaaaccacctttaactatgtcaaaggccgtctgcatgcgccg aaaggcaaagatttcgacgacgccgttgcctactggaaaaccctgcaaac cgacgaaggcgcaactttcgataccgttgtcactctgcaagcagaagaaa tttcaccgcaggtcacctggggcaccaatcccggccaggtgatttccgtg aacgacaatattcccgatccggcttcgtttgccgatccggttgaacgcgc gtcggcagaaaaagcgctggcctatatggggctgaaaccgggtattccgc tgaccgaagtggctatcgacaaagtgtttatcggttcctgtaccaactcg cgcattgaagatttacgcgcggcagcggagatcgccaaagggcgaaaagt cgcgccaggcgtgcaggcactggtggttcccggctctggcccggtaaaag cccaggcggaagcggaaggtctggataaaatctttattgaagccggtttt gaatggcgcttgcctggctgctcaatgtgtctggcgatgaacaacgaccg tctgaatccgggcgaacgttgtgcctccaccagcaaccgtaactttgaag gccgccaggggcgcggcgggcgcacgcatctggtcagcccggcaatggct gccgctgctgctgtgaccggacatttcgccgacattcgcaacattaaata a Isopropylmalate Atggcagagaaatttatcaaacacacaggcctggtggttccgctggatgc 82 dehydratase cgccaatgtcgataccgatgcaatcatcccgaaacagtttttgcagaaag (leuD tgacccgtacgggttttggcgcgcatctgtttaacgactggcgttttctg Escherichia gatgaaaaaggccaacagccaaacccggacttcgtgctgaacttcccgca coliK-12 gtatcagggcgcttccattttgctggcacgagaaaacttcggctgtggct Mg1655) cttcgcgtgagcacgcgccctgggcattgaccgactacggttttaaagtg gtgattgcgccgagttttgctgacatcttctacggcaatagctttaacaa ccagctgctgccggtgaaattaagcgatgcagaagtggacgaactgtttg cgctggtgaaagctaatccggggatccatttcgacgtggatctggaagcg caagaggtgaaagcgggagagaaaacctatcgctttaccatcgatgcctt ccgccgccactgcatgatgaacggtctggacagtattgggcttaccttgc agcacgacgacgccattgccgcttatgaagcaaaacaacctgcgtttatg aattaa aspartate atgcgagtgttgaagttcggcggtacatcagtggcaaatgcagaacgttt 44 kinase/ tctgcgtgttgccgatattctggaaagcaatgccaggcaggggcaggtgg homoserine ccaccgtcctctctgcccccgccaaaatcaccaaccacctggtggcgatg dehydrogenase attgaaaaaaccattagcggccaggatgctttacccaatatcagcgatgc (thrA cgaacgtatttttgccgaacttttgacgggactcgccgccgcccagccgg Eschrichia ggttcccgctggcgcaattgaaaactttcgtcgatcaggaatttgcccaa coli ataaaacatgtcctgcatggcattagtttgttggggcagtgcccggatag MG1655) catcaacgctgcgctgatttgccgtggcgagaaaatgtcgatcgccatta tggccggcgtattagaagcgcgcggtcacaacgttactgttatcgatccg gtcgaaaaactgctggcagtggggcattacctcgaatctaccgtcgatat tgctgagtccacccgccgtattgcggcaagccgcattccggctgatcaca tggtgctgatggcaggtttcaccgccggtaatgaaaaaggcgaactggtg gtgcttggacgcaacggttccgactactctgctgcggtgctggctgcctg tttacgcgccgattgttgcgagatttggacggacgttgacggggtctata cctgcgacccgcgtcaggtgcccgatgcgaggttgttgaagtcgatgtcc taccaggaagcgatggagctttcctacttcggcgctaaagttcttcaccc ccgcaccattacccccatcgcccagttccagatcccttgcctgattaaaa ataccggaaatcctcaagcaccaggtacgctcattggtgccagccgtgat gaagacgaattaccggtcaagggcatttccaatctgaataacatggcaat gttcagcgtttctggtccggggatgaaagggatggtcggcatggcggcgc gcgtctttgcagcgatgtcacgcgcccgtatttccgtggtgctgattacg caatcatcttccgaatacagcatcagtttctgcgttccacaaagcgactg tgtgcgagctgaacgggcaatgcaggaagagttctacctggaactgaaag aaggcttactggagccgctggcagtgacggaacggctggccattatctcg gtggtaggtgatggtatgcgcaccttgcgtgggatctcggcgaaattctt tgccgcactggcccgcgccaatatcaacattgtcgccattgctcagggat cttctgaacgctcaatctctgtcgtggtaaataacgatgatgcgaccact ggcgtgcgcgttactcatcagatgctgttcaataccgatcaggttatcga agtgtttgtgattggcgtcggtggcgttggcggtgcgctgctggagcaac tgaagcgtcagcaaagctggctgaagaataaacatatcgacttacgtgtc tgcggtgttgccaactcgaaggctctgctcaccaatgtacatggccttaa tctggaaaactggcaggaagaactggcgcaagccaaagagccgtttaatc tcgggcgcttaattcgcctcgtgaaagaatatcatctgctgaacccggtc attgttgactgcacttccagccaggcagtggcggatcaatatgccgactt cctgcgcgaaggtttccacgttgtcacgccgaacaaaaaggccaacacct cgtcgatggattactaccatcagttgcgttatgcggcggaaaaatcgcgg cgtaaattcctctatgacaccaacgttggggctggattaccggttattga gaacctgcaaaatctgctcaatgcaggtgatgaattgatgaagttctccg gcattctttctggttcgctttcttatatcttcggcaagttagacgaaggc atgagtttctccgaggcgaccacgctggcgcgggaaatgggttataccga accggacccgcgagatgatctttctggtatggatgtggcgcgtaaactat tgattctcgctcgtgaaacgggacgtgaactggagctggcggatattgaa attgaacctgtgctgcccgcagagtttaacgccgagggtgatgttgccgc ttttatggcgaatctgtcacaactcgacgatctctttgccgcgcgcgtgg cgaaggcccgtgatgaaggaaaagttttgcgctatgttggcaatattgat gaagatggcgtctgccgcgtgaagattgccgaagtggatggtaatgatcc gctgttcaaagtgaaaaatggcgaaaacgccctggccttctatagccact attatcagccgctgccgttggtactgcgcggatatggtgcgggcaatgac gttacagctgccggtgtctttgctgatctgctacgtaccctctcatggaa gttaggagtctga homoserine atggttaaagtttatgccccggcttccagtgccaatatgagcgtcgggtt 45 kinase tgatgtgctcggggcggcggtgacacctgttgatggtgcattgctcggag (thrB atgtagtcacggttgaggcggcagagacattcagtctcaacaacctcgga Escherichia cgctttgccgataagctgccgtcagaaccacgggaaaatatcgtttatca coli gtgctgggagcgtttttgccaggaactgggtaagcaaattccagtggcga MG1655) tgaccctggaaaagaatatgccgatcggttcgggcttaggctccagtgcc tgttcggtggtcgcggcgctgatggcgatgaatgaacactgcggcaagcc gcttaatgacactcgtttgctggctttgatgggcgagctggaaggccgta tctccggcagcattcattacgacaacgtggcaccgtgttttctcggtggt atgcagttgatgatcgaagaaaacgacatcatcagccagcaagtgccagg gtttgatgagtggctgtgggtgctggcgtatccggggattaaagtctcga cggcagaagccagggctattttaccggcgcagtatcgccgccaggattgc attgcgcacgggcgacatctggcaggcttcattcacgcctgctattcccg tcagcctgagcttgccgcgaagctgatgaaagatgttatcgctgaaccct accgtgaacggttactgccaggcttccggcaggcgcggcaggcggtcgcg gaaatcggcgcggtagcgagcggtatctccggctccggcccgaccttgtt cgctctgtgtgacaagccggaaaccgcccagcgcgttgccgactggttgg gtaagaactacctgcaaaatcaggaaggttttgttcatatttgccggctg gatacggcgggcgcacgagtactggaaaactaa threonine atgaaactctacaatctgaaagatcacaacgagcaggtcagctttgcgca 46 synthase agccgtaacccaggggttgggcaaaaatcaggggctgttttttccgcacg (thrC acctgccggaattcagcctgactgaaattgatgagatgctgaagctggat Escherichia tttgtcacccgcagtgcgaagatcctctcggcgtttattggtgatgaaat coli cccacaggaaatcctggaagagcgcgtgcgcgcggcgtttgccttcccgg MG1655) ctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaat gctgacccatattgcgggtgataagccagtgaccattctgaccgcgacct ccggtgataccggagcggcagtggctcatgctttctacggtttaccgaat gtgaaagtggttatcctctatccacgaggcaaaatcagtccactgcaaga aaaactgttctgtacattgggcggcaatatcgaaactgttgccatcgacg gcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa gaactgaaagtggcgctagggttaaactcggctaactcgattaacatcag ccgtttgctggcgcagatttgctactactttgaagctgttgcgcagctgc cgcaggagacgcgcaaccagctggttgtctcggtgccaagcggaaacttc ggcgatttgacggcgggtctgctggcgaagtcactcggtctgccggtgaa acgttttattgctgcgaccaacgtgaacgataccgtgccacgtttcctgc acgacggtcagtggtcacccaaagcgactcaggcgacgttatccaacgcg atggacgtgagtcagccgaacaactggccgcgtgtggaagagttgttccg ccgcaaaatctggcaactgaaagagctgggttatgcagccgtggatgatg aaaccacgcaacagacaatgcgtgagttaaaagaactgggctacacttcg gagccgcacgctgccgtagcttatcgtgcgctgcgtgatcagttgaatcc aggcgaatatggcttgttcctcggcaccgcgcatccggcgaaatttaaag agagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg gcagaacgtgctgatttacccttgctttcacataatctgcccgccgattt tgctgcgttgcgtaaattgatgatgaatcatcagtaa glucose-6- atggcggtaacgcaaacagcccaggcctgtgacctggtcattttcggcgc 24 phosphate gaaaggcgaccttgcgcgtcgtaaattgctgccttccctgtatcaactgg 1- aaaaagccggtcagctcaacccggacacccggattatcggcgtagggcgt dehydrogenase gctgactgggataaagcggcatataccaaagttgtccgcgaggcgctcga (zwf aactttcatgaaagaaaccattgatgaaggtttatgggacaccctgagtg Escherichia cacgtctggatttttgtaatctcgatgtcaatgacactgctgcattcagc coliK-12 cgtctcggcgcgatgctggatcaaaaaaatcgtatcaccattaactactt MG1655) tgccatgccgcccagcacttttggcgcaatttgcaaagggcttggcgagg caaaactgaatgctaaaccggcacgcgtagtcatggagaaaccgctgggg acgtcgctggcgacctcgcaggaaatcaatgatcaggttggcgaatactt cgaggagtgccaggtttaccgtatcgaccactatcttggtaaagaaacgg tgctgaacctgttggcgctgcgttttgctaactccctgtttgtgaataac tgggacaatcgcaccattgatcatgttgagattaccgtggcagaagaagt ggggatcgaagggcgctggggctattttgataaagccggtcagatgcgcg acatgatccagaaccacctgctgcaaattctttgcatgattgcgatgtct ccgccgtctgacctgagcgcagacagcatccgcgatgaaaaagtgaaagt actgaagtctctgcgccgcatcgaccgctccaacgtacgcgaaaaaaccg tacgcgggcaatatactgcgggcttcgcccagggcaaaaaagtgccggga tatctggaagaagagggcgcgaacaagagcagcaatacagaaactttcgt ggcgatccgcgtcgacattgataactggcgctgggccggtgtgccattct acctgcgtactggtaaacgtctgccgaccaaatgttctgaagtcgtggtc tatttcaaaacacctgaactgaatctgtttaaagaatcgtggcaggatct gccgcagaataaactgactatccgtctgcaacctgatgaaggcgtggata tccaggtactgaataaagttcctggccttgaccacaaacataacctgcaa atcaccaagctggatctgagctattcagaaacctttaatcagacgcatct ggcggatgcctatgaacgtttgctgctggaaaccatgcgtggtattcagg cactgtttgtacgtcgcgacgaagtggaagaagcctggaaatgggtagac tccattactgaggcgtgggcgatggacaatgatgcgccgaaaccgtatca ggccggaacctggggacccgttgcctcggtggcgatgattacccgtgatg gtcgttcctggaatgagtttgagtaa DERA atgaacattgcaaagttaattgaccatacaattttaaaagctaatactac 1 (Bacillus taaagaagatgttatgaaagtaatcgaagaagcaaaggaatataaattcg cereus cttctgtttgtattaatcctacatgggtaaagctagctgctgaggaatta ATCC gctggacatgatgtagatgtttgtactgtaatcggtttcccattaggcgc 10987; aagtactactgaaacaaaagctttcgaaacaaaagatgctatcgcaaaag AE017194.1) gtgcaactgaagttgacatggtaatcaacgtaggcgctttaaaagatggc gacgacgaacttgttgaaaaagacatttatgaagtagtacaagcagcaaa aggaaaagctcttgtaaaagtaatcattgaaacttgcctattaacagatg aagagaaagtacgcgcttgtgaattatcagtaaaagctggggctgatttc gtaaaaacttcaactggattctcaactggcggagcaactgctgaagatat cgcattaatgcgtaaaacagttggaccaaacgttggtgtaaaagcatctg gtggcgttcgtacacgtgaagatgcagaaaaaatggtagctgctggagct tctcgcgttggagcaagtgctagtgttgcaatcgtattaaatgatgcaaa aggtgctacagataactactaa DERA atgactgatctgaaagcaagcagcctgcgtgcactgaaattgatggacct 2 (Escherichia gaccaccctgaatgacgacgacaccgacgagaaagtgatcgccctgtgtc coliK12; atcaggccaaaactccggtcggcaataccgccgctatctgtatctatcct CP009685) cgctttatcccgattgctcgcaaaactctgaaagagcagggcaccccgga aatccgtatcgctacggtaaccaacttcccacacggtaacgacgacatcg acatcgcgctggcagaaacccgtgcggcaatcgcctacggtgctgatgaa gttgacgttgtgttcccgtaccgcgcgctgatggcgggtaacgagcaggt tggttttgacctggtgaaagcctgtaaagaggcttgcgcggcagcgaatg tactgctgaaagtgatcatcgaaaccggcgaactgaaagacgaagcgctg atccgtaaagcgtctgaaatctccatcaaagcgggtgcggacttcatcaa aacctctaccggtaaagtggctgtgaacgcgacgccggaaagcgcgcgca tcatgatggaagtgatccgtgatatgggcgtagaaaaaaccgttggtttc aaaccggcgggcggcgtgcgtactgcggaagatgcgcagaaatatctcgc cattgcagatgaactgttcggtgctgactgggcagatgcgcgtcactacc gctttggcgcttccagcctgctggcaagcctgctgaaagcgctgggtcac ggcgacggtaagagcgccagcagctactaa DERA atgtcacgttcgattgcacaaatgattgatcatacgctacttaaaccaaa 3 (Bacillus tacaacagaagaccaaattgtaaagctctgtgaggaagcaaaggaatatt halodurans catttgcatctgtttgtgtgaatcctacttgggtcgctcttgctgcgcag C-125; ttgctaaaagatgcacctgatgtgaaagtatgtacagttatcggctttcc BA000004) gttaggggcaacgactccggaagtgaaagcgtttgaaacgactaatgcca ttgaaaatggagcgacagaagtggacatggtcattaacattggagcgtta aaagataaacaatacgagcttgttggacgcgacattcaagcggttgttaa agcagcagaagggaaagcattaacgaaagtaatcattgaaacatcgttat taacggaggaagagaagaaggctgcgtgtgagcttgccgtaaaagcagga gccgactttgtcaaaacgtcgactggattctctggcggaggtgctacggc tgaggatatcgcgctcatgcgaaaagtggtcggaccaaatttaggagtca aagcttctggaggtgttagagatctgtccgacgcgaaagcgatgattgat gctggtgctactcggattggtgcgagtgctggggtggcgattgttaacgg ggagcgtagcgaagggagttattaa DERA atgtcattagccaacataattgatcatacagctttgaaaccgcatacaca 4 (Bacillus aaaagcggacattctaaaactaattgaagaagcgaaaacatacaaatttg subtilis cttcagtatgtgtcaatccgacatgggtggagcttgctgcaaaagagctt subsp. aagggaactggagtcgacgtttgtacggtcatcggcttcccgctcggtgc subtilisstr. caatacaactgaaacaaaagcgttcgaaacaaaagacgccatttcaaaag 168; gcgccactgaagtggatatggtcattaatattgccgctttaaaagacaag AL009126.3) gaagacgatgtggtggaagctgatatccgcggtgtagtggaagctgtagc cggaaaagcgcttgtcaaagtcattatcgaaacgtgccttctgactgatg aagaaaaagaacgtgcatgccgtttagcggtgtctgcgggagcggatttc gtaaaaacatcaacaggcttttctacaggcggcgcaacgaaggaagatat cgccttaatgcgcaaaacagtagggcctgatatcggcgtgaaagcatctg gcggcgtcagaacgaaagaagatgtagacacaatggtagaggccggagca agccgaattggcgccagcgcaggcgtttctatcgtaaaaggagaaaatgc atcaggcggagacaactattaa DERA atgatagagtacaggattgaggaggcagtagcgaagtacagagagttcta 5 (Thermotoga cgaattcaagcccgtcagagaaagcgcaggtattgaagatgtgaaaagtg maritima; ctatagagcacacgaatctgaaaccgtttgccacaccagacgatataaaa CP011108) aaactctgtcttgaagcaagggaaaatcgtttccatggagtctgtgtgaa tccgtgttatgtgaaactggctcgtgaagaactcgaaggaaccgatgtga aagtcgtcaccgttgttggttttccactgggagcgaacgaaactcggacg aaagcccatgaggcgattttcgctgttgagagtggagccgatgagatcga tatggtcatcaacgttggcatgctcaaggcaaaggagtgggagtacgttt acgaggatataagaagtgttgtcgaatcggtgaaaggaaaagttgtgaag gtgatcatcgaaacgtgctatctggatacggaagagaagatagcggcgtg tgtcatttccaaacttgctggagctcatttcgtgaagacttccacgggat ttggaacaggaggggcgaccgcagaagacgttcatctcatgaaatggatc gtgggagatgagatgggtgtaaaagcttccggagggatcagaaccttcga ggacgctgttaaaatgatcatgtacggtgctgatagaataggaacgagtt cgggagttaagatcgttcaggggggagaagagagatatggaggttaa DERA gtggttaaaatgaatgtggagacaagggaggaacttgcatcacttataga 6 (Methano- ccacaccaatgtgagggctgatgcaacagaaaatgatattgagaggctat thermobacter gcagggaggcggtcagctacggcttcaggtgcgcggtggtcacacccacc thermau- aatgtcaggctggcggctgaactccttgaggggaccgatgtgacggtctg trophicus; ctcagttgttggtttcccggcaggcgtcagtacaccccgcgttaaggccc AP011952) ttgaagcctctgaggccgttgagaacggggccggtgaggtggacatggtc atgaatatcggggccatgaagtcaggcaatagggagctcgtatacaggga tatcagcggcgttgttgatgccgccggcgtccccgtcaaggttatacttg aaacagcctatctcacagacaaggagaaggttgaagcctgccttataagt aaagaggccggtgcggcatttgttaaaacatcaacagcctatggtggact agccggcgccacagttgaggatgtgatgctcatgcggaaaacggtgggtg atgagatgggagtcaaggcatctgggggaataagggatcttgaaacagcc cttgcgatgatagatgctggggcagacaggatcgggacatcaaccggtgt acagataatcgagggatggaggtaa DERA atgtcactcgcctcctacatcgaccacacgctgcttaaggccaccgccac 7 (Deinococcus gctcgccgacatccgcacgctgtgtgaggaagcccgcgagcactcgttct radiodurans; acgcggtgtgcatcaacccggtctttattccccacgcccgcgcctggctc AE00050) gaaggcagcgacgtgaaggtcgccaccgtctgcggctttcccctcggcgc catcagctccgagcagaaagctctggaagcccgcctgagcgccgaaacgg gcgccgacgaaatcgatatggtcatccacatcggctcggcgcttgccggc gactgggacgcggtggaagccgacgtgcgggcagtgcgccgcgcggtgcc cgagcaggtgctcaaggtgattatcgaaacctgctacctgaccgacgagc aaaagcgcttggcgactgaggtcgccgtacagggcggcgccgacttcgtg aagacgagcacaggcttcggcaccggcggcgccaccgtggacgacgtgcg cctgatggcggaagtgatcgggggccgcgccggactcaaggcggcgggcg gcgtccgcactcctgccgacgcgcaagccatgatcgaggcgggcgcgacc cggctgggcacctcgggcggcgtgggtctggtgtcgggcggcgaaaacgg agccggctactaa DERA atgaatagtgcaaaattgattgatcacactttattgaagcctgagtcaac 8 (Staphylococcus acgtacgcaaatcgatcaaatcatcgatgaagcgaaagcataccatttta aureus aatctgtatgtgtgaatccaacgcatgttaaatatgcagcagagcgacta subsp. gctgattcagaggtgttagtttgtacggtaataggattcccattaggtgc aureus atcgacaactgcgacgaaagcatttgaaacagaagatgcgattcaaaatg Mu50; gtgcagatgaaattgacatggtcatcaacatcggcgcattaaaagatgga BA000017) cgttttgatgatgtacaacaagacattgaagcagtggtgaaagctgcgaa aggtcacacagtaaaagtgattattgagacggtattgttggaccatgacg aaatcgtaaaagcgagtgaattaacaaaagtggctggtgcggacttcgtt aaaacttcaacaggttttgcaggtggcggtgcgactgcagaagacgttaa attaatgaaagatacagtaggtgctgatgtagaagtaaaagcatcaggtg gcgtacgtaatttagaagatttcaataaaatggttgaagcaggtgcgaca cgtattggtgcgagcgcaggcgttcaaattatgcaaggtttagaagcaga ttcagattactaa DERA atgacaattgctaaaatgatcgatcatactgctttaaaaccagacacaac 9 (Listeria gaaagaacaaattttaaccctaacaaaagaagcaagagaatacggctttg monocytogenes catccgtatgtgtgaacccaacttgggtaaaactatccgctgaacaactt EGD-e; gctggagcagaatccgtagtatgtactgttatcggtttcccactaggagc HG421741) gaatacccctgaagtaaaagcatttgaagtgaaagatgccatccaaaacg gcgcgaaagaagtcgatatggttatcaatatcggtgcacttaaagacaag gacgacgaattagtagaacgcgatattcgcgctgttgtcgatgttgctaa aggcaaagcattagtaaaagtaattatcgaaacttgcctattaacagacg aagaaaaagtgcgcgcatgcgaaatcgctgtaaaagcaggaacagacttc gttaaaacatctacaggattttcaacaggtggcgcaactgccgaagatat cgccttgatgcgtaaaacagttggaccgaacatcggtgtaaaagcatctg gtggggttcgtacgaaagaagacgtagaaaaaatgatcgaagcaggcgca actcgtatcggcgcaagtgcaggcgttgcaattgtttccggcgaaaaacc agctaaacctgataattactaa DERA atgaaattaaataaatatatagatcatacgcttttaaaacaagatgcaaa 10 (Streptococcus gaaaaaacaaattgatagtttgttgtctgaggctagagagtatgactttg pneumoniae ccagtgtttgcgttaatccgacctgggttgaacatgctaaaaaaggactt TIGR4; gaaggcacagatgttaaggtttgcacagtagtaggtttccctttgggagc AE005672) aacaacttcagccgtgaaagcatttgagacaaaagaagctatccaaaatg gtgcagatgagattgatatggtgatcaatgttggagctctcaaatcaggt aatttagccttggttgagtcagatattcgcgcagtagtggaagcaagtgg tgataagttagtgaaagtcattattgaagcttgccttctgacagaccaag aaaaagttgttgtttgccaattggcccaaaaagctggggctgactttgtc aaaacatctactggcttttcaactggtggtgctacgatagcagatgttac attaatgcgtgaaacagttggatctgatatgggtgtcaaggccgccggtg gagctcgttcttatgcagatgctcttgcctttgtcgaagcaggtgcgacc cgtatcggaacgtcagctggggtagctattttaaaaggagaattggcaga tggcgactactaa BFD atggcttcggtacacggcaccacatacgaactcttgcgacgtcaaggcat 78 (Pseudomonas cgatacggtcttcggcaatcctggctcgaacgagctcccgtttttgaagg putida; actttccagaggactttcgatacatcctggctttgcaggaagcgtgtgtg Ap013070.1) gtgggcattgcagacggctatgcgcaagccagtcggaagccggctttcat taacctgcattctgctgctggtaccggcaatgctatgggtgcactcagta acgcctggaactcacattccccgctgatcgtcactgccggccagcagacc agggcgatgattggcgttgaagctctgctgaccaacgtcgatgccgccaa cctgccacgaccacttgtcaaatggagctacgagcccgcaagcgcagcag aagtccctcatgcgatgagcagggctatccatatggcaagcatggcgcca caaggccctgtctatctttcggtgccatatgacgattgggataaggatgc tgatcctcagtcccaccacctttttgatcgccatgtcagttcatcagtac gcctgaacgaccaggatctcgatattctggtgaaagctctcaacagcgca tccaacccggcgatcgtcctgggcccggacgtcgacgcagcaaatgcgaa cgcagactgcgtcatgttggccgaacgcctcaaagctccggtttgggttg cgccatccgctccacgctgcccattccctacccgtcatccttgcttccgt ggattgatgccagctggcatcgcagcgatttctcagctgctcgaaggtca cgatgtggttttggtaatcggcgctccagtgttccgttaccaccaatacg acccaggtcaatatctcaaacctggcacgcgattgatttcggtgacctgc gacccgctcgaagctgcacgcgcgccaatgggcgatgcgatcgtggcaga cattggtgcgatggctagcgctcttgccaacttggttgaagagagcagcc gccagctcccaactgcagctccggaacccgcgaaggttgaccaagacgct ggccgacttcacccagagacagtgttcgacacactgaacgacatggcccc ggagaatgcgatttacctgaacgagtcgacttcaacgaccgcccaaatgt ggcagcgcctgaacatgcgcaaccctggtagctactacttctgtgcagct ggcggactgggcttcgccctgcctgcagcaattggcgttcaactcgcaga acccgagcgacaagtcatcgccgtcattggcgacggatcggcgaactaca gcattagtgcgttgtggactgcagctcagtacaacatccccactatcttc gtgatcatgaacaacggcacctacggtgcgttgcgatggtttgccggcgt tctcgaagcagaaaacgttcctgggctggatgtgccagggatcgacttcc gcgcactcgccaagggctatggtgtccaagcgctgaaagccgacaacctt gagcagctcaagggttcgctacaagaagcgctttctgccaaaggcccggt acttatcgaagtaagcaccgtaagcccggtgaagtga KDC atgtatacagtaggagattacctgttagaccgattacacgagttgggaat 79 (Lactococcus tgaagaaatttttggagttcctggtgactataacttacaatttttagatc lactis; aaattatttcacgcgaagatatgaaatggattggaaatgctaatgaatta AY548760.1) aatgcttcttatatggctgatggttatgctcgtactaaaaaagctgccgc atttctcaccacatttggagtcggcgaattgagtgcgatcaatggactgg caggaagttatgccgaaaatttaccagtagtagaaattgttggttcacca acttcaaaagtacaaaatgacggaaaatttgtccatcatacactagcaga tggtgattttaaacactttatgaagatgcatgaacctgttacagcagcgc ggactttactgacagcagaaaatgccacatatgaaattgaccgagtactt tctcaattactaaaagaaagaaaaccagtctatattaacttaccagtcga tgttgctgcagcaaaagcagagaagcctgcattatctttagaaaaagaaa gctctacaacaaatacaactgaacaagtgattttgagtaagattgaagaa agtttgaaaaatgcccaaaaaccagtagtgattgcaggacacgaagtaat tagttttggtttagaaaaaacggtaactcagtttgtttcagaaacaaaac taccgattacgacactaaattttggtaaaagtgctgttgatgaatctttg ccctcatttttaggaatatataacgggaaactttcagaaatcagtcttaa aaattttgtggagtccgcagactttatcctaatgcttggagtgaagctta cggactcctcaacaggtgcattcacacatcatttagatgaaaataaaatg atttcactaaacatagatgaaggaataattttcaataaagtggtagaaga ttttgattttagagcagtggtttcttctttatcagaattaaaaggaatag aatatgaaggacaatatattgataagcaatatgaagaatttattccatca agtgctcccttatcacaagaccgtctatggcaggcagttgaaagtttgac tcaaagcaatgaaacaatcgttgctgaacaaggaacctcattttttggag cttcaacaattttcttaaaatcaaatagtcgttttattggacaaccttta tggggttctattggatatacttttccagcggctttaggaagccaaattgc ggataaagagagcagacaccttttatttattggtgatggttcacttcaac ttaccgtacaagaattaggactatcaatcagagaaaaactcaatccaatt tgttttatcataaataatgatggttatacagttgaaagagaaatccacgg acctactcaaagttataacgacattccaatgtggaattactcgaaattac cagaaacatttggagcaacagaagatcgtgtagtatcaaaaattgttaga acagagaatgaatttgtgtctgtcatgaaagaagcccaagcagatgtcaa tagaatgtattggatagaactagttttggaaaaagaagatgcgccaaaat tactgaaaaaaatgggtaaattatttgctgagcaaaataaatag KDC atgaccgatgacggctacacagtcggtgactacctcctggaccggctcgc 70 (Mycobacterium cgaactcggcgtgaccgaggtcttcggcgtccccggcgactatcagctgg smegmatis agttcctcgaccacgtcgtggcgcacccgcgcatcacgtgggtcggcggc (strain gcgaacgaactcaacgcgggctacgcggccgacggctacggccggctgcg ATCC gggcatggcggcgttggtcaccacgttcggcgtcggtgagctctcggcgg 700084/ ccaacgccatcgcaggcagctacgccgagcacgtcccggtggtgcacatc mc(2)155); gtcggcgcgccgtcgaaggattcgcaggccgcgcggcgcatcgtgcacca A0R480) cacgctgggtgacggcgatttcgagcacttcctgcgcatgagccgcgaga tcacctgcgcgcaggccaatctggtgcccgccacggcgacccgcgagatc gaccgcgtgctctcggaggtgcacgagcagaagcggcccggctatctgct gatcgcgaccgacgtcgcccgcttccccaccgaaccaccgaccgccccgc tgccgcgccacagcgggggcaccagcccacgggcgctgtcgctgttcacc gaggccgcaacgcaactcatcggcgagcaccggttgaccgtgctggccga tttcctggtgcaccgcatgggatgcgtcgaggcgctcaacaagctgctga ccgccgacaccgtgccgcacgccacgctgatgtggggcaagagcctggtc gacgagagttcgccgaacttcctgggcatctacgccggtgcggccagtga gggctcggtgcgcgaggtgatcgaggacgcgcctgtgctggtgaccgcag gtgtgctgttcaccgacatggtcagcgggttcttcagccagcgcatcgac ccggcacgcacgatcgacatcggggtcaaccagagcgtcgtcgccgggca ggtgttcgcgccgctggacatggctgccgcgctcgacgcgctcgcgtcga tcctcgccgaacgcggcatcgagtcgcccgcactgccgccggcccccgca ccgcagcggcccgcagcgccgccgcgtgacgcggtgcttacacaggaagc gttgtgggacaggctcgccgaggcgttgacgccgggcaacgtggtgctcg ccgaccagggcacgtctttctacggcctggccgggcaccggctggcgtcg ggcgtgacattcatcggtcagccgttgtgggcgtcgatcggctacacact gcccgccgcgctcggcgcgggtctggccgaccgcgaccggcgcacggtgc tgctgatcggcgacggcgcagcgcagttgacggtgcaggaactcggcgcg ttcggccgcgaggggctcacgcccgtggtggtggtcgtcaacaacaacgg ctacaccgtggagcgcgcgatccacggtgtcacggcccgctacaacgaca tcacggcgtggcggtggaccgagttgccggccgcactcggtgtgcccgat gcgctgacgttccgctgcgccacctacggcgaactcgacgacgcgctgac cgtcgccgccgagacgcaggaccgcatggtgttcgtcgaggtgatgcttg agcgcatggacattccgccgctgctgggcgagctcgcacagtcggcgtcg gccgccaacgccaaatag Proteinsequence PA1127 MSVESIRIEGIDTPVSRIGLGTWAIGGWMWGGADDAT 31 (Akr SVETIRRAVESGINLIDTAPVYGFGHSEEVVGKALQG Pseudomonas LRDKAVIATKAALEWSDAGIHRNASAARIRREVEDSL aeruginosa RRLKTDRIDLYQIHWPDPLVAHEETAGELERLRRDGK PAO1) ILAIGVSNYSPEQMDGFRQFAPLASVQPPYNLFERAI DADVLPYAERNGIVVLAYGALCRGLLSGRMNAETRFD GDDLRKSDPKFQQPRFAQYLAAVAQLEELARERYGKS VLALAIRWILDRGPTVALWGARKPEQLNGIADAFGWR LDDEAMARIERILAETIQDPVGPEFMAPPSRNA PDCZ. MSYTVGTYLAERLVQIGLKHHFAVAGDYNLVLLDNLL 71 mobilis LNKNMEQVYCCNELNCGFSAEGYARAKGAAAAVVTYS ZM4= VGALSAFDAIGGAYAENLPVILISGAPNNNDHAAGHV ATCC31821 LHHALGKTDYHYQLEMAKNITAAAEAIYTPEEAPAKI DHVIKTALREKKPVYLEIACNIASMPCAAPGPASALF NDEASDEASLNAAVEETLKFIANRDKVAVLVGSKLRA AGAEEAAVKFADALGGAVATMAAAKSFFPEENPHYIG TSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWT DIPDPKKLVLAEPRSVVVNGIRFPSVHLKDYLTRLAQ KVSKKTGALDFFKSLNAGELKKAAPADPSAPLVNAEI ARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGARVE YEMQWGHIGWSVPAAFGYAVGAPERRNILMVGDGSFQ LTAQEVAQMVRLKLPVIIFLINNYGYTIEVMIHDGPY NNIKNWDYAGLMEVFNGNGGYDSGAGKGLKAKTGGEL AEAIKVALANTDGPTLIECFIGREDCTEELVKWGKRV AAANSRKPVNKLL* Pyruvate MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALV 25 dependent AGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVGAGTV aldolase LNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPL (Eda IPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQA Escherichia IAGPFSQVRFCPTGGISPANYRDYLALKSVLCIGGSW coliK-12 LVPADALEAGDYDRITKLAREAVEGAKL MG1655) 4-hydroxy- MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALD 26 2-oxovalerate DARVDSIEVAHGDGLQGSSFNYGFGAHSDLEWIEAAA aldolase DVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVAT (MphE HCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENL Escherichia AKQAKLMEGYGATCIYVVDSGGAMNMSDIRDRFRALK coliK-12 AELKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDA MG1655) SLAGMGAGAGNAPLEVFIAAADKLGWQHGTDLYALMD AADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCE TAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDL RNNK 4-hydroxy- MKLEGKKVTVHDMTLRDGMHPKRHQMTLEQMKSIACG 27 2-oxovalerate LDAAGIPLIEVTHGDGLGGSSVNYGFPAHSDEEYLGA aldolase VIPLMKQAKVSALLLPGIGTVEHLKMAKDLGVNTIRV (Paraburkholderia ATHCTEADVSEQHITQSRKLGLDTVGFLMMAHMASPE xenovorans KLVSQALLMQGYGANCIYVTDSAGYMLPDDVKARLSA LB400) VRAALKPETELGFHGHHNLAMGVANSIAAIEAGATRI DAAAAGLGAGAGNTPMEVFIAVCARMGIETGVDVFKI QDVAEDLVVPIMDHVIRIDRDSLTLGYAGVYSSFLLF AKRASAKYGVPARDILVELGRRGMVGGQEDMIEDTAM TMARERGLTLTAA 4-hydroxy- MENSFKAALKAGRPQIGLWLGLSSSYSAELLAGAGFD 83 2-oxoheptane WLLIDGEHAPNNVQTVLTQLQAIAPYPSQPVVRPSWN dioate DPVQIKQLLDVGTQTLLVPMVQNADEAREAVRATRYP aldolase PAGIRGVGSALARASRWNRIPDYLQKANDQMCVLVQI (HpcH/HpaI ETREAMKNLPQILDVEGVDGVFIGPADLSADMGYAGN Escherichia PQHPEVQAAIEQAIVQIRESGKAPGILIANEQLAKRY coli LELGALFVAVGVDTTLLARAAEALAARFGAQATAVKP ATCC8739) GVY Threonine MADSQPLSGAPEGAEYLRAVLRAPVYEAAQVTPLQKM 47 dehydratase EKLSSRLDNVILVKREDRQPVHSFKLRGAYAMMAGLT ilvA EEQKAHGVITASAGNHAQGVAFSSARLGVKALIVMPT (Escherichia ATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELSQQ coliK-12 QGFTWVPPFDHPMVIAGQGTLALELLQQDAHLDRVFV MG1655) PVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKA ALDAGHPVDLPRVGLFAEGVAVKRIGDETFRLCQEYL DDIITVDSDAICAAMKDLFEDVRAVAEPSGALALAGM KKYIALHNIRGERLAHILSGANVNFHGLRYVSERCEL GEQREALLAVTIPEEKGSFLKFCQLLGGRSVTEFNYR FADAKNACIFVGVRLSRGLEERKEILQMLNDGGYSVV DLSDDEMAKLHVRYMVGGRPSHPLQERLYSFEFPESP GALLRFLNTLGTYWNISLFHYRSHGTDYGRVLAAFEL GDHEPDFETRLNELGYDCHDETNNPAFRFFLAG Alpha- MYTVGDYLLDRLHELGIEEIFGVPGDYNLQFLDQIIS 66 ketoisovalerate RKDMKWVGNANELNASYMADGYARTKKAAAFLTTFGV decarboxlase GELSAVNGLAGSYAENLPVVEIVGSPTSKVQNEGKFV kivD HHTLADGDFKHFMKMHEPVTAARTLLTAENATVEIDR (Lactococcus VLSALLKERKPVYINLPVDVAAAKAEKPSLPLKKENP lactis TSNTSDQEILNKIQESLKNAKKPIVITGHEIISFGLE lactis NTVTQFISKTKLPITTLNFGKSSVDETLPSFLGIYNG KF147) KLSEPNLKEFVESADFILMLGVKLTDSSTGAFTHHLN ENKMISLNIDEGKIFNESIQNFDFESLISSLLDLSGI EYKGKYIDKKQEDFVPSNALLSQDRLWQAVENLTQSN ETIVAEQGTSFFGASSIFLKPKSHFIGQPLWGSIGYT FPAALGSQIADKESRHLLFIGDGSLQLTVQELGLAIR EKINPICFIINNDGYTVEREIHGPNQSYNDIPMWNYS KLPESFGATEERVVSKIVRTENEFVSVMKEAQADPNR MYWIELVLAKEDAPKVLKKMGKLFAEQNKS 2- MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALER 51 isopro- MGVDVMEVGFPVSSPGDFESVQTIARQVKNSRVCALA pylmalate RCVEKDIDVAAESLKVAEAFRIHTFIATSPMHIATKL synthase RSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPI (leuA ADLARVVEAAINAGATTINIPDTVGYTMPFEFAGIIS Escherichia GLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGA coliK-13 RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHT MG1655) AINHQEIWRTSQLVSQICNMPIPANKAIVGSGAFAHS SGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSG RAAVKHRMDEMGYKESEYNLDNLYDAFLKLADKKGQV FDYDLEALAFIGKQQEEPEHFRLDYFSVQSGSNDIAT AAVKLACGEEVKAEAANGNGPVDAVYQAINRITEYNV ELVKYSLTAKGHGKDALGQVDIVANYNGRRFHGVGLA TDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQHNEN NKETV 3- MSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMR 54 isopropylmalate ITTSHYDVGGAAIDNHGQPLPPATVEGCEQADAVLFG dehydrogenase SVGGPKWEHLPPDQQPERGALLPLRKHFKLFSNLRPA (leuB KLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQ Escherichia PKGREGSGQYEKAFDTEVYHRFEIERIARIAFESARK coliK-12 RRHKVTSIDKANVLQSSILWREIVNEIATEYPDVELA MG1655) HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAM ITGSMGMLPSASLNEQGFGLYEPAGGSAPDIAGKNIA NPIAQILSLALLLRYSLDADDAACAIERAINRALEEG IRTGDLARGAAAVSTDEMGDIIARYVAEGV Isopropylmalate MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTS 57 dehydratase PQAFDGLRAHGRPVRQPGKTFATMDHNVSTQTKDINA (leuC CGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVM Escherichia GPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSE coliK-12 VEHVLATQTLKQGRAKTMKIEVQGKAAPGITAKDIVL Mg1655 AIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAV AYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQ VISVNDNIPDPASFADPVERASAEKALAYMGLKPGIP LTEVAIDKVFIGSCTNSRIEDLRAAAEIAKGRKVAPG VQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGC SMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHL VSPAMAAAAAVTGHFADIRNIK Isopropylmalate MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRT 60 dehydratase GFGAHLFNDWRFLDEKGQQPNPDFVLNFPQYQGASIL (leuD LARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFY Escherichia GNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDL coliK-12 EAQEVKAGEKTYRFTIDAFRRHCMMNGLDSIGLTLQH Mg1655) DDAIAAYEAKQPAFMN aspartate MRVLKFGGTSVANAERFLRVADILESNARQGQVATVL 35 kinase/ SAPAKITNHLVAMIEKTISGQDALPNISDAERIFAEL homoserine LTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLL dehydrogenase GQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVI (thra DPVEKLLAVGHYLESTVDIAESTRRIAASRIPADHMV Escherichia LMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC coli CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSY MG1655) FGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIG ASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAA RVFAAMSRARISVVLITQSSSEYSISFCVPQSDCVRA ERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMR TLRGISAKFFAALARANINIVAIAQGSSERSISVVVN NDDATTGVRVTHQMLFNTDQVIEVFVIGVGGVGGALL EQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNL ENWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCT SSQAVADQYADFLREGFHVVTPNKKANTSSMDYYHQL RYAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDEL MKFSGILSGSLSYIFGKLDEGMSFSEATTLAREMGYT EPDPRDDLSGMDVARKLLILARETGRELELADIEIEP VLPAEFNAEGDVAAFMANLSQLDDLFAARVAKARDEG KVLRYVGNIDEDGVCRVKIAEVDGNDPLFKVKNGENA LAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTL SWKLGV homoserine MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVT 38 kinase VEAAETFSLNNLGRFADKLPSEPRENIVYQCWERFCQ (thrB ELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMN Escherichia EHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFL coli GGMQLMIEENDIISQQVPGFDEWLWVLAYPGIKVSTA MG1655) EARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGI SGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVH ICRLDTAGARVLEN threonine MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPE 41 synthase FSLTEIDEMLKLDFVTRSAKILSAFIGDEIPQEILEE (thrC RVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGG Escherichia RFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGL coli PNVKVVILYPRGKISPLQEKLFCTLGGNIETVAIDGD MG1655) FDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ ICYYFEAVAQLPQETRNQLVVSVPSGNFGDLTAGLLA KSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQAT LSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDD ETTQQTMRELKELGYTSEPHAAVAYRALRDQLNPGEY GLFLGTAHPAKFKESVEAILGETLDLPKELAERADLP LLSHNLPADFAALRKLMMNHQ glucose-6- MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAG 21 phosphate QLNPDTRIIGVGRADWDKAAYTKVVREALETFMKETI 1- DEGLWDTLSARLDFCNLDVNDTAAFSRLGAMLDQKNR dehydrogenase ITINYFAMPPSTFGAICKGLGEAKLNAKPARVVMEKP (zwf LGTSLATSQEINDQVGEYFEECQVYRIDHYLGKETVL Escherichia NLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGR coliK-12 WGYFDKAGQMRDMIQNHLLQILCMIAMSPPSDLSADS MG1655) IRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGK KVPGYLEEEGANKSSNTETFVAIRVDIDNWRWAGVPF YLRTGKRLPTKCSEVVVYFKTPELNLFKESWQDLPQN KLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLS YSETFNQTHLADAYERLLLETMRGIQALFVRRDEVEE AWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMIT RDGRSWNEFE DERA MIEYRIEEAVAKYREFYEFKPVRESAGIEDVKSAIEH 11 (Thermotoga TNLKPFATPDDIKKLCLEARENRFHGVCVNPCYVKLA maritima; REELEGTDVKVVTVVGFPLGANETRTKAHEAIFAVES AAD36625.1) GADEIDMVINVGMLKAKEWEYVYEDIRSVVESVKGKV VKVIIETCYLDTEEKIAACVISKLAGAHFVKTSTGFG TGGATAEDVHLMKWIVGDEMGVKASGGIRTFEDAVKM IMYGADRIGTSSGVKIVQGGEERYGG DERA MVKMNVETREELASLIDHTNVRADATENDIERLCREA 12 (Methano- VSYGFRCAVVTPTNVRLAAELLEGTDVTVCSVVGFPA thermobacter GVSTPRVKALEASEAVENGAGEVDMVMNIGAMKSGNR thermauto- ELVYRDISGVVDAAGVPVKVILETAYLTDKEKVEACL trophicus; ISKEAGAAFVKTSTAYGGLAGATVEDVMLMRKTVGDE AAB85318.1) MGVKASGGIRDLETALAMIDAGADRIGTSTGVQIIEG WR DERA MSLASYIDHTLLKATATLADIRTLCEEAREHSFYAVC 13 (Deinococcus INPVFIPHARAWLEGSDVKVATVCGFPLGAISSEQKA radiodurans; LEARLSAETGADEIDMVIHIGSALAGDWDAVEADVRA AAF10775.1) VRRAVPEQVLKVIIETCYLTDEQKRLATEVAVQGGAD FVKTSTGFGTGGATVDDVRLMAEVIGGRAGLKAAGGV RTPADAQAMIEAGATRLGTSGGVGLVSGGENGAGY DERA MNSAKLIDHTLLKPESTRTQIDQIIDEAKAYHFKSVC 14 (Staphylococcus VNPTHVKYAAERLADSEVLVCTVIGFPLGASTTATKA aureus; FETEDAIQNGADEIDMVINIGALKDGRFDDVQQDIEA strain VVKAAKGHTVKVIIETVLLDHDEIVKASELTKVAGAD Mu50; FVKTSTGFAGGGATAEDVKLMKDTVGADVEVKASGGV WP_001083318.1) RNLEDFNKMVEAGATRIGASAGVQIMQGLEADSDY DERA MKLNKYIDHTLLKQDAKKKQIDSLLSEAREYDFASVC 15 (Streptococcus VNPTWVEHAKKGLEGTDVKVCTVVGFPLGATTSAVKA pneumoniae FETKEAIQNGADEIDMVINVGALKSGNLALVESDIRA serotype VVEASGDKLVKVIIEACLLTDQEKVVVCQLAQKAGAD 4(strain FVKTSTGFSTGGATIADVTLMRETVGSDMGVKAAGGA ATCC RSYADALAFVEAGATRIGTSAGVAILKGELADGDY BAA-334/ TIGR4); WP_000773677.1) DERA MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAK 16 (Escherichia TPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVT coli NFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALM (strain AGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDE K12); ALIRKASEISIKAGADFIKTSTGKVAVNATPESARIM NP_418798.1) MEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADEL FGADWADARHYRFGASSLLASLLKALGHGDGKSASSY DERA MTIAKMIDHTALKPDTTKEQILTLTKEAREYGFASVC 17 (Listeria VNPTWVKLSAEQLAGAESVVCTVIGFPLGANTPEVKA monocytogenes FEVKDAIQNGAKEVDMVINIGALKDKDDELVERDIRA serovar VVDVAKGKALVKVIIETCLLTDEEKVRACEIAVKAGT 1/2a(strain DFVKTSTGFSTGGATAEDIALMRKTVGPNIGVKASGG ATCC VRTKEDVEKMIEAGATRIGASAGVAIVSGEKPAKPDN BAA-679/ Y EGD-e); NP_465519.1) DERA MSRSIAQMIDHTLLKPNTTEDQIVKLCEEAKEYSFAS 18 (Bacillus VCVNPTWVALAAQLLKDAPDVKVCTVIGFPLGATTPE halodurans VKAFETTNAIENGATEVDMVINIGALKDKQYELVGRD (strain IQAVVKAAEGKALTKVIIETSLLTEEEKKAACELAVK ATCC AGADFVKTSTGFSGGGATAEDIALMRKVVGPNLGVKA BAA-125/ SGGVRDLSDAKAMIDAGATRIGASAGVAIVNGERSEG DSM18197/ SY FERM7344/ JCM9153/ C-125); WP_010897517.1) DERA MNIAKLIDHTILKANTTKEDVMKVIEEAKEYKFASVC 19 (Bacillus INPTWVKLAAEELAGHDVDVCTVIGFPLGASTTETKA cereus FETKDAIAKGATEVDMVINVGALKDGDDELVEKDIYE (strain VVQAAKGKALVKVIIETCLLTDEEKVRACELSVKAGA ATCC10987/ DFVKTSTGFSTGGATAEDIALMRKTVGPNVGVKASGG NRS248); VRTREDAEKMVAAGASRVGASASVAIVLNDAKGATDN WP_001017443.1) Y DERA MSLANIIDHTALKPHTQKADILKLIEEAKTYKFASVC 20 (Bacillus VNPTWVELAAKELKGTGVDVCTVIGFPLGANTTETKA subtilis FETKDAISKGATEVDMVINIAALKDKEDDVVEADIRG (strain VVEAVAGKALVKVIIETCLLTDEEKERACRLAVSAGA 168); DFVKTSTGFSTGGATKEDIALMRKTVGPDIGVKASGG CAB15978.2) VRTKEDVDTMVEAGASRIGASAGVSIVKGENASGGDN Y BFD MASVHGTTYELLRRQGIDTVFGNPGSNELPFLKDFPE 76 (Benzoylformate DFRYILALQEACVVGIADGYAQASRKPAFINLHSAAG decarboxylase; TGNAMGALSNAWNSHSPLIVTAGQQTRAMIGVEALLT Pseudomonas NVDAANLPRPLVKWSYEPASAAEVPHAMSRAIHMASM putida APQGPVYLSVPYDDWDKDADPQSHHLFDRHVSSSVRL NBRC14164; NDQDLDILVKALNSASNPAIVLGPDVDAANANADCVM WP_016501746.1) LAERLKAPVWVAPSAPRCPFPTRHPCFRGLMPAGIAA ISQLLEGHDVVLVIGAPVFRYHQYDPGQYLKPGTRLI SVTCDPLEAARAPMGDAIVADIGAMASALANLVEESS RQLPTAAPEPAKVDQDAGRLHPETVFDTLNDMAPENA IYLNESTSTTAQMWQRLNMRNPGSYYFCAAGGLGFAL PAAIGVQLAEPERQVIAVIGDGSANYSISALWTAAQY NIPTIFVIMNNGTYGALRWFAGVLEAENVPGLDVPGI DFRALAKGYGVQALKADNLEQLKGSLQEALSAKGPVL IEVSTVSPVK KDC MYTVGDYLLDRLHELGIEEIFGVPGDYNLQFLDQIIS 77 (indole-3- REDMKWIGNANELNASYMADGYARTKKAAAFLTTFGV pyruvate GELSAINGAGSYAENLPVVEIVGSPTSKVQNDGKFVH decarboxylase; HTLADGDFKHFMKMHEPVTAARTLLTAENATYEIDRV Lactococcus LSQLLKERKPVYINLPVVAAAKAEKPALSLEKESSTT lactis NTTEQVILSKIEESLKNAQKPVVIAGHEVISFGLEKT WP_046124870.1) VTQFVSETKLPITTLNFGKSAVDESLPSFLGIYNGKL SEISLKNFVESADFILMLGVKLTDSSTGAFTHHLDEN KMISLNIDEGIIFNKVVEDFDFRAVVSSLSELKGIEY EGQYIKQYEEFIPSSAPLSQDRLWQAVESLTQSNETI VAEQGTSFFGASTIFLKSNSRFIGQPLWGSIGYTFPA ALGSQIADKESRHLLFIGDGSLQLTVQELGLSIREKL NPICFIINNDGYTVEREIHGPTQSYNDIPMWNYSKLP ETFGATEDRVVSKIVRTENEFVSVMKEAQADVNRMYW IELVLEKEDAPKLLKKMGKLFAEQNK KDC MTDDGYTVGDYLLDRLAELGVTEVFGVPGDYQLEFLD 68 (Mycobacterium HVVAHPRITWVGGANELNAGYAADGYGRLRGMAALVT smegmatis TFGVGELSAANAIAGSYAEHVPVVHIVGAPSKDSQAA (strain RRIVHHTLGDGDFEHFLRMSREITCAQANLVPATATR ATCC700084/ EIDRVLSEVHEQKRPGYLLIATDVARFPTEPPTAPLP mc(2)155) RHSGGTSPRALSLFTEAATQLIGEHRLTVLADFLVHR WP_011730751.1) MGCVEALNKLLTADTVPHATLMWGKSLVDESSPNFLG IYAGAASEGSVREVIEDAPVLVTAGVLFTDMVSGFFS QRIDPARTIDIGVNQSVVAGQVFAPLDMAAALDALAS ILAERGIESPALPPAPAPQRPAAPPRDAVLTQEALWD RLAEALTPGNVVLADQGTSFYGLAGHRLASGVTFIGQ PLWASIGYTLPAALGAGLADRDRRTVLLIGDGAAQLT VQELGAFGREGLTPVVVVVNNNGYTVERAIHGVTARY NDITAWRWTELPAALGVPDALTFRCATYGELDDALTV AAETQDRMVFVEVMLERMDIPPLLGELAQSASAANAK
Example 1: Selection of Aldolase Enzymes for the Trans-2-Unsaturated Aldehyde and Delta-Lactone Pathways
[0492] The first operation in the trans-2-unsaturated aldehyde pathway and the delta-lactone pathway is the condensation of two aldehyde molecules by an aldolase enzyme. To identify the aldolase enzymes that may catalyze the aldehyde condensation reaction, a list of various aldolase homologues or putative aldolases was identified based on sequence similarity to E. coli deoxyribose-5-phosphate aldolase (DERA). These various aldolases are listed in TABLE 15.
TABLE-US-00017 TABLE 15 % Identity Name Organism PDB No. GI to BH1352 Aldolase Thermus 1J2W 45 thermophilus HB8 deoxyribose-5-phosphate Escherichia coli 1JCJ 16974931 35 aldolase (K201L mutant) deoxyribose-5-phosphate Escherichia coli 1KTN 28372821 36 aldolase Aldolase Aquifex aeolicus 1MZH 29726561 43 Aldolase Aeropyrum pernix 1N7K 29726561 37 deoxyribose-5-phosphate Pyrobaculum 1VCV 73535346 36 aldolase aerophilum deoxyribose-5-phosphate Plasmodium yoelii 2A4A 75766024 35 aldolase Hydrolase Streptomyces 3I78 297342939 39 griseus deoxyribose-5-phosphate Mycobacterium 3NDO 30101668 44 aldolase smegmatis deoxyribose-5-phosphate Mycobacterium 3NG3 299689368 46 aldolase avium 104 deoxyribose-5-phosphate Entamoeba 3NGJ 301016075 69 aldolase histolydca Putative deoxyribose-5- Coccidioides 3OA3 303325189 51 phosphate aldolase immitis deoxyribose-5-phosphate Thermotoga 3R12 329666268 55 aldolase maritima deoxyribose-5-phosphate Lactobacilus brevis 4XBK 946926237 53 aldolase deoxyribose-5-phosphate Lactobacilus brevis 4XBS 946926241 53 aldolase (E78K mutant) deoxyribose-5-phosphate Colwelia 5C2X 985483947 37 aldolase psychereythraea deoxyribose-5-phosphate Shewanella 5C6M 985483957 34 aldolase halifaxensis deoxyribose-5-phosphate Streptococcus suis 5DBT 1018192340 69 aldolase
Example 2: Selection of Aldolase Enzymes for the Gamma-Lactone Pathway
[0493] The first step in the gamma-lactone pathway is the condensation of an aldehyde and a pyruvate or pyruvic acid by an aldolase enzyme. To identify the aldolase enzymes that may catalyze the condensation reaction, a list of various aldolase homologues or putative aldolases was identified based on sequence similarity to E. coli pyruvate dependent aldolase Eda (listed in TABLE 16), E. coli 4-hydroxy-2-oxoheptanedioate aldolase HpcH (listed in TABLE 17), E. coli 4-hydroxy-2-oxovalerate aldolase MphE (listed in TABLE 18), and Paraburkholderia xenovorans LB400 4-hydroxy-2-oxovalerate aldolase Bphl (listed in TABLE 19).
TABLE-US-00018 TABLE 16 % Ident Name Organism PDB No. GI to Eda KDPG aldolase Escherichia coli 1FQ0 10835436 100 KDPG aldolase E. coil (K133Q/T161K 1FWR 10835451 99 mutant) KDPG aldolase Pseudomonas putida 1MXS 37926857 46 Putatve KDPG aldolase Haemophilus influenza 1VHC 40889919 37 KDPG aldolase Thermotoga maritima MSB8 1VLW 52696233 33 KDPG aldolase Thermotoga maritima 1WA3 60593837 33 KDPG aldolase E. coli 2C0A 75766436 99 KDPG aldolase E. coli (E45N mutant) 1WAU 88191724 99 KDGgal E. coli 2V81 157836718 25 Oxoglutarate Aldolase Thermus thermophilus HB8 2YW3 159795598 40 KDPG aldolasc Oleispira antarctica 3VCR 372467175 50 Keto-hydroxyglutarte- Vibrionales bacterium 4E38 380765206 40 aldolase SWAT-3 KDPG Aldolase Zymomonas mobilis 4BK9 635576158 54 Unknown protein E. coli 4QCC 723586857 26
TABLE-US-00019 TABLE 17 % Ident to Name Organism PDB No. GI HpcH Apo Class II Aldolase Escherichia coli C pdb|2V5J|A 158430996 100 Hpch Pyruvate Aldolase Escherichia coli ATCC pdb|4B5X|A 402550309 99 (HpaI), Mutant D42a 8739 Pyruvate Aldolase R70a Escherichia coli ATCC pdb|4B5W|A 402550303 99 Mutant, HpaI 8739 Pyruvate Aldolase, HpaI, Escherichia coli ATCC pdb|4B5S|A 402550295 10 8739 Class II Aldolase Escherichia coli K-12 pdb|2VWS|A 198443128 56 2-Dehydro-3-Deoxy- Escherichia coli pdb|1DXE|A 10120730 48 Galactarate Aldolase Hpch/hpal Burkholderia cenocepacia pdb|4MF4|A 538261383 42 Aldolase/citrate Lyase J2315 Family Protein HpchHPAI ALDOLASE Desulfitobacterium pdb|3QZ6|A 326328104 33 hafniense DCB-2 Citrate Synthase Sbng Staphylococcus aureus pdb|4TV5|A 700588452 28 subsp. aureus str. Newman Citrate Synthase Variant Staphylococcus aureus pdb|4TV6|A 700588453 27 Sbng E151q subsp. aureus str. Newman Macrophomate Synthase Macrophoma commelinae pdb|1IZC|A 29726304 25
TABLE-US-00020 TABLE 18 % Ident to Name Organism PDB No. GI MphE Bifunctional Aldolase- Pseudomonas sp. CF600 pdb|1NVM|A 33357505 83 Dehydrogenase Aldolase/aldehyde Thermomonospora curvata pdb|4LRS|A 538261320 53 Dehydrogenas DSM 43183 Aldolase-dehydrogenase Mycobacterium pdb|4JN6|A 491668629 52 tuberculosis Putative Aldolase Bacteroides vulgatus pdb|3DXI|A 197305157 25 (Bvu_2661) ATCC 8482 Truncated Alpha- Neisseria meningitidis pdb|3RMJ|A 380258925 26 isopropylmalate Synthase serogroup B 2-Isopropylmalate Cytophaga hutchinsonii pdb|3EEG|A 203282565 23 Synthase ATCC 33406 Isopropylmalate Synthase Leptospira biflexa serovar pdb|4OV4|A 673541345 22 Patoc strain Patoc 1 (Paris)
TABLE-US-00021 TABLE 19 % Ident to Name Organism PDB No. GI BphI Bifunctional Aldolase- Pseudomonas sp. CF600 pdb|1NVM|A 33357505 57 Dehydrogenase Aldolase-dehydrogenase Mycobacterium pdb|4JN6|A 491668629 51 tuberculosis The Bifunctional Enzyme Thermomonospora curvata pdb|4LRS|A 538261320 52 (aldolase/aldehyde DSM 43183 Dehydrogenase) 2-Isopropylmalate Cytophaga hutchinsonii pdb|3EEG|A 203282565 25 Synthase ATCC 33406 Putative 2- Listeria monocytogenes pdb|3EWB|X 218766747 27 Isopropylmalate Synthase serotype 4b str. F2365 Putative Aldolase Bacteroides vulgatus pdb|3DXI|A 197305157 40 (Bvu_2661) ATCC 8482 Homocitrate Synthase Thermus thermophilus pdb|2ZTJ|A 261278579 37 HB27 Oxaloacetate Vibrio cholerae pdb|2NX9|A 122921155 24 Decarboxylase Isopropylmalate Synthase Leptospira biflexa serovar pdb|4OV4|A 673541345 29 Patoc strain Patoc 1 (Paris) Carboxyl Transferase Rhizobium etli CFN 42 pdb|4JX6|A 508123917 35 Multifunctional Pyruvate Rhizobium etli CFN 42 pdb|2QF7|A 158430175 35 Carboxylase
Example 3: Strain for Producing Trans-2-Hexenal Using Aldolase-Based Pathway
[0494] Strain E. coli MG1655 ApflB AldhA AadhE AyqhD AeutG AadhP AyjgB::cmR containing pArdra002 plasmid expressing pyruvate decarboxylase from Zymomonas mobilis (PDC), deoxyribose-5-phosphate aldolase from Bacillus halodurans (BH1352), and aldo-keto reductase from Pseudomonas aeruginosa (PA1127) was examined for the production of trans-2-hexenal. The strain was prepared by deleting seven genes, pflB, IdhA, adhE, yqhD, eutG, adhP, and yjgB using the lambda red recombinase method described in Datsenko and Wanner (Datsenko et al., PNAS USA 97: 6640-6645 (2000)).
[0495] Seed Preparation:
[0496] Two seed cultures were prepared. The first seed culture was prepared by inoculating a glycerol stock in 5 mL medium and grown overnight. A second seed culture was prepared in 50 mL falcon tubes by inoculating 100 L of the first seed culture in 10 mL media and grown overnight. The cultures were used to inoculate the fermenter to an optical density at 600 nm (OD.sub.600) of approximately 0.2 (range from about 0.15 to about 0.25).
[0497] Growth Phase:
[0498] Cells were grown in a 2L fermenter with an agitation set to 1000 RPM and DO over 50% until an OD.sub.600 of approximately 18 was reached. Protein expression was then induced with 0.1 M IPTG (1.5 mL of 1 M stock). Protein expression was carried out for about 7 hours. At about 7 hours or when the glucose from the medium was completely consumed, additional glucose was fed to the cells.
[0499] Production Phase:
[0500] The production phase started after about 7 hours of protein expression by reducing the agitation to 500 RPM and by shutting down the air-flow. In addition to the 3.3 g/L glucose (10 mL of 50% glucose stock), 3 g/L of both acetaldehyde and butyraldehyde were added to the culture at the start and after 2 hours from the start of the production phase. Additional 3 g/L of both acetaldehyde and butyraldehyde were added to the culture after about 15 hours. The total production time was approximately 20 hours.
[0501] Sampling:
[0502] 1 mL samples were taken throughout and especially before and after addition of glucose.
[0503] Results:
[0504] 2.5 g/L of trans-2-hexenal was produced in about 20 hours. The progression of the trans-2-hexenal production during the production phase is shown in
Example 4: Theoretical Yield Calculation of Trans-2-Hexenal
[0505]
TABLE-US-00022 Mole amount Theoretical yield of trans-2-hexenal 1 mole of linolenic acid 1 mole of trans-2-hexenal 18 moles of carbon 1 mole of trans-2-hexenal 1 mole of carbon 0.055 mole of trans-2-hexenal
[0506] The theoretical yield of trans-2-hexenal according to the present disclosure is about twice as much as the theoretical yield of natural trans-2-hexenal. According to the present disclosure:
(1) 0.5 mole of glucose=1 mole of acetaldehyde
(2) 1 mole of glucose=1 mole of butyraldehyde
(3) 1 mole of acetaldehyde+1 mole of butyraldehyde=1 mole of trans-2-hexenal
[0507] Thus, the theoretical yield of trans-2-hexenal according to the present disclosure can be determined as follow:
TABLE-US-00023 Mole amount Theoretical yield of trans-2-hexenal 1.5 moles of glucose 1 mole of trans-2-hexenal 9 moles of carbon 1 mole of trans-2-hexenal 1 mole of carbon 0.11 mole of trans-2-hexenal
Example 5: Theoretical Yield Calculation of Delta-Decalactone
[0508] The theoretical yield of delta decalactone according to the present disclosure:
(1) 1 mole of glucose=2 moles of acetaldehyde
(2) 2.5 moles of glucose=1 mole of hexanal
(3) 2 moles of acetaldehyde+1 mole of hexanal=1 mole of delta-decalactone
[0509] Thus, the theoretical yield of delta-decalactone according to the present disclosure can be determined as follow:
TABLE-US-00024 Mole amount Theoretical yield of delta-decalactone 3.5 moles of glucose 1 mole of delta-decalactone 21 moles of carbon 1 mole of delta-decalactone 1 mole of carbon 0.048 mole of delta-decalactone
Example 6: Theoretical Yield Calculation of Gamma-Decalactone
[0510] The theoretical yield of gamma-decalactone according to the present disclosure:
(1) 1 mole of glucose=2 moles of pyruvate
(2) 3 moles of glucose=1 mole of heptanal
(3) 1 mole of pyruvate+1 mole of heptanal=1 mole of gamma-decalactone
[0511] Thus, the theoretical yield of gamma-decalactone according to the present disclosure can be determined as follow:
TABLE-US-00025 Mole amount Theoretical yield of gamma-decalactone 3.5 moles of glucose 1 mole of gamma-decalactone 21 moles of carbon 1 mole of gamma-decalactone 1 mole of carbon 0.048 mole of gamma-decalactone
Example 7: Construction of Pyruvate-Accumulating Strain
[0512] As pyruvate is the first metabolite in the trans-2-unsaturated aldehydes, delta-lactones, and gamma-lactones pathways, increasing production requires a host organism that can accumulate pyruvate. The latter represents a key metabolite in the central carbon metabolism of most common microorganisms. In E. coli, pyruvate is the main precursor to several native fermentative by-products. To produce high titres of pyruvate in E. coli, pathways draining pyruvate to fermentative products were deleted. Seven genes, adhE (encoding alcohol dehydrogenase), ldhA (encoding lactate dehydrogenase), pflB (encoding pyruvate formate lyase), yqhD (encoding NADP-dependent alcohol dehydrogenase), eutG (encoding alcohol dehydrogenase), adhP (encoding alcohol dehydrogenase), and yjgB (encoding ZN-dependent alcohol dehydrogenase) were deleted from E. coli. The gene deletions were sequentially transferred from the corresponding single gene deletion mutants from KEIO collection to the wild type strain using P1 transduction method. The gene deletions were confirmed using PCR using at least the primers provided in the sequences: F-adhE-check (ggtcaactaa tccttaactg atcg) and R-adhEcheck (aagcaaatca tcaccgcact gac), F-ldhA-check (caggcttagc gcaacaaacg) and R-ldhA-check (ggttgcgcct acactaagc), F-pflBcheck (tccacttaag aaggtaggtg ttac) and R-pflA-check (aaagttgccg ctttacgggg aaa). The resultant strain with seven gene deletions was designated as LMSE-40C.