Azepane inhibitors of menin-MLL interaction
11530226 · 2022-12-20
Assignee
Inventors
- Patrick Rene Angibaud (Saint Pierre d'Autils, FR)
- Vineet Pande (Vosselaar, BE)
- Barbara Herkert (Flonheim, DE)
- Daniel Jason Krosky (Blue Bell, PA)
- Olivier Alexis Georges Querolle (Saint Vigor, FR)
- Aaron Nathaniel Patrick (Doylestown, PA)
- Isabelle Noelle Constance Pilatte (Louviers, FR)
Cpc classification
International classification
A61K31/519
HUMAN NECESSITIES
A61K31/55
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention relates to pharmaceutical agents useful for therapy and/or prophylaxis in a mammal, and in particular to azepane compounds, pharmaceutical composition comprising such compounds, and their use as menin/MLL protein/protein interaction inhibitors, useful for treating diseases such as cancer, myelodysplastic syndrome (MDS) and diabetes. ##STR00001##
Claims
1. A method of treating a cancer selected from leukemia or a solid tumor cancer comprising administering to a subject in need thereof, a therapeutically effective amount of a compound of Formula (I) ##STR00158## or a tautomer or a stereoisomeric form thereof, or a pharmaceutical composition comprising the compound of Formula (I), or a tautomer or a stereoisomeric form thereof; wherein R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3; Y.sup.1 is selected from the group consisting of hydrogen; C.sub.1-6 alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom optionally substituted with a C.sub.1-4alkyl or cyclopropyl substituent; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of fluoro, -CN, phenyl, -OR.sup.1Y, and NR.sup.2Y, R.sup.2YY; wherein R.sup.1Y is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and -C(═O)NR.sup.1YR.sup.2Y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.3y and -NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2Y and R.sup.2YY are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a -C(═O)NR.sup.1yR.sup.2y substituent; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.3Y and -NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen; OH; NH.sub.2; -C(═O)NR.sup.1yR.sup.2y; C.sub.1-6 alkyl; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.3Y, and -NR.sup.4YR.sup.4YY; with the proviso that when Y.sup.2 and Y.sup.3 are both substituents at the same carbon atom, and one of Y.sup.2 or Y.sup.3 is OH or NH.sub.2, then the other Y.sup.2 or Y.sup.3 is H, C.sub.1-6 alkyl, C.sub.1-4 alkyl substituted with a substituent selected from the group consisting of fluoro and -CN, or C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sub.3Y and NR.sup.4YR.sup.4YY; wherein R.sup.3Yis selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and -C(═O)NR.sup.4yR.sup.5y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.6y and—NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.4Y and R.sup.4YY are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and -C(═O)NR.sup.4yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.6y and -NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.1y, R.sup.2y, R.sup.3y, R.sup.4y, R.sup.5y and R.sup.6y are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and -L-R.sup.3 is selected from (a), (b), (c), (d), (e), or (f): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl and cyclopropyl; with the proviso that when R.sup.1A is hydrogen, then Y.sup.1 is not hydrogen; or (b) L is selected from the group consisting of -O-, -O-CR.sup.1BR.sup.1BB-, -N(R.sup.B)-, -N(R.sup.B)-CR.sup.1BR.sup.1BB, and -(NR.sup.B)-CHR.sup.1B-CHR.sup.2B-; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, C.sub.1-4 alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; -C(═O)NR.sup.3BR.sup.3BB; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and -CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4B and -NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2B is selected from the group consisting of hydrogen; -OR.sup.6B; -NR.sup.7BR.sup.7BB; -C(═O)NR.sup.8BR.sup.8BB; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.4B, and -NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.3B, R.sup.3BB, R.sup.4B, R.sup.5BB, R.sup.5BB, R.sup.6B, R.sup.7B, R.sup.7BB, R.sup.8B and R.sup.8BB are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and C(═O)NR.sup.9BR.sup.9BB; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.10B and -NR.sup.11BR.sup.11BB; wherein R.sup.9B, R.sup.9BB, R.sup.10B, R.sup.11Band R.sup.11BBare each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.1C-CO.sub.2R.sup.2C; -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC; -N(R.sup.C)-COR.sup.5C; -N(R.sup.C)-SO.sub.2NR.sup.6CR.sup.6CC; wherein R.sup.C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1c and -NR.sup.2cR.sup.2cc; R.sup.1C and R.sup.3C are each selected from the group consisting of hydrogen; -C(═O)NR.sup.3cR.sup.3cc; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and -CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4c and -NR.sup.5cR.sup.5cc and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen, and C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of NR.sup.6cR.sup.6cc, Ar, and Het.sup.1; R.sup.2C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; R.sup.5C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with -NR.sup.2cR.sup.2cc Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.1c, R.sup.2c, R.sup.2cc, R.sup.3c, R.sup.3cc, R.sup.4c, R.sup.5c, and R.sup.5cc are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.6c and R.sup.6cc are each independently selected from the group consisting of hydrogen, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of -NHC.sub.1-4 alkyl and cyclopropyl; and R.sup.4CC and R.sup.6CCare each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or (d) L is selected from -N(R.sup.D)-CR.sup.1DR.sup.1DD- and-N(R.sup.D)-CR.sup.1DR.sup.1DD-CR.sup.2DR.sup.2DD-; wherein R.sup.D is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro and -CN; and C.sub.2-4alkyl substituted with a substituent selected from -OR.sup.1d and NR.sup.2dR.sup.2dd; wherein R.sup.1d, R.sup.2d and R.sup.2dd are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1D, R.sup.1DD, R.sup.2D and R.sup.2DD are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.3 is selected from the group consisting of ##STR00159## wherein R.sup.3D, R.sup.4D, and R.sup.5D are each independently selected from the group consisting of C.sub.1-6 alkyl optionally substituted with a -OH, -OC.sub.1-6 alkyl, or a -NH.sub.2 substituent; or (e) -L-R.sup.3 is ##STR00160## wherein R.sup.E is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and C.sub.1-4alkyl; and R.sup.2E is selected from the group consisting of fluoro, -OC.sub.1-4 alkyl, and C.sub.1-4alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl or a C-linked 4- to 6-membered heterocyclyl containing an oxygen atom; and R.sup.3E is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a fluoro or a -CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4E and -NR.sup.5ER.sup.5EE; wherein R.sup.4E, R.sup.5E and R.sup.5EE are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, and -C(═O)NR.sup.6ER.sup.6EE; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.7E and NR.sup.8ER.sup.8EE; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.6E, R.sup.6EE, R.sup.7E, R.sup.8E and R.sup.8EE are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (f) -L-R.sup.3 is a radical selected from the group consisting of ##STR00161## wherein R.sup.1F is selected from the group consisting of hydrogen, C.sub.1-4alkyl and C.sub.2-4alkyl-NR.sup.fR.sup.ff; and R.sup.2F and R.sup.3F are each independently selected from hydrogen and C.sub.1-4alkyl; wherein R.sup.f and R.sup.ff are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and wherein Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5, C(═O)NR.sup.5R.sup.5′, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6, -NR.sup.7R.sup.7′ and -C(═O)NR.sup.8R.sup.8′; Het.sup.1is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, 4- or 5-thiazolyl, isothiazolyl, and isoxazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5′, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6, NR.sup.7R.sup.7′, and -C(═O)NR.sup.8R.sup.8′; and Het.sup.2is a non-aromatic heterocyclyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5′, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6-NR.sup.7R.sup.7′ and -C(═O)NR.sup.8R.sup.8′; wherein R.sup.4, R.sup.5, R.sup.5′, R.sup.6, R.sup.7, R.sup.7′, R.sup.8 and R.sup.8′ are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro and -C(═O)NR.sup.9R.sup.9′; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.10 and -NR.sup.11R.sup.11′; wherein R.sup.9, R.sup.9′, R.sup.10, R.sup.11 and R.sup.11′ are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; or a pharmaceutically acceptable salt or a solvate thereof; wherein the solid tumor cancer is selected from prostate cancer, lung cancer, breast cancer, pancreatic cancer, colon cancer, liver cancer, melanoma or glioblastoma; and wherein the leukemia is selected from acute leukemias, chronic leukemias, myeloid leukemias, myelogeneous leukemias, lymphoblastic leukemias, lymphocytic leukemias, Acute myelogeneous leukemias (AML), Chronic myelogenous leukemias (CML), Acute lymphoblastic leukemias (ALL), Chronic lymphocytic leukemias (CLL), T cell prolymphocytic leukemias (T-PLL), Large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemias, MLL-PTD leukemias, MLL amplified leukemias, MLL-positive leukemias, and leukemias exhibiting HOX/MEISI gene expression signatures.
2. The method according to claim 1, wherein R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3; Y.sup.1 is selected from the group consisting of hydrogen; C.sub.1-4alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom optionally substituted with a C.sub.1-4alkyl or cyclopropyl substituent; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of fluoro, -CN, phenyl, -OR.sup.1Y, and -NR.sup.2YR.sup.2YY; wherein R.sup.1Y, R.sup.2Y and R.sup.2Y are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and C.sub.1-6 alkyl; and -L-R.sup.3 is selected from (a), (b), (c), (e), or (f): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl and cyclopropyl; or (b) L is selected from the group consisting of -N(R.sup.B)-, -N(R.sup.B)-CR.sup.1BR.sup.1BB, and (NR.sup.B)-CHR.sup.1B-CHR.sup.2B-; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, C.sub.1-4 alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4B and -NR.sup.5BR.sup.5BB; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen or oxygen atom; R.sup.2B is selected from the group consisting of hydrogen; and C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, OR.sup.4B and -NR.sup.5BR.sup.5BB wherein R.sup.4B, R.sup.5B and R.sup.5BB are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.1C)-CHR.sup.1C-CO.sub.2R.sup.2C; -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC; -N(R.sup.C)-COR.sup.5C; -N(R.sup.C)-SO.sub.2-NR.sup.6CR.sup.6CC; wherein R.sup.C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1c and -NR.sup.2cR.sup.2cc; R.sup.1C and R.sup.3C are each selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4c and -NR.sup.5cR.sup.5cc, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen, and C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of NR.sup.6cR.sup.6cc Ar, and Het.sup.1; R.sup.2C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; and Het.sup.2; R.sup.5C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with -NR2 .sup.CR.sup.1CC Ar or Het.sup.1, Ar Het.sup.1, and Het.sup.2, wherein R.sup.1c, R.sup.2c, R.sup.2cc, R.sup.4c, R.sup.5c, and R.sup.5cc are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of -NHC.sub.1-4 alkyl and cyclopropyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; and Het.sup.2; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or (e) --L-R.sup.3 is ##STR00162## wherein R.sup.E is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and C.sub.1-4 alkyl; and R.sup.2E is selected from the group consisting of fluoro, -OC.sub.1-4 alkyl, and C.sub.1-4 alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl or a C-linked 4- to 6-membered heterocyclyl containing an oxygen atom; and R.sup.3E is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a fluoro or a -CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4E and -NR.sup.5ER.sup.5EE; wherein R.sup.4E, R.sup.5E and R.sup.5EE are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, and -C(═O)NR.sup.6ER.sup.6EE; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.7E and NR.sup.8ER.sup.8EE; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.6E, R.sup.6EE, R.sup.7E, R.sup.8E and R.sup.8EE are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (f) -L-R.sup.3 is a radical selected from the group consisting of ##STR00163## wherein R.sup.1F is selected from the group consisting of hydrogen, C.sub.1-4alkyl and C.sub.2-4alkyl-NR.sup.fR.sup.ff; and R.sup.2F and R.sup.3F are each independently selected from hydrogen and C.sub.1-4alkyl; wherein Rand R.sup.fare each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and wherein Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5′, C(═O)NR.sup.5R.sup.5′ and C.sub.1-4alkyl; Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, imidazolyl, and 4- or 5-thiazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo and C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6, NR.sup.7R.sup.7′, and -C(═O)NR.sup.8R.sup.8′; and Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5′, and C.sub.1-4alkyl; wherein R.sup.4, R.sup.5, R.sup.5′, R.sup.6, R.sup.7, R.sup.7′, R.sup.8 and R.sup.8′ are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl.
3. The method according to claim 1, wherein R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3; Y.sup.1 is selected from the group consisting of hydrogen; C.sub.1-6 alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen atom optionally substituted with a C.sub.1-4 alkyl or cyclopropyl substituent; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of phenyl, -OR.sup.1Y, and -NR.sup.2YR.sup.2YY; wherein R.sup.1Y, R.sup.2Yand R.sup.2YY are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; Y.sup.2 and Y.sup.3 are hydrogen; and -L-R.sup.3 is selected from (a), (b), (c), (e), or (f): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and -NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl and cyclopropyl; or (b) L is selected from the group consisting of -N(R.sup.B)-, -N(R.sup.B)-CR.sup.1BR.sup.1BB, and (NR.sup.B)-CHR.sup.1B-CHR.sup.2B-; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, C.sub.1-4 alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a phenyl or a Het.sup.1 substituent; and C2.4alkyl substituted with a substituent selected from the group consisting of -OH and -NH.sub.2; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; and R.sup.2B is hydrogen; or (c)-L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC, N(R.sup.C)-COR.sup.5C; -N(R.sup.C)-SO.sub.2NR.sup.6CR.sup.6CC; wherein R.sup.C is selected from the group consisting of hydrogen; and C.sub.1-4alkyl optionally substituted with a phenyl substituent; R.sup.3C is hydrogen or C.sub.1-4 alkyl; R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.5C is C.sub.1-4alkyl optionally substituted with -NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or (e) -L-R.sup.3 is ##STR00164## wherein R.sup.E is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and C.sub.1-4 alkyl; and R.sup.2E is selected from the group consisting of fluoro, -OC.sub.1-4 alkyl, and C.sub.1-4 alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (f) -L-R.sup.3 is a radical selected from the group consisting of ##STR00165## wherein R.sup.1F is hydrogen or C.sub.1-4alkyl and wherein Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -C(═O)NR.sup.5R.sup.5′, and C.sub.1-4alkyl; wherein R.sup.5 and R.sup.5′ are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo and C.sub.1-4 alkyl; and Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo and C.sub.1-4 alkyl.
4. The method according to claim 1, wherein R.sup.1 is CF.sup.3; R.sup.2 is hydrogen; Y.sup.1 is selected from the group consisting of hydrogen; C.sub.1-6 alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen atom optionally substituted with a Ci-4alkyl substituent; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of phenyl, -OH and -OC.sub.1-4 alkyl; Y.sup.2 and Y.sup.3 are hydrogen; and -L-R.sup.3 is selected from (a), (b), (c), (e), or (f): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, C.sub.1-4 alkyl and cyclopropyl; or (b) L is selected from the group consisting of -N(R.sup.B)- and -N(R.sup.B)-CR.sup.1BR.sup.1BB; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a phenyl or a -CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1B is selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a phenyl or a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a -OH substituent; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4 N(R.sup.C)-COR.sup.5C; and -N(R.sup.C)-SO.sub.2-NR.sup.6CR.sup.6CC; wherein R.sup.C is selected from the group consisting of hydrogen; and C.sub.1-4 alkyl optionally substituted with a phenyl substituent; R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.5C is C.sub.1-4 alkyl optionally substituted with -NR.sup.2cR.sup.2cc wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (e) -L-R.sup.3 is ##STR00166## wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected C.sub.1-4 alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5-cycloalkyl; and R.sup.3E is hydrogen; or (f) -L-R.sup.3 is ##STR00167## and wherein Ar is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of halo, -C(═O)NR.sup.5R.sup.5′, and C.sub.1-4 alkyl; wherein R.sup.5 and R.sup.5′ are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; Het.sup.1is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one or two substituents each independently selected from the group consisting of halo and C.sub.1-4 alkyl; and Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with a C.sub.1-4alkyl substituent.
5. The method according to claim 1, wherein R.sup.1 is CF.sub.3; R.sup.2 is hydrogen; Y.sup.1, Y.sup.2 and Y.sup.3 are hydrogen; and -L-R.sup.3 is selected from (a), (b), (c), (e), or (f): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl and cyclopropyl; or (b) L is -N(R.sup.B)-CR.sup.1BR.sup.1BB- and R.sup.3 is selected from the group consisting of Ar and Het.sup.1; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a phenyl or a -CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a Het.sup.1 substituent; and C.sub.2-4 alkyl substituted with a -OH substituent; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC; N(R.sup.C)-COR.sup.5C; and -N(R.sup.C)-SO.sub.2-NR.sup.6CR.sup.6CC; wherein R.sup.C is selected from the group consisting of hydrogen; and C.sub.1-4alkyl optionally substituted with a phenyl substituent; R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.5C is C.sub.1-4alkyl optionally substituted with -NR.sup.2cR.sup.2cc wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (e) -L-R is ##STR00168## wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected C.sub.1-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen; or (f) -L-R 3 is ##STR00169## and wherein Ar is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of halo, -C(═O)NR.sup.5R.sup.5′, and C.sub.1-4alkyl; wherein R.sup.5 and R.sup.5′ are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl; and Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one or two substituents each independently selected from the group consisting of halo and C.sub.1-4alkyl.
6. The method according to claim 1, wherein R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3; Y.sup.1 is selected from the group consisting of hydrogen; C.sub.1-6 alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom optionally substituted with a C.sub.1-4 alkyl or cyclopropyl substituent; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of fluoro, -CN, phenyl, -OR.sup.1Y, and -NR.sup.2YR.sup.2YY; wherein R.sup.1Y is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and C(═O)NR.sup.1yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.3y and -NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2Y and R.sup.2YY are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a -C(═O)NR.sup.1yR.sup.2y substituent; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.3Y and -NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen; OH; NH.sub.2; -C(═O)NR.sup.1yR.sup.2y; C.sub.1-6 alkyl; and C.sub.1-4 alkyl substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.3Y, and -NR.sup.4YR.sup.4YY; with the proviso that when Y.sup.2 and Y.sup.3 are both substituents at the same carbon atom, and one of Y.sup.2 or Y.sup.3 is OH or NH.sub.2, then the other Y.sup.3 or Y.sup.2is H, C.sub.1-6 alkyl, C.sub.1-4 alkyl substituted with a substituent selected from the group consisting of fluoro and -CN, or C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.3Y and NR.sup.4YR.sup.4YY; wherein R.sup.3Yis selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and C(═O)NR.sup.4yR.sup.5y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.6y and -NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.4Y and R.sup.4YY are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and -C(═O)NR.sup.1yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.6y and -NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.1y, R.sup.2y, R.sup.3y, R.sup.4y, R.sup.5s and R.sup.6y are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and -L-R.sub.3 is selected from (a), (b), (c), (d), or (e): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and -NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl and cyclopropyl; with the proviso that when RIA is hydrogen, then Y.sup.1 is not hydrogen; or (b) L is selected from the group consisting of -N(R.sup.B)-, -N(R.sup.B)-C.sup.1BR.sup.1BB, and -(NR.sup.B)-CHR.sup.1B-CHR.sup.2BB-; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; Het.sup.2; and a 7-to 10-membered saturated spirocarbobicyclic system; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, C.sub.1-4 alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; -C(═O)NR.sup.3BR.sup.3BB; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and -CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4B and -NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2B is selected from the group consisting of hydrogen; -OR.sup.6B; -NR.sup.7BR.sup.7BB; -C(═O)NR.sup.8BR.sup.8BB; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.4B, and -NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.3B, R.sup.3BB, R.sup.4B, R.sup.5B, R.sup.5BB, R.sup.6B, R.sup.7B, R.sup.7BB, R.sup.8B and R.sup.8BB are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN and -C(═O) NR.sup.9BR.sup.9BB; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.10B and -NR.sup.1BR.sup.1BB wherein R.sup.9B, R.sup.9BB, R.sup.10B, R.sup.llB and R.sup.1BB are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.1C-CO.sub.2R.sup.2C; -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC; -N(R.sup.C)-COR.sup.5C; -N(R.sup.C)-SO.sub.2-NR.sup.6CR.sup.6CC; wherein R.sup.C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and -CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1c and -NR.sup.2cR.sup.2cc; R.sup.1C and R.sup.3C are each selected from the group consisting of hydrogen; -C(═O)NR.sup.3cR.sup.3cc C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and -CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4c and -NR.sup.5cR.sup.5cc and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen, and C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of NR.sup.6cR.sup.6ccAr, and Het.sup.1; R.sup.2C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; R.sup.5C is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with -NR.sup.2cR.sup.2cc Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.1c, R.sup.2c, R.sup.2cc, R.sup.3c, R.sup.3cc, R.sup.4c, R.sup.5cand R.sup.5cc are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.6c and R.sup.6cc are each independently selected from the group consisting of hydrogen, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of -NHC.sub.1-4 alkyl and cyclopropyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or (d) L is selected from -N(R.sup.D)-CR.sup.1DR.sup.1DD- and -N(R.sup.DCR.sup.1DR.sup.1DD-CR.sup.2DR.sup.2DD-; wherein R.sup.D is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro and -CN; and C.sub.2-4alkyl substituted with a substituent selected from -OR.sup.1dand NR.sup.2dR.sup.2dd; wherein R.sup.1d, R.sup.2d and R.sup.2dd are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1D, R.sup.1DD, R.sup.2D and R.sup.2DD are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.3 is selected from the group consisting of ##STR00170## and; wherein R.sup.3D, R.sup.4D, and R.sup.5D are each independently selected from the group consisting of C.sub.1-6 alkyl optionally substituted with a -OH, -OC.sub.1-6 alkyl, or a -NH.sub.2 substituent; or (e) -L-R.sup.3 is ##STR00171## wherein R.sup.E is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and C.sub.1-4alkyl; and R.sup.2E is selected from the group consisting of fluoro, -OC.sub.1-4 alkyl, and C.sub.1-4alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl or a C-linked 4- to 6-membered heterocyclyl containing an oxygen atom; and R.sup.3E is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a fluoro or a -CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.4E and -NR.sup.5ER.sup.5EE; wherein R.sup.4E, R.sup.5E and R.sup.5EE are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, and -C(═O)NR.sup.6ER.sup.6EE; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.7E and -NR.sup.8R.sup.8EE; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.6E, R.sup.6EE, R.sup.7E, R.sup.8E and R.sup.8EE are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and wherein Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5c, -C(═O)NR.sup.5R.sup.5, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6-NR.sup.7R.sup.7′, and -C(═O)NR.sup.8R.sup.8′; Het.sup.1is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, 4- or 5-thiazolyl, isothiazolyl, and isoxazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5′, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6, -NR.sup.7R.sup.7′, and -C(═O)NR.sup.8R.sup.8′; and Het.sup.2is a non-aromatic heterocyclyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -CN, -OR.sup.4, -NR.sup.5R.sup.5′, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro, -CN, -OR.sup.6, -NR.sup.7R.sup.7′, and -C(═O)NR.sup.8R.sup.8′, wherein R.sup.4, R.sup.5, R.sup.5′, R.sup.6, R.sup.7, R.sup.7′, R.sup.8 and R.sup.8′ are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of fluoro and -C(═O)NR.sup.9R.sup.9′ and C.sub.2-4 alkyl substituted with a substituent selected from the group consisting of -OR.sup.10 and -NR.sup.11R.sup.11; wherein R.sup.9, R.sup.9′, R.sup.10, R.sup.11 and R.sup.11′ are each independently selected from the group consisting of hydrogen; C.sub.1-4 alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom.
7. The method according to claim 1, wherein R.sup.1 is CF.sub.3 R.sup.2 is hydrogen; Y.sup.1 is hydrogen; Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and C.sub.1-6 alkyl; -L-R.sup.3 is selected from (a), (b), (c), (e), or (f): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and -NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (b) L is selected from the group consisting of -O-, -O-CR.sup.1BR.sup.1BB, -N(R.sup.B)-, and -N(R.sup.B)-CR.sup.1BR.sup.1BB-; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a phenyl; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, and Ci-4alkyl; R.sup.1B is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.1BB is hydrogen; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC; and -N(R.sup.C)-COR.sup.5C; wherein R.sup.C is hydrogen; R.sup.3C is C.sub.1-4alkyl; R.sup.4C is hydrogen; R.sup.5C is Het.sup.2 and R.sup.4CC is C.sub.1-4 alkyl; or (e) -L-R.sup.3 is ##STR00172## wherein R.sup.E is hydrogen; R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen; or (f) -L-R.sup.3 is a radical selected from the group consisting of ##STR00173## and wherein Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -OR.sup.4, -C(═O)NR.sup.5R.sup.5′, and C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of -OR.sup.6, and -NR.sup.7R.sup.7′ Het.sup.1is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyridazinyl, and pyrazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from C.sub.1-4alkyl optionally substituted with a -OR.sup.6 substituent; and Het.sup.2 is a non-aromatic heterocyclyl optionally substituted with one, two, or three C.sub.1-4alkyl substituents; wherein R.sup.4, R.sup.5, R.sup.5′, R.sup.6, R.sup.7, and R.sup.7′ are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl.
8. The method according to claim 6, wherein R.sup.1 is CF.sub.3; R.sup.2 is hydrogen; Y.sup.1 is hydrogen; Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and C.sub.1-6 alkyl; -L-R.sup.3 is selected from (a), (b), (c), or (e): (a) -L-R.sup.3 is -NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of C.sub.1-6 alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of -OR.sup.1a and -NR.sup.2aR.sup.2aa wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl; or (b) L is selected from the group consisting of -N(R.sup.B)-, and -N(R.sup.B)-CR.sup.1BR.sup.1BB; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a phenyl; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of -OR.sup.1b and -NR.sup.2bR.sup.1bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, and C.sub.1-4 alkyl; R.sup.1B is selected from the group consisting of hydrogen and C 1-4alkyl; and R.sup.1BB is hydrogen; or (c) -L-R.sup.3 is selected from the group consisting of -N(R.sup.C)-CHR.sup.3C-CONR.sup.4CR.sup.4CC; and -N(R.sup.C)-COR.sup.5C; wherein R.sup.C is hydrogen; R.sup.3C is C.sub.1-4alkyl; R.sup.4C is hydrogen; R.sup.5C is Het.sup.2; and R.sup.4CC is C.sub.1-4 alkyl; or (e) -L-R.sup.3 is ##STR00174## wherein R.sup.E is hydrogen; R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen; and wherein Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, -OR.sup.4, -C(═O)NR.sup.5R.sup.5′, and C.sub.1-4 alkyl optionally substituted with a substituent selected from the group consisting of -OR.sup.6, and -NR.sup.7R.sup.7′, Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyridazinyl, and pyrazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from C.sub.1-4alkyl optionally substituted with a -OR.sup.6 substituent; and Het.sup.2 is a non-aromatic heterocyclyl optionally substituted with one, two, or three C.sub.1-4 alkyl substituents; wherein R.sup.4, R.sup.5, R.sup.5′, R.sup.6, R.sup.7, and R.sup.7′ are each independently selected from the group consisting of hydrogen and C.sub.1-4 alkyl.
Description
DESCRIPTION OF THE INVENTION
(1) The present invention concerns novel compounds of Formula (I),
(2) ##STR00002## and the tautomers and the stereoisomeric forms thereof, wherein R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3; R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3; Y.sup.1 is selected from the group consisting of hydrogen; Ci_6alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom optionally substituted with a Ci-4alkyl or cyclopropyl substituent; and Ci-4alkyl substituted with a substituent selected from the group consisting of fluoro, —CN, phenyl, —OR.sup.1Y, and —NR.sup.2YR.sup.2YY; wherein R.sup.1Y is selected from the group consisting of hydrogen; C.sub.1-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.1yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.3y and —NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2Y and R.sup.2YY are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a —C(=0)NR.sup.1yR.sup.2y substituent; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.3y and —NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom;
(3) Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen; OH; NH.sub.2; —C(=0)NR.sup.1yR.sup.2y; Ci-.sub.6alkyl; and Ci-4alkyl substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.3Y, and —NR.sup.4YR.sup.4YY; with the proviso that when Y.sup.2 and Y.sup.3 are both substituents at the same carbon atom, and one of Y.sup.2 or Y.sup.3 is OH or NH.sub.2, then the other Y.sup.3 or Y.sup.2 is H, Ci-4alkyl, Ci-4alkyl substituted with a substituent selected from the group consisting of fluoro and —CN, or C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.3Y and —NR.sup.4YR.sup.4YY; wherein R.sup.3Y is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.4yR.sup.5y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.6y and —NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.4Y and R.sup.4YY are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.1yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.6y and —NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.1y, R.sup.2y, R.sup.3y, R.sup.4y, R.sup.5y and R.sup.6y are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and
(4) -L-R.sup.3 is selected from (a), (b), (c), (d), (e), or (f)
(5) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; with the proviso that when R.sup.1A is hydrogen, then Y.sup.1 is not hydrogen; or
(6) (b) L is selected from the group consisting of -0-, -0-CR.sup.1BR.sup.1BB—, —N(R.sup.B)—, —N(R.sup.B)—CR.sup.1BR.sup.1BB—, and —(NR.sup.B)—CHR.sup.1B—CHR.sup.2B—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; —C(=0)NR.sup.3BR.sup.3BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4B and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2B is selected from the group consisting of hydrogen; OR.sup.6B; NR.sup.7BR.sup.7BB; —C(=0)NR.sup.8BR.sup.8BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.4B, and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.3B, R.sup.3BB, R.sup.4B, R.sup.5B, R.sup.5BB, R.sup.6B, R.sup.7B, R.sup.7BB, R.sup.8B and R.sup.8BB are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.9BR.sup.9BB; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.10B and —NR.sup.11BR.sup.11BB; wherein R.sup.9B, R.sup.9BB, R.sup.10B, R.sup.11B and R.sup.11BB are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; or
(7) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.C)—CHR.sup.1C—C0.sub.2R.sup.2C; N(R.sup.c) CHR.sup.3C—CONR.sup.4CR.sup.4CC; N(R.sup.c)—COR.sup.5C; —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein
(8) R.sup.c is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1c and —NR.sup.2cR.sup.2cc;
(9) R.sup.1C and R.sup.3C are each selected from the group consisting of hydrogen; —C(=0)NR.sup.3cR.sup.3cc; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4c and —NR.sup.5cR.sup.5cc; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom;
(10) R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of NR.sup.6cR.sup.6cc, Ar, and Het.sup.1;
(11) R.sup.2C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system;
(12) R.sup.5C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with —NR.sup.2cR.sup.2cc, Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.1c, R.sup.2c, R.sup.2cc, R.sup.3c, R.sup.3cc, R.sup.4c, R.sup.5c and R.sup.5cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.6c and R.sup.6cc are each independently selected from the group consisting of hydrogen, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of —NHCi_4alkyl and cyclopropyl; and
(13) R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or
(14) (d) L is selected from —N(R.sup.D)—CR.sup.1DR.sup.1DD— and —N(R.sup.D)—CR.sup.1DR.sup.1DD—CR.sup.2DR.sup.2DD—; wherein R.sup.D is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro and —CN; and C.sub.2-4alkyl substituted with a substituent selected from —OR.sup.1d and —NR.sup.2dR.sup.2dd; wherein R.sup.1d, R.sup.2d and R.sup.2dd are each independently selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1D, R.sup.1DD, R.sup.2D and R.sup.2DD are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and
(15) R.sup.3 is selected from the group consisting of
(16) ##STR00003##
wherein R.sup.3D, R.sup.4D, and R.sup.5D are each independently selected from the group consisting of Ci-.sub.6alkyl optionally substituted with a —OH, —OCi_6alkyl, or a —NH.sub.2 substituent; or
(17) (e) -L-R.sup.3 is
(18) ##STR00004##
wherein R.sup.E is selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and Ci-4alkyl; and R.sup.2E is selected from the group consisting of fluoro, —OCi-4alkyl, and Ci-4alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C 3-.sub.5cycloalkyl or a C-linked 4- to 6-membered heterocyclyl containing an oxygen atom; and R.sup.3E is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a fluoro or a —CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4E and —NR.sup.5ER.sup.5EE; wherein R.sup.4E, R.sup.5E and R.sup.5EE are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, and —C(=0)NR.sup.6ER.sup.6EE; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.7E and —NR.sup.8ER.sup.8EE; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.6E, R.sup.6EE, R.sup.7E, R.sup.8E and R.sup.8EE are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or
(19) (f) -L-R.sup.3 is a radical selected from the group consisting of
(20) ##STR00005##
(21) wherein R.sup.1F is selected from the group consisting of hydrogen, Ci-4alkyl and —C.sub.2-4alkyl-NR.sup.fR.sup.ff; and R.sup.2F and R.sup.3F are each independently selected from hydrogen and Ci_4alkyl; wherein R.sup.f and R.sup.ff are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(22) and wherein
(23) Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, —C(=0)NR.sup.5R.sup.5′, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6, —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′;
(24) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, 4- or 5-thiazolyl, isothiazolyl, and isoxazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6,
(25) —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′; and
(26) Het.sup.2 is a non-aromatic heterocyclyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6, —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′;
(27) wherein R.sup.4, R.sup.5, R.sup.5, R.sup.6, R.sup.7, R.sup.7′, R.sup.8 and R.sup.8′ are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro and —C(=0)NR.sup.9R.sup.9′; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.10 and —NR.sup.11R.sup.11′; wherein R.sup.9, R.sup.9, R.sup.10, R.sup.11 and R.sup.n are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom;
(28) and the pharmaceutically acceptable salts and the solvates thereof.
(29) The present invention also relates to a pharmaceutical composition comprising a therapeutically effective amount of a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, and a pharmaceutically acceptable carrier or excipient.
(30) Additionally, the invention relates to a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, for use as a medicament, and to a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, for use in the treatment or in the prevention of cancer, myelodysplastic syndrome (MDS) and diabetes.
(31) In a particular embodiment, the invention relates to a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, for use in the treatment or in the prevention of cancer.
(32) In a specific embodiment said cancer is selected from leukemias, myeloma or a solid tumor cancer (e.g. prostate cancer, lung cancer, breast cancer, pancreatic cancer, colon cancer, liver cancer, melanoma and glioblastoma, etc.). In some embodiments, the leukemias include acute leukemias, chronic leukemias, myeloid leukemias, myelogeneous leukemias, lymphoblastic leukemias, lymphocytic leukemias, Acute myelogeneous leukemias (AML), Chronic myelogenous leukemias (CML), Acute lymphoblastic leukemias (ALL), Chronic lymphocytic leukemias (CLL), T cell prolymphocytic leukemias (T-PLL), Large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemias, MLL-PTD leukemias, MLL amplified leukemias, MLL-positive leukemias, leukemias exhibiting HOXIMEIS1 gene expression signatures etc.
(33) The invention also relates to the use of a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, in combination with an additional pharmaceutical agent for use in the treatment or prevention of cancer, myelodysplastic syndrome (MDS) and diabetes.
(34) Furthermore, the invention relates to a process for preparing a pharmaceutical composition according to the invention, characterized in that a pharmaceutically acceptable carrier is intimately mixed with a therapeutically effective amount of a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof.
(35) The invention also relates to a product comprising a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, and an additional pharmaceutical agent, as a combined preparation for simultaneous, separate or sequential use in the treatment or prevention of cancer, myelodysplastic syndrome (MDS) and diabetes.
(36) Additionally, the invention relates to a method of treating or preventing a cell proliferative disease in a warm-blooded animal which comprises administering to the said animal an effective amount of a compound of Formula (I), a pharmaceutically acceptable salt, or a solvate thereof, as defined herein, or a pharmaceutical composition or combination as defined herein.
DETAILED DESCRIPTION OF THE INVENTION
(37) The term ‘halo’ or ‘halogen’ as used herein represents fluoro, chloro, bromo and iodo. The prefix ‘C.sub.x-y’ (where x and y are integers) as used herein refers to the number of carbon atoms in a given group. Thus, a C.sub.1-6alkyl group contains from 1 to 6 carbon atoms, and so on.
(38) The term ‘C.sub.1-4alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 4 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, /7-butyl, .v-butyl, /-butyl and the like.
(39) The term ‘C.sub.2-4alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 2 to 4 carbon atoms, such as ethyl, /7-propyl, isopropyl, «-butyi, .v-butyl, /′-butyl and the like. The term “Cu.alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 6 carbon atoms such as the groups defined for Ci.sub.4 alkyl and /7-pentyl, n-hexyl, 2-methylbutyl and the like.
(40) The term ‘C2-.alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 2 to 6 carbon atoms such as the groups defined for C.sub.2-4 alkyl and /7-pentyl, n-hexyl, 2-methylbutyl and the like.
(41) It will be clear for the skilled person that S(=0).sub.2, (S0.sub.2) or S0.sub.2 represents a sulfonyl moiety.
(42) It will be clear for the skilled person that CO or C(=0) represents a carbonyl moiety.
(43) As used herein “spiro bicyclic’ systems are cyclic systems wherein two cycles are joined at a single atom. Examples of 7- to 10-membered saturated spirocarbobicyclic systems include, but are not limited to
(44) ##STR00006##
(45) and the like.
(46) In general, whenever the term ‘substituted’ is used in the present invention, it is meant, unless otherwise indicated or clear from the context, to indicate that one or more hydrogens, in particular from 1 to 4 hydrogens, more in particular from 1 to 3 hydrogens, preferably 1 or 2 hydrogens, more preferably 1 hydrogen, on the atom or radical indicated in the expression using “substituted’ are replaced with a selection from the indicated group, provided that the normal valency is not exceeded, and that the substitution results in a chemically stable compound, i.e. a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture.
(47) Combinations of substituents and/or variables are permissible only if such combinations result in chemically stable compounds. ‘Stable compound’ is meant to indicate a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture.
(48) The skilled person will understand that when an atom or radical is substituted with “a substituent’, it is meant that the atom or radical referred to is substituted with one substituent selected from the indicated group.
(49) The skilled person will understand that the term ‘optionally substituted’ means that the atom or radical indicated in the expression using Optionally substituted may or may not be substituted (this means substituted or unsubstituted respectively).
(50) It will be clear for the skilled person that when e.g. L is —N(R.sup.B)—CR.sup.1BR.sup.1BB— in option (b) of Ł—R.sup.3, this means that the nitrogen atom substituted with R.sup.B is attached to the azepane ring. This is similar for other definitions of L such as for example -0-CR.sup.1BR.sup.1BB— (oxygen attached to azepane ring), —(NR.sup.B)—CHR.sup.1B—CHR.sup.2B— (nitrogen atom substituted with R.sup.B attached to the azepane ring), —N(R.sup.D)—CR.sup.1DR.sup.1DD— (nitrogen atom substituted with R.sup.D attached to the azepane ring), —N(R.sup.D)—CR.sup.1DR.sup.1DD—CR.sup.2DR.sup.2DD—(nitrogen atom substituted with R.sup.D attached to the azepane ring), or other similar definitions of L in the scope.
(51) When two or more substituents are present on a moiety they may, where possible and unless otherwise indicated or clear from the context, replace hydrogens on the same atom or they may replace hydrogen atoms on different atoms in the moiety.
(52) It will be clear for the skilled person that, unless otherwise is indicated or is clear from the context, a substituent on a heterocyclyl group may replace any hydrogen atom on a ring carbon atom or on a ring heteroatom (e.g. a hydrogen on a nitrogen atom may be replaced by a substituent).
(53) Within the context of this invention ‘saturated’ means ‘fully saturated’, if not otherwise specified.
(54) A ‘non-aromatic group’ embraces unsaturated ring systems without aromatic character, partially saturated and fully saturated carbocyclic and heterocyclic ring systems. The term ‘partially saturated’ refers to rings wherein the ring structure(s) contain(s) at least one multiple bond e.g. a C═C, N═C bond. The term ‘fully saturated’ refers to rings where there are no multiple bonds between ring atoms. Thus, a ‘non-aromatic heterocyclyl’ is a non-aromatic monocyclic or bicyclic system, unless otherwise specified, having for example, 3 to 12 ring members, more usually 5 to 10 ring members. Examples of monocyclic groups are groups containing 4 to 7 ring members, more usually, 5 or 6 ring members. Examples of bicyclic groups are those containing 8 to 12, more usually 9 or ring members.
(55) Non-limiting examples of monocyclic heterocyclyl systems containing at least one heteroatom selected from nitrogen, oxygen or sulfur (N, O, S) include, but are not limited to 4- to 7-membered heterocyclyl systems such as azetidinyl, oxetanyl, pyrrolidinyl, tetrahydrofuranyl, piperidinyl, piperazinyl, pyranyl, dihydropyranyl, tetrahydropyranyl, morpholinyl, thiomorpholinyl, and tetrahydro-2H-thiopyranyl 1,1-dioxide, in particular azetidinyl, oxetanyl, pyrrolidinyl, tetrahydrofuranyl, piperidinyl, piperazinyl, pyranyl, dihydropyranyl, tetrahydropyranyl, morpholinyl, and thiomorpholinyl. Non-limiting examples of bicyclic heterocyclyl systems containing at least one heteroatom selected from nitrogen, oxygen or sulfur (N, O, S) include, but are not limited to octahydro-1H-indolyl, indolinyl,
(56) ##STR00007##
Unless otherwise specified, each can be bound to the remainder of the molecule of Formula (I) through any available ring carbon atom (C-linked) or nitrogen atom (N-linked), and may optionally be substituted, where possible, on carbon and/or nitrogen atoms according to the embodiments.
(57) The term ‘C-linked 4- to 7-membered heterocyclyl containing at least one nitrogen, oxygen or sulphur atom’ as used herein alone or as part of another group, defines a saturated, cyclic hydrocarbon radical containing at least one nitrogen, oxygen or sulphur atom having from 4 to 7 ring members, as defined above, bound through an available carbon atom. It will be clear that similar the term ‘C-linked 4- to 6-membered heterocyclyl containing an oxygen atom’ as used herein alone or as part of another group, defines a saturated, cyclic hydrocarbon radical containing one oxygen atom having from 4 to 6 ring members, as defined above, bound through an available carbon atom (such as for example oxetanyl, tetrahydrofuranyl, and tetrahydropyranyl).
(58) Whenever substituents are represented by chemical structure, ‘-’ represents the bond of attachment to the remainder of the molecule of Formula (I).
(59) Lines (such as ‘-’) drawn into ring systems indicate that the bond may be attached to any of the suitable ring atoms.
(60) Met′ and Het.sup.2 may be attached to the remainder of the molecule of Formula (I) through any available ring carbon or nitrogen atom as appropriate, if not otherwise specified.
(61) It will be clear that a saturated cyclic moiety may, where possible, have substituents on both carbon and nitrogen atoms, unless otherwise is indicated or is clear from the context.
(62) When any variable occurs more than one time in any constituent, each definition is independent.
(63) When any variable occurs more than one time in any formula (e.g. Formula (I)), each definition is independent.
(64) The term “subject” as used herein, refers to an animal, preferably a mammal (e.g. cat, dog, primate or human), more preferably a human, who is or has been the object of treatment, observation or experiment.
(65) The term “therapeutically effective amount” as used herein, means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medicinal doctor or other clinician, which includes alleviation or reversal of the symptoms of the disease or disorder being treated.
(66) The term “composition” is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
(67) The term “treatment”, as used herein, is intended to refer to all processes wherein there may be a slowing, interrupting, arresting or stopping of the progression of a disease, but does not necessarily indicate a total elimination of all symptoms.
(68) The term “compound(s) of the (present) invent ion” or “compound(s) according to the (present) invention” as used herein, is meant to include the compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof.
(69) As used herein, any chemical formula with bonds shown only as solid lines and not as solid wedged or hashed wedged bonds, or otherwise indicated as having a particular configuration (e.g. R, S) around one or more atoms, contemplates each possible stereoisomer, or mixture of two or more stereoisomers.
(70) Hereinbefore and hereinafter, the term “compound(s ) of Formula (I)” is meant to include the tautomers thereof and the stereoisomeric forms thereof.
(71) The terms “stereoisomers”, “stereoisomeric forms” or “stereochemically isomeric forms” hereinbefore or hereinafter are used interchangeably.
(72) The invention includes all stereoisomers of the compounds of the invention either as a pure stereoisomer or as a mixture of two or more stereoisomers.
(73) Enantiomers are stereoisomers that are non-superimposable mirror images of each other. A 1:1 mixture of a pair of enantiomers is a racemate or racemic mixture.
(74) Atropisomers (or atropoisomers) are stereoisomers which have a particular spatial configuration, resulting from a restricted rotation about a single bond, due to large steric hindrance. All atropisomeric forms of the compounds of Formula (I) are intended to be included within the scope of the present invention.
(75) Diastereomers (or diastereoisomers) are stereoisomers that are not enantiomers, i.e. they are not related as mirror images. If a compound contains a double bond, the substituents may be in the E or the Z configuration.
(76) Substituents on bivalent cyclic saturated or partially saturated radicals may have either the cis- or trans-configuration; for example if a compound contains a disubstituted cycloalkyl group, the substituents may be in the cis or trans configuration.
(77) Therefore, the invention includes enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof, whenever chemically possible.
(78) The meaning of all those terms, i.e. enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof are known to the skilled person.
(79) The absolute configuration is specified according to the Cahn-Ingold-Prelog system. The configuration at an asymmetric atom is specified by either R or S. Resolved stereoisomers whose absolute configuration is not known can be designated by (+) or (−) depending on the direction in which they rotate plane polarized light. For instance, resolved enantiomers whose absolute configuration is not known can be designated by (+) or (−) depending on the direction in which they rotate plane polarized light.
(80) When a specific stereoisomer is identified, this means that said stereoisomer is substantially free, i.e. associated with less than 50%, preferably less than 20%, more preferably less than 10%, even more preferably less than 5%, in particular less than 2% and most preferably less than 1%, of the other stereoisomers. Thus, when a compound of Formula (1) is for instance specified as (/?), this means that the compound is substantially free of the (S) isomer; when a compound of Formula (I) is for instance specified as E, this means that the compound is substantially free of the Z isomer; when a compound of Formula (I) is for instance specified as cis, this means that the compound is substantially free of the trans isomer.
(81) Some of the compounds according to Formula (I) may also exist in their tautomeric form. Such forms in so far as they may exist, although not explicitly indicated in the above Formula (I) are intended to be included within the scope of the present invention. It follows that a single compound may exist in both stereoisomeric and tautomeric form.
(82) Pharmaceutically acceptable salts include acid addition salts and base addition salts. Such salts may be formed by conventional means, for example by reaction of a free acid or a free base form with one or more equivalents of an appropriate base or acid, optionally in a solvent, or in a medium in which the salt is insoluble, followed by removal of said solvent, or said medium, using standard techniques (e.g. in vacuo, by freeze-drying or by filtration). Salts may also be prepared by exchanging a counter-ion of a compound of the invention in the form of a salt with another counter-ion, for example using a suitable ion exchange resin.
(83) The pharmaceutically acceptable salts as mentioned hereinabove or hereinafter are meant to comprise the therapeutically active non-toxic acid and base salt forms which the compounds of Formula (I) and solvates thereof, are able to form.
(84) Appropriate acids comprise, for example, inorganic acids such as hydrohalic acids, e.g. hydrochloric or hydrobromic acid, sulfuric, nitric, phosphoric and the like acids; or organic acids such as, for example, acetic, propanoic, hydroxyacetic, lactic, pyruvic, oxalic (i.e. ethanedioic), ma Ionic, succinic (i.e. butanedioic acid), maleic, fumaric, malic, tartaric, citric, methanesulfonic, ethanesulfonic, benzenesulfonic, p-toluenesulfonic, cyclamic, salicylic, p-aminosalicylic, pamoic and the like acids. Conversely said salt forms can be converted by treatment with an appropriate base into the free base form.
(85) The compounds of Formula (I) and solvates thereof containing an acidic proton may also be converted into their non-toxic metal or amine salt forms by treatment with appropriate organic and inorganic bases.
(86) Appropriate base salt forms comprise, for example, the ammonium salts, the alkali and earth alkaline metal salts, e.g. the lithium, sodium, potassium, cesium, magnesium, calcium salts and the like, salts with organic bases, e.g. primary, secondary and tertiary aliphatic and aromatic amines such as methylamine, ethylamine, propylamine, isopropylamine, the four butylamine isomers, dimethylamine, diethylamine, diethanolamine, dipropylamine, diisopropylamine, di-n-butylamine, pyrrolidine, piperidine, morpholine, trimethylamine, triethylamine, tripropylamine, quinuclidine, pyridine, quinoline and isoquinoline; the benzathine, N-methyl-D-glucamine, hydrabamine salts, and salts with amino acids such as, for example, arginine, lysine and the like. Conversely the salt form can be converted by treatment with acid into the free acid form.
(87) The term solvate comprises the solvent addition forms as well as the salts thereof, which the compounds of Formula (!) are able to form. Examples of such solvent addition forms are e.g. hydrates, alcoholates and the like.
(88) The compounds of the invention as prepared in the processes described below may be synthesized in the form of mixtures of enantiomers, in particular racemic mixtures of enantiomers, that can be separated from one another following art-known resolution procedures. A manner of separating the enantiomeric forms of the compounds of Formula (I), and pharmaceutically acceptable salts, and solvates thereof, involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically. Preferably if a specific stereoisomer is desired, said compound would be synthesized by stereospecific methods of preparation. These methods will advantageously employ enantiomerically pure starting materials.
(89) The present invention also embraces isotopically-labeled compounds of the present invention which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature (or the most abundant one found in nature).
(90) All isotopes and isotopic mixtures of any particular atom or element as specified herein are contemplated within the scope of the compounds of the invention, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form. Exemplary isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine and iodine, such as .sup.2H, ¾, .sup.11C, .sup.13C, .sup.14C, .sup.13N, .sup.150, .sup.170, .sup.18O, .sup.32P, .sup.33P, .sup.35S, .sup.18F, .sup.36Ci, .sup.122I, .sup.123I, .sup.125I, .sup.1311, .sup.75Br, .sup.76Br, .sup.77Br and .sup.82Br. Preferably, the radioactive isotope is selected from the group of .sup.2H, .sup.3H, .sup.11C and .sup.18F. More preferably, the radioactive isotope is .sup.2H. In particular, deuterated compounds are intended to be included within the scope of the present invention.
(91) Certain isotopically-labeled compounds of the present invention (e.g., those labeled with .sup.3H and .sup.14C) may be useful for example in substrate tissue distribution assays. Tritiated (.sup.3H) and carbon-14 (.sup.14C) isotopes are useful for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e., .sup.2H may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances. Thus, in a particular embodiment of the present invention, R.sup.2 is selected from hydrogen or deuterium, in particular deuterium. Positron emitting isotopes such as .sup.150, .sup.13N, .sup.11C and .sup.18F are useful for positron emission tomography (PET) studies. PET imaging in cancer finds utility in helping locate and identify tumours, stage the disease and determine suitable treatment. Human cancer cells overexpress many receptors or proteins that are potential disease-specific molecular targets. Radiolabelled tracers that bind with high affinity and specificity to such receptors or proteins on tumour cells have great potential for diagnostic imaging and targeted radionuclide therapy (Charron, Carlie L. et al. Tetrahedron Fett. 2016, 57(37), 4 119-4127). Additionally, target-specific PET radiotracers may be used as biomarkers to examine and evaluate pathology, by for example, measuring target expression and treatment response (Austin R. et al. Cancer Letters (2016), doi: 10.1016/j.canlet.20 16.05.008).
(92) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(93) R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3;
(94) R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3;
(95) Y.sup.1 is selected from the group consisting of hydrogen; Ci-6alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom optionally substituted with a Ci-4alkyl or cyclopropyl substituent; and Ci-4alkyl substituted with a substituent selected from the group consisting of fluoro, —CN, phenyl, —OR.sup.1Y, and —NR.sup.2YR.sup.2YY; wherein R.sup.1Y, R.sup.2Y and R.sup.2YY are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(96) Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and Ci-.sub.6alkyl; and
(97) Ł—R.sup.3 is selected from (a), (b), (c), (e), or (f):
(98) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or
(99) (b) L is selected from the group consisting of —N(R.sup.B)—, —N(R.sup.B)—CR.sup.1BR.sup.1BB—, and —(NR.sup.B)—CHR.sup.1B—CHR.sup.2B—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and
(100) Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4B and —NR.sup.5BR.sup.5BB; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen or oxygen atom; R.sup.2B is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.4B, and —NR.sup.5BR.sup.5BB; wherein R.sup.4B, R.sup.5B and R.sup.5BB are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or
(101) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.C)—CHR.sup.1C—C0.sub.2R.sup.2C; —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; —N(R.sup.C)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein
(102) R.sup.c is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1c and —NR.sup.2cR.sup.2cc;
(103) R.sup.1C and R.sup.3C are each selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4c and —NR.sup.5cR.sup.5cc;
(104) R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of NR.sup.6cR.sup.6cc, Ar, and Het.sup.1;
(105) R.sup.2C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1 and Het.sup.2;
(106) R.sup.5C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with —NR.sup.2cR.sup.2cc, Ar or Het.sup.1; Ar; Het.sup.1; and Het.sup.2; wherein R.sup.1c, R.sup.2c, R.sup.2cc, R.sup.4c, R.sup.5c and R.sup.5cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.6C and R.sup.6cc are each independently selected from the group consisting of hydrogen, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of —NHCi_4alkyl and cyclopropyl; and
(107) R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen; Ci_4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; and Het.sup.2; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or
(108) (e) -L-R.sup.3 is
(109) ##STR00008##
wherein R.sup.E is selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and Ci-4alkyl; and R.sup.2E is selected from the group consisting of fluoro, —OCi-4alkyl, and Ci-4alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a c 3-.sub.5cycloalkyl or a C-linked 4- to 6-membered heterocyclyl containing an oxygen atom; and R.sup.3E is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a fluoro or a —CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4E and —NR.sup.5ER.sup.5EE; wherein R.sup.4E, R.sup.5E and R.sup.5EE are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, and —C(=0)NR.sup.6ER.sup.6EE; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.7E and —NR.sup.8ER.sup.8EE; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.6E, R.sup.6EE, R.sup.7E, R.sup.8E and R.sup.8EE are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or
(110) (f) -L-R.sup.3 is a radical selected from the group consisting of
(111) ##STR00009##
(112) wherein R.sup.1F is selected from the group consisting of hydrogen, Ci-4alkyl and —C.sub.2-4alkyl-NR.sup.fR.sup.ff; and R.sup.2F and R.sup.3F are each independently selected from hydrogen and Ci-4alkyl, in particular hydrogen; wherein R.sup.f and R.sup.ff are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(113) and wherein
(114) Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, —C(=0)NR.sup.5R.sup.5′, and Ci_.sub.4alkyl;
(115) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, imidazolyl, and 4- or 5-thiazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo and Ci_.sub.4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6,
(116) —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′; and
(117) Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, and C.sub.1-4alkyl;
(118) wherein R.sup.4, R.sup.5, R.sup.5, R.sup.6, R.sup.7, R.sup.7′, R.sup.8 and R.sup.8′ are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
(119) and the pharmaceutically acceptable salts and the solvates thereof.
(120) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(121) R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3;
(122) R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3;
(123) Y.sup.1 is selected from the group consisting of hydrogen; Ci-6alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom optionally substituted with a Ci_.sub.4alkyl or cyclopropyl substituent; and Ci_.sub.4alkyl substituted with a substituent selected from the group consisting of fluoro, —CN, phenyl, —OR.sup.1Y, and —NR.sup.2YR.sup.2YY; wherein R.sup.1Y is selected from the group consisting of hydrogen; Ci_.sub.4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.1yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.3y and —NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2Y and R.sup.2YY are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a —C(=0)NR.sup.1yR.sup.2y substituent; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.3y and —NR.sup.1yR.sup.2y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom;
(124) Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen; OH; NH.sub.2; —C(=0)NR.sup.1yR.sup.2y; Ci-ealkyl; and C.sub.1-4alkyl substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.3Y, and —NR.sup.4YR.sup.4YY; with the proviso that when Y.sup.2 and Y.sup.3 are both substituents at the same carbon atom, and one of Y.sup.2 or Y.sup.3 is OH or NH.sub.2, then the other Y.sup.3 or Y.sup.2 is H, Ci-ealkyl, C.sub.1-4alkyl substituted with a substituent selected from the group consisting of fluoro and —CN, or C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.3Y and —NR.sup.4YR.sup.4YY; wherein R.sup.3Y is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.4yR.sup.5y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.6y and —NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.4Y and R.sup.4YY are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.1yR.sup.2y; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.6y and —NR.sup.4yR.sup.5y; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.1y, R.sup.2y, R.sup.3y, R.sup.4y, R.sup.5y and R.sup.6y are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and
(125) Ł—R.sup.3 is selected from (a), (b), (c), (d), or (e):
(126) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; with the proviso that when R.sup.1A is hydrogen, then Y.sup.1 is not hydrogen; or
(127) (b) L is selected from the group consisting of —N(R.sup.B)—, —N(R.sup.B)—CR.sup.1BR.sup.1BB—, and —(NR.sup.B)—CHR.sup.1B—CHR.sup.2B—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; —C(=0)NR.sup.3BR.sup.3BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4B and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2B is selected from the group consisting of hydrogen; —OR.sup.6B; —NR.sup.7BR.sup.7BB; —C(=0)NR.sup.8BR.sup.8BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.4B, and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.3B, R.sup.3BB, R.sup.4B, R.sup.5B, R.sup.5BB, R.sup.6B, R.sup.7B, R.sup.7BB, R.sup.8B and R.sup.8BB are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.9BR.sup.9BB; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.10B and —NR.sup.11BR.sup.11BB; wherein R.sup.9B, R.sup.9BB, R.sup.10B, R.sup.11B and R.sup.11BB are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; or
(128) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.C)—CHR.sup.1C—C0.sub.2R.sup.2C; —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein
(129) R.sup.C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1c and —NR.sup.2cR.sup.2cc;
(130) R.sup.1C and R.sup.3C are each selected from the group consisting of hydrogen; —C(=0)NR.sup.3cR.sup.3cc; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4c and —NR.sup.5cR.sup.5cc; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom;
(131) R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of NR.sup.6cR.sup.6cc, Ar, and Het.sup.1;
(132) R.sup.2C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system;
(133) R.sup.5C is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with —NR.sup.2CR.sup.2cc, Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.1c, R.sup.2c, R.sup.2cc, R.sup.3c, R.sup.3cc, R.sup.4c, R.sup.5c and R.sup.5cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.6c and R.sup.6cc are each independently selected from the group consisting of hydrogen, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of —NHCi_4alkyl and cyclopropyl; and
(134) R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with Ar or Het.sup.1; Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or
(135) (d) L is selected from —N(R.sup.D)—CR.sup.1DR.sup.1DD— and —N(R.sup.D)—CR.sup.1DR.sup.1DD—CR.sup.2DR.sup.2DD—; wherein R.sup.D is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro and —CN; and C.sub.2-4alkyl substituted with a substituent selected from —OR.sup.1d and —NR.sup.2dR.sup.2dd; wherein R.sup.1d; R.sup.2d and R.sup.2dd are each independently selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1D, R.sup.1DD, R.sup.2D and R.sup.2DD are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and
(136) R.sup.3 is selected from the group consisting of
(137) ##STR00010##
wherein R.sup.3D, R.sup.4D, and R.sup.5D are each independently selected from the group consisting of Ci-.sub.6alkyl optionally substituted with a —OH, —OCi_6alkyl, or a —NH.sub.2 substituent; or
(138) (e) -L-R.sup.3 is
(139) ##STR00011##
wherein R.sup.E is selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and Ci-4alkyl; and R.sup.2E is selected from the group consisting of fluoro, —OCi-4alkyl, and Ci-4alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a c.sub.3-5cycloalkyl or a C-linked 4- to 6-membered heterocyclyl containing an oxygen atom; and R.sup.3E is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a fluoro or a —CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4E and —NR.sup.5ER.sup.5EE; wherein R.sup.4E, R.sup.5E and R.sup.5EE are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, and —C(=0)NR.sup.6ER.sup.6EE; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.7E and —NR.sup.8ER.sup.8EE; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.6E, R.sup.6EE, R.sup.7E, R.sup.8E and R.sup.8EE are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(140) and wherein
(141) Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, —C(=0)NR.sup.5R.sup.5′, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6, —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′;
(142) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, 4- or 5-thiazolyl, isothiazolyl, and isoxazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6, —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′; and
(143) Het.sup.2 is a non-aromatic heterocyclyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —CN, —OR.sup.4, —NR.sup.5R.sup.5′, and Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.6, —NR.sup.7R.sup.7′, and —C(=0)NR.sup.8R.sup.8′;
(144) wherein R.sup.4, R.sup.5, R.sup.5, R.sup.6, R.sup.7, R.sup.7′, R.sup.8 and R.sup.8′ are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro and —C(=0)NR.sup.9R.sup.9′; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.10 and —NR.sup.1′R.sup.11′; wherein R.sup.9, R.sup.9, R.sup.10, R.sup.11 and R.sup.n are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom;
(145) and the pharmaceutically acceptable salts and the solvates thereof.
(146) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(147) R.sup.1 is CF.sub.3;
(148) R.sup.2 is hydrogen;
(149) Y.sup.1 is hydrogen;
(150) Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and Ci-.sub.6alkyl;
(151) Ł—R.sup.3 is selected from (a), (b), (c), (e), or (f):
(152) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci_6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or
(153) (b) L is selected from the group consisting of —O—, -0-CR.sup.1BR.sup.1BB—, —N(R.sup.B)—, and —N(R.sup.B)—CR.sup.1BR.sup.1BB—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, and Ci-4alkyl; R.sup.1B is selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.1BB is hydrogen; or
(154) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; and
(155) —N(R.sup.c)—COR.sup.5C; wherein
(156) R.sup.c is hydrogen;
(157) R.sup.3C is Ci_.sub.4alkyl; R.sup.4C is hydrogen; R.sup.5C is Het.sup.2; and R.sup.4CC is Ci_.sub.4alkyl; or
(158) (e) -L-R.sup.3 is
(159) ##STR00012##
wherein R.sup.E is hydrogen; R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C3-.sub.5cycloalkyl; and R.sup.3E is hydrogen; or
(160) (f) -L-R.sup.3 is a radical selected from the group consisting of
(161) ##STR00013##
(162) and wherein
(163) Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —OR.sup.4, —C(=0)NR.sup.5R.sup.5′, and Ci_4alkyl optionally substituted with a substituent selected from the group consisting of —OR.sup.6, and —NR.sup.7R.sup.7′;
(164) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyridazinyl, and pyrazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from Ci-4alkyl optionally substituted with a —OR.sup.6 substituent; and
(165) Het.sup.2 is a non-aromatic heterocyclyl optionally substituted with one, two, or three Ci_4alkyl substituents;
(166) wherein R.sup.4, R.sup.5, R.sup.5, R.sup.6, R.sup.7, and R.sup.7′ are each independently selected from the group consisting of hydrogen and Ci_.sub.4alkyl;
(167) and the pharmaceutically acceptable salts and the solvates thereof.
(168) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(169) R.sup.1 is CF.sub.3;
(170) R.sup.2 is hydrogen;
(171) Y.sup.1 is hydrogen;
(172) Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and Ci-.sub.6alkyl;
(173) _L-R.sup.3 is selected from (a), (b), (c), (e), or (f):
(174) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci_6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen and Ci_.sub.4alkyl; or
(175) (b) L is selected from the group consisting of —N(R.sup.B)—, and —N(R.sup.B)—CR.sup.1BR.sup.1BB—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, and Ci-4alkyl; R.sup.1B is selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.1BB is hydrogen; or
(176) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.C)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; and —N(R.sup.c)—COR.sup.5C; wherein
(177) R.sup.c is hydrogen;
(178) R.sup.3C is Ci_.sub.4alkyl;
(179) R.sup.4C is hydrogen;
(180) R.sup.5C is Het.sup.2; and
(181) R.sup.4CC is Ci_.sub.4alkyl; or
(182) (e) -L-R.sup.3 is
(183) ##STR00014##
wherein R.sup.E is hydrogen; R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C3-.sub.5cycloalkyl; and R.sup.3E is hydrogen;
(184) and wherein
(185) Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —OR.sup.4, —C(=0)NR.sup.5R.sup.5′, and Ci_4alkyl optionally substituted with a substituent selected from the group consisting of —OR.sup.6, and —NR.sup.7R.sup.7′;
(186) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyridazinyl, and pyrazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from Ci-4alkyl optionally substituted with a —OR.sup.6 substituent; and
(187) Het.sup.2 is a non-aromatic heterocyclyl optionally substituted with one, two, or three Ci-4alkyl substituents;
(188) wherein R.sup.4, R.sup.5, R.sup.5, R.sup.6, R.sup.7, and R.sup.7′ are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(189) and the pharmaceutically acceptable salts and the solvates thereof.
(190) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(191) R.sup.1 is CF.sub.3;
(192) R.sup.2 is hydrogen;
(193) Y.sup.1 is hydrogen;
(194) Y.sup.2 and Y.sup.3 are hydrogen;
(195) ŁL-R.sup.3 is selected from (a) or (b):
(196) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is Ci_.sub.6alkyl; or
(197) (b) L is —N(R.sup.B)—CR.sup.1BR.sup.1BB—;
(198) and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is hydrogen; R.sup.1B is selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.1BB is hydrogen;
(199) and wherein
(200) Ar is phenyl optionally substituted with one Ci-4alkyl;
(201) Het.sup.1 is pyrazolyl; and
(202) Het.sup.2 is a non-aromatic heterocyclyl; in particular 3-azetidinyl;
(203) and the pharmaceutically acceptable salts and the solvates thereof.
(204) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(205) R.sup.1 is selected from the group consisting of CH.sub.3, CH.sub.2F, CHF.sub.2 and CF.sub.3;
(206) R.sup.2 is selected from the group consisting of hydrogen and CH.sub.3;
(207) Y.sup.1 is selected from the group consisting of hydrogen; Ci_6alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen atom optionally substituted with a Ci-4alkyl or cyclopropyl substituent; and Ci-4alkyl substituted with a substituent selected from the group consisting of phenyl, —OR.sup.1Y, and —NR.sup.2YR.sup.2YY;
(208) wherein R.sup.1Y, R.sup.2Y and R.sup.2YY are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(209) Y.sup.2 and Y.sup.3 are hydrogen; and
(210) ŁL-R.sup.3 is selected from (a), (b), (c), (e), or (f):
(211) (a) -L-R.sup.3 is-NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or
(212) (b) L is selected from the group consisting of —N(R.sup.B)—, —N(R.sup.B)—CR.sup.1BR.sup.1BB—, and —(NR.sup.B)—CHR.sup.1B—CHR.sup.2B—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl or a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OH and —NH.sub.2; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; and R.sup.2B is hydrogen; or
(213) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein
(214) R.sup.c is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a phenyl substituent;
(215) R.sup.3C is hydrogen or Ci-4alkyl;
(216) R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and Ci-4alkyl;
(217) R.sup.5C is Ci_4alkyl optionally substituted with —NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and
(218) R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or R.sup.4C and R.sup.4CC, or R.sup.6C and R.sup.6CC together with the nitrogen atom to which they are attached, form a N-linked Het.sup.2; or
(219) (e) _L-R.sup.3 is
(220) ##STR00015##
wherein R.sup.E is selected from the group consisting of hydrogen and C.sub.4alkyl; R.sup.1E is selected from the group consisting of hydrogen, fluoro and C.sub.4alkyl; and R.sup.2E is selected from the group consisting of fluoro, —OC.sub.1-4alkyl, and C.sub.4alkyl optionally substituted with 1, 2 or 3 fluoro substituents; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a c3-.sub.5cycloalkyl; and R.sup.3E is selected from the group consisting of hydrogen and C.sub.4alkyl; or
(221) (f) -L-R.sup.3 is a radical selected from the group consisting of
(222) ##STR00016##
(223) wherein R.sup.1F is hydrogen or alkyl;
(224) and wherein
(225) Ar is phenyl optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo, —C(=0)NR.sup.5R.sup.5′, and alkyl; wherein R.sup.5 and R.sup.5′ are each independently selected from the group consisting of hydrogen and C.sub.4-4alkyl;
(226) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo and Ci-4alkyl; and
(227) Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with one, two, or three substituents each independently selected from the group consisting of halo and Ci-4alkyl;
(228) and the pharmaceutically acceptable salts and the solvates thereof.
(229) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(230) R.sup.1 is CF.sub.3;
(231) R.sup.2 is hydrogen;
(232) Y.sup.1 is selected from the group consisting of hydrogen; Ci_6alkyl; C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen atom optionally substituted with a Ci-4alkyl substituent; and Ci-4alkyl substituted with a substituent selected from the group consisting of phenyl, —OH and —OCi-4alkyl;
(233) Y.sup.2 and Y.sup.3 are hydrogen; and
(234) ŁL-R.sup.3 is selected from (a), (b), (c), (e), or (f):
(235) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of hydrogen; Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or
(236) (b) L is selected from the group consisting of —N(R.sup.B)— and —N(R.sup.B)—CR.sup.1BR.sup.1BB—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl or a —CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl or a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a —OH substituent; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; or
(237) (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; and —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein
(238) R.sup.c is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a phenyl substituent;
(239) R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and Ci-4alkyl;
(240) R.sup.5C is Ci_4alkyl optionally substituted with —NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and
(241) R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or
(242) (e) -L-R.sup.3 is
(243) ##STR00017##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen; or
(244) (f) -L-R.sup.3 is
(245) ##STR00018##
(246) and wherein
(247) Ar is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of halo, —C(=0)NR.sup.5R.sup.5′, and Ci-4alkyl; wherein R.sup.5 and R.sup.5 are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(248) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one or two substituents each independently selected from the group consisting of halo and Ci-4alkyl; and
(249) Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with a Ci-4alkyl substituent; and the pharmaceutically acceptable salts and the solvates thereof.
(250) The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
(251) R.sup.1 is CF.sub.3;
(252) R.sup.2 is hydrogen;
(253) Y.sup.1, Y.sup.2 and Y.sup.3 are hydrogen; and
(254) -L-R.sup.3 is selected from (a), (b), (c), (e), or (f):
(255) (a) Ł—R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci_6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa; wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or
(256) (b) L is —N(R.sup.B)—CR.sup.1BR.sup.1BB— and R.sup.3 is selected from the group consisting of Ar and Het.sup.1; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl or a —CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a —OH substituent; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; or (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; and —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein
(257) R.sup.c is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a phenyl substituent;
(258) R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and Ci-4alkyl;
(259) R.sup.5C is Ci-4alkyl optionally substituted with —NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and
(260) R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or
(261) (e) -L-R.sup.3 is
(262) ##STR00019##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen; or
(263) (f) -L-R.sup.3 is
(264) ##STR00020##
(265) and wherein
(266) Ar is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of halo, —C(=0)NR.sup.5R.sup.5′, and Ci-4alkyl; wherein R.sup.5 and R.sup.5′ are each independently selected from the group consisting of hydrogen and Ci_4alkyl; and
(267) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one or two substituents each independently selected from the group consisting of halo and Ci-4alkyl; and the pharmaceutically acceptable salts and the solvates thereof.
(268) Another embodiment of the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments wherein
(269) R.sup.1 is CF.sub.3;
(270) R.sup.2 is hydrogen;
(271) Y.sup.1 is hydrogen;
(272) Y.sup.2 and Y.sup.3 are each independently selected from the group consisting of hydrogen and Ci-6alkyl.
(273) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
(274) -L-R.sup.3 is selected from (a), (b), (c), (d), or (e).
(275) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein -L-R.sup.3 is (a).
(276) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein _L-R.sup.3 is (b).
(277) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein -L-R.sup.3 is (c).
(278) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein -L-R.sup.3 is (d).
(279) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein -L-R.sup.3 is (e).
(280) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein -L-R.sup.3 is (f).
(281) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
(282) -L-R.sup.3 is selected from (a), (b), (c), (d), or (e); wherein (a), (c), (d) and (e) are defined according to any one of the other embodiments; and wherein (b) is defined as
(283) (b) L is selected from the group consisting of —N(R.sup.B)—, —N(R.sup.B)—CR.sup.1BR.sup.1BB—, and —(NR.sup.B)—CHR.sup.1B—CHR.sup.2B—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; —C(=0)NR.sup.3BR.sup.3BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4B and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2B is selected from the group consisting of hydrogen; —OR.sup.6B; —NR.sup.7BR.sup.7BB; —C(=0)NR.sup.8BR.sup.8BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.4B, and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.3B, R.sup.3BB, R.sup.4B, R.sup.5B, R.sup.5BB, R.sup.6B, R.sup.7B, R.sup.7BB, R.sup.8B and R.sup.8BB are each independently selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.9BR.sup.9BB; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.10B and —NR.sup.11BR.sup.11BB; wherein
(284) R.sup.9B, R.sup.9BB, R.sup.10B, R.sup.11B and R.sup.11BB are each independently selected from the group consisting of hydrogen; Ci-4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom.
(285) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
(286) ŁL-R.sup.3 is selected from (a), (b), (c), (d), or (e); and provided that L in option (b) is not —O— or -0-CR.sup.1BR.sup.1BB—.
(287) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
(288) -L-R.sup.3 is selected from (a), (b), (c), (d), (e) or (f); wherein (a), (c), (d) and (e) are defined according to any one of the other embodiments;
(289) wherein (b) is defined as
(290) (b) L is selected from the group consisting of —N(R.sup.B)—, —N(R.sup.B)—CR.sup.1BR.sup.1BB—, and —(NR.sup.8)—CHR.sup.1B—CHR.sup.2B—; and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; Het.sup.2; and a 7- to 10-membered saturated spirocarbobicyclic system; wherein R.sup.8 is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; R.sup.1B is selected from the group consisting of hydrogen; —C(=0)NR.sup.3BR.sup.3BB; Ci_4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl, Het.sup.1, and —CN; C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.4B and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and R.sup.1BB is selected from the group consisting of hydrogen and methyl; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form a C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; R.sup.2B is selected from the group consisting of hydrogen; —OR.sup.6B; —NR.sup.7BR.sup.7BB; —C(=0)NR.sup.8BR.sup.8BB; Ci_.sub.4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN, —OR.sup.4B, and —NR.sup.5BR.sup.5BB; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; wherein R.sup.3B, R.sup.3BB, R.sup.4B, R.sup.5B, R.sup.5BB, R.sup.6B, R.sup.7B, R.sup.7BB, R.sup.8B and R.sup.8BB are each independently selected from the group consisting of hydrogen; Ci_.sub.4alkyl optionally substituted with a substituent selected from the group consisting of fluoro, —CN and —C(=0)NR.sup.9BR.sup.9BB; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.10B and —NR.sup.11BR.sup.11BB; wherein
(291) R.sup.9B, R.sup.9BB, R.sup.10B, R.sup.11B and R.sup.11BB are each independently selected from the group consisting of hydrogen; Ci_.sub.4alkyl; and C-linked 4- to 7-membered non-aromatic heterocyclyl containing at least one nitrogen, oxygen or sulfur atom; and wherein (f) is defined as
(292) (f) -L-R.sup.3 is a radical selected from the group consisting of
(293) ##STR00021##
(294) In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
(295) -L-R.sup.3 is selected from (a), (b), (c), (d), (e) or (f); wherein (a), (b), (c), (d) and (e) are defined according to any one of the other embodiments;
(296) wherein (f) is defined as
(297) (f) -L-R.sup.3 is a radical selected from the group consisting of
(298) ##STR00022##
(299) Another embodiment of the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments wherein one or more of the following restrictions apply:
(300) (i) R.sup.1 is CF.sub.3;
(301) (ii) R.sup.2 is hydrogen;
(302) (iii) Y.sup.1 is hydrogen;
(303) (iv) Y.sup.2 and Y.sup.3 are hydrogen;
(304) (v) -L-R.sup.3 is selected from (a) or (b):
(305) (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is Ci-.sub.6alkyl; or
(306) (b) L is —N(R.sup.B)—CR.sup.1BR.sup.1BB—;
(307) and R.sup.3 is selected from the group consisting of Ar; Het.sup.1; and Het.sup.2;
(308) (vi) R.sup.B is hydrogen;
(309) (vii) R.sup.1B is selected from the group consisting of hydrogen and Ci-4alkyl; and
(310) (viii) R.sup.1BB is hydrogen;
(311) (ix) Ar is phenyl optionally substituted with one Ci-4alkyl;
(312) (x) Het.sup.1 is pyrazolyl;
(313) (xi) Het.sup.2 is a non-aromatic heterocyclyl; in particular 3-azetidinyl.
(314) Another embodiment of the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments wherein one or more of the following restrictions apply:
(315) (i) R.sup.1 is CF.sub.3;
(316) (ii) R.sup.2 is hydrogen;
(317) (iii) Y Y.sup.2 and Y.sup.3 are hydrogen;
(318) (iv) Ł—R.sup.3 is selected from (a), (b), (c) or (e): (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or (b) L is —N(R.sup.B)—CR.sup.1BR.sup.1BB— and R.sup.3 is selected from the group consisting of Ar and Het.sup.B wherein R.sup.B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a phenyl or a —CN substituent; and C.sub.2-4alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb; wherein R.sup.1b, R.sup.2b, and R.sup.2bb are each independently selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a —OH substituent; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; or (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; and —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein R.sup.c is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a phenyl substituent; R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.5C is Ci_.sub.4alkyl optionally substituted with —NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or (e) -L-R.sup.3 is
(319) ##STR00023##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C 3-.sub.5cycloalkyl; and R.sup.3E is hydrogen;
(320) (v) Ł—R.sup.3 is selected from (a), (b), (c) or (e): (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or (b) L is —NH—CR.sup.1BR.sup.1BB— and R.sup.3 is selected from the group consisting of Ar and Het.sup.1; wherein R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a —OH substituent; and R.sup.1BB is hydrogen; or R.sup.1B and R.sup.1BB together with the carbon to which they are attached form an oxetanyl ring; or (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; and —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein R.sup.c is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a phenyl substituent; R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.5C is Ci_4alkyl optionally substituted with —NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or (e) -L-R.sup.3 is
(321) ##STR00024##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen; (vi) -L-R.sup.3 is selected from (a), (b), (c) or (e):
(322) (a) Ł—R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or (b) L is —NH—CR.sup.1BR.sup.1BB— and R.sup.3 is selected from the group consisting of Ar and Het.sup.E wherein R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a —OH substituent; and R.sup.1BB is hydrogen; or (c) -L-R.sup.3 is selected from the group consisting of —N(R.sup.c)—CHR.sup.3C—CONR.sup.4CR.sup.4CC; —N(R.sup.c)—COR.sup.5C; and —N(R.sup.c)—S0.sub.2—NR.sup.6CR.sup.6CC; wherein R.sup.c is selected from the group consisting of hydrogen; and Ci-4alkyl optionally substituted with a phenyl substituent; R.sup.3C, R.sup.4C and R.sup.6C are each selected from the group consisting of hydrogen and Ci-4alkyl; R.sup.5C is Ci_4alkyl optionally substituted with —NR.sup.2cR.sup.2cc; wherein R.sup.2c and R.sup.2cc are each independently selected from the group consisting of hydrogen and Ci-4alkyl; and R.sup.4CC and R.sup.6CC are each independently selected from the group consisting of hydrogen and Ci-4alkyl; or (e) -L-R.sup.3 is
(323) ##STR00025##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C3-.sub.5cycloalkyl; and R.sup.3E is hydrogen;
(324) (vii) Ł—R.sup.3 is selected from (a), (b), or (e): (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or (b) L is —NH—CR.sup.1BR.sup.1BB— and R.sup.3 is selected from the group consisting of Ar and Het.sup.1; wherein R.sup.1B is selected from the group consisting of hydrogen; Ci-4alkyl optionally substituted with a Het.sup.1 substituent; and C.sub.2-4alkyl substituted with a —OH substituent; and R.sup.1BB is hydrogen; or (e) -L-R.sup.3 is
(325) ##STR00026##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a C.sub.3-5cycloalkyl; and R.sup.3E is hydrogen;
(326) (vii) -L-R.sup.3 is selected from (a), (b), or (e): (a) -L-R.sup.3 is —NHR.sup.1A, wherein R.sup.1A is selected from the group consisting of Ci-.sub.6alkyl optionally substituted with one, two or three fluoro substituents; and C.sub.2-6alkyl substituted with a substituent selected from the group consisting of —OR.sup.1a and —NR.sup.2aR.sup.2aa, wherein R.sup.1a, R.sup.2a and R.sup.2aa are each independently selected from the group consisting of hydrogen, Ci-4alkyl and cyclopropyl; or
(327) (b) L is —NH—CH.sub.2— and R.sup.3 is selected from the group consisting of Ar and Het.sup.1; or (e) -L-R.sup.3 is
(328) ##STR00027##
wherein R.sup.E is selected from the group consisting of hydrogen and methyl; R.sup.1E and R.sup.2E are each an independently selected Ci-4alkyl substituent; or R.sup.1E and R.sup.2E are bound to the same carbon atom and together form a c3-.sub.5cycloalkyl; and R.sup.3E is hydrogen;
(329) (viii) Ar is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of halo, —C(=0)NR.sup.5R.sup.5′, and Ci-4alkyl; wherein R.sup.5 and R.sup.5′ are each independently selected from the group consisting of hydrogen and Ci-4alkyl;
(330) (ix) Ar is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of halo and Ci-4alkyl;
(331) (x) Het.sup.1 is a monocyclic heteroaryl selected from the group consisting of pyridyl, 4-, 5- or 6-pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, and imidazolyl; each of which may be optionally substituted with one or two substituents each independently selected from the group consisting of halo and Ci-4alkyl;
(332) (xi) Het.sup.1 is pyrazolyl optionally substituted with a Ci-4alkyl substituent; (xii) Het.sup.2 is a non-aromatic heterocyclyl selected from azetidinyl, pyrrolidinyl and piperidinyl, each of which may be optionally substituted with a Ci-4alkyl substituent.
(333) All possible combinations of the above indicated embodiments are considered to be embraced within the scope of the invention.
(334) Particular compounds of Formula (I) are:
(335) ##STR00028##
(336) including the stereoisomeric forms, the pharmaceutically acceptable salts thereof, in particular the hydrochloride salts thereof, and the solvates thereof.
(337) Particular compounds of Formula (I) are:
(338) ##STR00029## ##STR00030##
(339) including the stereoisomeric forms, the pharmaceutically acceptable salts thereof, in particular the hydrochloride salts thereof, and the solvates thereof.
(340) Methods for the Preparation of Compounds of Formula (I)
(341) In this section, as in all other sections unless the context indicates otherwise, references to Formula (I) also include all other sub-groups and examples thereof as defined herein.
(342) The general preparation of some typical examples of the compounds of Formula (I) is described hereunder and in the specific examples, and are generally prepared from starting materials which are either commercially available or prepared by standard synthetic processes commonly used by those skilled in the art. The following schemes are only meant to represent examples of the invention and are in no way meant to be a limit of the invention.
(343) Alternatively, compounds of the present invention may also be prepared by analogous reaction protocols as described in the general schemes below, combined with standard synthetic processes commonly used by those skilled in the art of organic chemistry.
(344) The skilled person will realize that in the reactions described in the Schemes, although this is not always explicitly shown, it may be necessary to protect reactive functional groups (for example hydroxy, amino, or carboxy groups) where these are desired in the final product, to avoid their unwanted participation in the reactions. For example in Scheme 5, the NH moiety on the azepanyl ring can be protected with a tert-butoxycarbonyl protecting group. In general, conventional protecting groups can be used in accordance with standard practice. The protecting groups may be removed at a convenient subsequent stage using methods known from the art. This is illustrated in the specific examples.
(345) The skilled person will realize that in the reactions described in the Schemes, it may be advisable or necessary to perform the reaction under an inert atmosphere, such as for example under N.sub.2-gas atmosphere.
(346) It will be apparent for the skilled person that it may be necessary to cool the reaction mixture before reaction work-up (refers to the series of manipulations required to isolate and purify the product(s) of a chemical reaction such as for example quenching, column chromatography, extraction).
(347) The skilled person will realize that heating the reaction mixture under stirring may enhance the reaction outcome. In some reactions microwave heating may be used instead of conventional heating to shorten the overall reaction time.
(348) The skilled person will realize that another sequence of the chemical reactions shown in the Schemes below, may also result in the desired compound of Formula (I). The skilled person will realize that intermediates and final compounds shown in the Schemes below may be further functionalized according to methods well-known by the person skilled in the art. The intermediates and compounds described herein can be isolated in free form or as a salt.
(349) Scheme 1
(350) In general, compound of Formula (I) wherein all variables are defined according to the scope of the present invention, can be prepared according to the following reaction Scheme 1. In Scheme 1, LG is a leaving group, such as for example halo. All other variables in Scheme 1 are defined according to the scope of the present invention. In Scheme 1, the following reaction conditions apply:
(351) ##STR00031##
Scheme 2
(352) Alternatively, compounds of Formula (I), wherein all variables are defined according to the scope of the present invention, can be prepared according to the following reaction Scheme 2. In Scheme 2, Y.sup.1 is hydrogen in compounds of Formula (IV), (IV″) and (lb) and Y.sup.1a has the same meaning as Y.sup.1 defined in the scope of the invention except for hydrogen in compounds of Formula (VI), (VF) and (la), and all other variables are defined according to the scope of the invention.
(353) In Scheme 2, the following reaction conditions apply:
(354) ##STR00032##
Scheme 3
Alternatively, compounds of Formula (I), wherein all variables are defined according to the scope of the present invention, can be prepared according to the following reaction Scheme 3. In Scheme 3, Y.sup.1 is hydrogen in compound of Formula (Id), and Y.sup.1a has the same meaning as Y.sup.1 defined in the scope of the invention except for hydrogen in compound of Formula (Ic), -L-R.sup.3 is —N(R.sup.B)—R.sup.3, —N(R.sup.B)—CR.sup.1BR.sup.1BB—R.sup.3 or —N(R.sup.B)—CHR.sup.1B—CHR.sup.2B—R.sup.3 as defined in (b), or -L-R.sup.3 is as defined in (c) or (d), herein referred to as -NQ-L.sup.a-R.sup.3, and all other variables are defined according to the scope of the invention. It will be clear that Q represents R.sup.B, R.sup.c or R.sup.D respectively, and L.sup.a is the remainder of the L definition not including -NQ-.
(355) In Scheme 3, the following reaction conditions apply:
(356) ##STR00033##
Scheme 3B
(357) Alternatively, compounds of Formula (I), wherein
(358) L.sup.b is Ci-2alkyl optionally substituted with R.sup.2B;
(359) L.sup.b1 is Co_1alkyl optionally substituted with R.sup.2B;
(360) R.sup.3a is selected from Het.sup.2 or a -7 to 10-membered saturated spirocyclic system;
(361) R.sup.Ba is selected from the group consisting of hydrogen; Co-3alkyl optionally substituted with a substituent selected from the group consisting of fluoro, phenyl and —CN; and Ci_3alkyl substituted with a substituent selected from the group consisting of —OR.sup.1b and —NR.sup.2bR.sup.2bb;
(362) can be prepared according to scheme 3B.
(363) All other variables are defined according to the scope of the present invention. The skilled person will understand that in case R.sup.B is hydrogen, some reactions of Scheme 3B can be skipped.
(364) ##STR00034##
(365) Someone skilled in the art will realize that, in the preparation of compounds, the order of steps 1 and 2 can be inverted with step 3 and that, for example for the preparation of compounds (If), reagent ((XXIV) can be used prior to reagent (XXII).
(366) Scheme 4
(367) Intermediates of Formula (IV), can be prepared according to the following reaction Scheme 4, wherein
(368) ##STR00035##
represents a suitable protecting group, such as for example an acetal protecting group and all other variables are defined according to the scope of the present invention.
(369) In Scheme 4, the following reaction conditions apply:
(370) ##STR00036##
(371) Alternatively, intermediates of Formula (IX) that are protected or unprotected, may be commercially available.
(372) Scheme 4B
(373) Alternatively, further intermediates of Formula (IV) can be prepared according to the following reaction Scheme 4B.
(374) In Scheme 4B, the following reaction conditions apply:
(375) ##STR00037##
Scheme 4C
(376) Intermediates of Formula (XXI) can be prepared according to the following reaction Scheme 4b
(377) ##STR00038##
Scheme 5
(378) Intermediates of Formula (III) can be prepared according to the following reaction Scheme 5, wherein Y.sup.1 is hydrogen in compound of Formula (Illb), and Y.sup.1ahas the same meaning as Y.sup.1 defined in the scope of the invention except for hydrogen in compound of Formula (Ilia), -L-R.sup.3 is —N(R.sup.B)—R.sup.3, —N(R.sup.B)—CR.sup.1BR.sup.1BB—R.sup.3 or —N(R.sup.b)—CHR.sup.1B—CHR.sup.2B—R.sup.3 as defined in (b), or -L-R.sup.3 is as defined in (c) or (d), herein referred to as -NQ-L.sup.a-R.sup.3 or —NH-L.sup.a-R.sup.3, and all other variables are defined according to the scope of the invention.
(379) In Scheme 5, the following reaction conditions apply:
(380) ##STR00039##
(381) Alternatively, intermediates of Formula (III) may be commercially available.
(382) Scheme 5B
(383) Alternatively, further intermediates of Formula (III), herein referred to as (lllc) and (Hid) can be prepared according to the following reaction Scheme 5b. In Scheme 5b, Y.sup.1 is hydrogen in compounds of Formula (Hid), (XIX) and (XX) and Y.sup.1a has the same meaning as Y.sup.1 defined in the scope of the invention except for hydrogen in compounds of Formula (IIIc), (XV), (XVI) and (XVII), and all other variables are defined according to the scope of the invention.
(384) In Scheme 5b, the following reaction conditions apply:
(385) ##STR00040##
(386) Alternatively, intermediates of Formula (lllc) and (llld) may be commercially available.
(387) Scheme 6
(388) Intermediates of Formula (II), wherein R.sup.2 is methyl, can be prepared according to the following reaction Scheme 6, wherein L G represents a suitable leaving group, such as for example, halo or methanesulfonyl. All other variables in Scheme 6 are defined according to the scope of the present invention.
(389) In Scheme 6, the following reaction conditions apply:
(390) ##STR00041##
(391) Alternatively, intermediates of Formula (II) may be commercially available.
(392) It will be appreciated that where appropriate functional groups exist, compounds of various formulae or any intermediates used in their preparation may be further derivatised by one or more standard synthetic methods employing condensation, substitution, oxidation, reduction, or cleavage reactions. Particular substitution approaches include conventional alkylation, arylation, heteroarylation, acylation, sulfonylation, halogenation, nitration, formylation and coupling procedures.
(393) The compounds of Formula (I) may be synthesized in the form of racemic mixtures of enantiomers which can be separated from one another following art-known resolution procedures. The racemic compounds of Formula (I) containing a basic nitrogen atom may be converted into the corresponding diastereomeric salt forms by reaction with a suitable chiral acid. Said diastereomeric salt forms are subsequently separated, for example, by selective or fractional crystallization and the enantiomers are liberated therefrom by alkali. An alternative manner of separating the enantiomeric forms of the compounds of Formula (I) involves liquid chromatography using achiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically.
(394) In the preparation of compounds of the present invention, protection of remote functionality (e.g., primary or secondary amine) of intermediates may be necessary. The need for such protection will vary depending on the nature of the remote functionality and the conditions of the preparation methods. Suitable amino-protecting groups (NH-PG) include acetyl, trifluoroacetyl, t-butoxycarbonyl (Boc), benzyl oxycarbonyI (CBz) and 9-fluorenylmethyleneoxycarbonyl (Fmoc). The need for such protection is readily determined by one skilled in the art. For a general description of protecting groups and their use, see T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 4th ed., Wiley, Hoboken, N.J., 2007.
(395) Pharmacology
(396) It has been found that the compounds of the present invention block the interaction of menin with MLL proteins and oncogenic MLL fusion proteins. Therefore the compounds according to the present invention and the pharmaceutical compositions comprising such compounds may be useful for the treatment or prevention, in particular treatment, of diseases such as cancer, myelodysplasia syndrome (MDS) and diabetes.
(397) In particular, the compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of cancer. According to one embodiment, cancers that may benefit from a treatment with menin/MLL inhibitors of the invention comprise leukemias, myeloma or a solid tumor cancer (e.g. prostate cancer, lung cancer, breast cancer, pancreatic cancer, colon cancer, liver cancer, melanoma and glioblastoma, etc.). In some embodiments, the leukemias include acute leukemias, chronic leukemias, myeloid leukemias, myelogeneous leukemias, lymphoblastic leukemias, lymphocytic leukemias, Acute myelogeneous leukemias (AML), Chronic myelogenous leukemias (CML), Acute lymphoblastic leukemias (ALL), Chronic lymphocytic leukemias (CLL), T cell prolymphocyte leukemias (T-PLL), Large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemias, MLL-PTD leukemias, MLL amplified leukemias, MLL-positive leukemias, leukemias exhibiting HOXIMEISl gene expression signatures etc.
(398) Hence, the invention relates to compounds of Formula (I), the tautomers and the stereoisomers forms thereof, and the pharmaceutically acceptable salts, and the solvates thereof, for use as a medicament.
(399) The invention also relates to the use of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, or a pharmaceutical composition according to the invention, for the manufacture of a medicament.
(400) The present invention also relates to a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, or a pharmaceutical composition according to the invention, for use in the treatment, prevention, amelioration, control or reduction of the risk of disorders associated with the interaction of menin with MLL proteins and oncogenic MLL fusion proteins in a mammal, including a human, the treatment or prevention of which is affected or facilitated by blocking the interaction of menin with MLL proteins and oncogenic MLL fusion proteins.
(401) Also, the present invent ion relates to the use of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, or a pharmaceutical composition according to the invention, for the manufacture of a medicament for treating, preventing, ameliorating, controlling or reducing the risk of disorders associated with the interaction of menin with MLL proteins and oncogenic MLL fusion proteins in a mammal, including a human, the treatment or prevention of which is affected or facilitated by blocking the interaction of menin with MLL proteins and oncogenic MLL fusion proteins.
(402) The invention also relates to a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, for use in the treatment or prevention of any one of the diseases mentioned hereinbefore.
(403) The invention also relates to a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, for use in treating or preventing any one of the diseases mentioned hereinbefore.
(404) The invention also relates to the use of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof. for the manufacture of a medicament for the treatment or prevention of any one of the disease conditions mentioned hereinbefore.
(405) The compounds of the present invention can be administered to mammals, preferably humans, for the treatment or prevention of any one of the diseases mentioned hereinbefore.
(406) In view of the utility of the compounds of Formula (I), the tautomers and the stereoisomeric forms thereof, and the pharmaceutically acceptable salts, and the solvates thereof, there is provided a method of treating warm-blooded animals, including humans, suffering from any one of the diseases mentioned hereinbefore.
(407) Said method comprises the administration, i.e. the systemic or topical administration, preferably oral administration, of a therapeutically effective amount of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, to warm-blooded animals, including humans.
(408) Therefore, the invention also relates to a method for the treatment or prevention of any one of the diseases mentioned hereinbefore comprising administering a therapeutically effective amount of compound according to the invention to a patient in need thereof.
(409) One skilled in the art will recognize that a therapeutically effective amount of the compounds of the present invention is the amount sufficient to have therapeutic activity and that this amount varies inter alias, depending on the type of disease, the concentration of the compound in the therapeutic formulation, and the condition of the patient. Generally, the amount of a compound of the present invention to be administered as a therapeutic agent for treating the disorders referred to herein will be determined on a case by case by an attending physician.
(410) Those of skill in the treatment of such diseases could determine the effective therapeutic daily amount from the test results presented hereinafter. An effective therapeutic daily amount would be from about 0.005 mg/kg to 100 mg/kg, in particular 0.005 mg/kg to 50 mg/kg, in particular 0.01 mg/kg to 50 mg/kg body weight, more in particular from 0.01 mg/kg to 25 mg′kg body weight, preferably from about 0.01 mg/kg to about 15 mg/kg, more preferably from about 0.01 mg/kg to about 10 mg/kg, even more preferably from about; 0.01 mg/kg to about 1 mg/kg, most preferably from about 0.05 mg/kg to about 1 mg/kg body weight. A particular effective therapeutic daily amount might be 1 mg/kg body weight, 2 mg′kg body weight, 4 mg/kg body weight, or 8 mg/kg body weight. The amount of a compound according to the present invention, also referred to herein as the active ingredient, which is required to achieve a therapeutically effect may vary on case-by-case basis, for example with the particular compound, the route of administration, the age and condition of the recipient, and the particular disorder or disease being treated. A method of treatment may also include administering the active ingredient on a regimen of between one and four intakes per day. In these methods of treatment the compounds according to the invention are preferably formulated prior to administration. As described herein below, suitable pharmaceutical formulations are prepared by known procedures using well known and readily available ingredients.
(411) The present invention also provides compositions for preventing or treating the disorders referred to herein. Said compositions comprising a therapeutically effective amount of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, and a pharmaceutically acceptable carrier or diluent.
(412) While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical composition. Accordingly, the present; invention further provides a pharmaceutical composition comprising a compound according to the present invent ion, together with a pharmaceutically acceptable carrier or diluent. The carrier or diluent must be “acceptable” in the sense of being compatible with the other ingredients of the composition and not deleterious to the recipients thereof.
(413) The pharmaceutical compositions of this invention may be prepared by any methods well known in the art of pharmacy, for example, using methods such as those described in Gennaro et al. Remington’ s Pharmaceutical Sciences (18.sup.th ed. Mack Publishing Company, 1990, see especially Part 8: Pharmaceutical preparations and their Manufacture). A therapeutically effective amount of the particular compound, in base form or salt form, as the active ingredient is combined in intimate admixture with a pharmaceutically acceptable carrier, which may take a wide variety of forms depending on the form of preparation desired for administration. These pharmaceutical compositions are desirably in unitary dosage form suitable, preferably, for systemic administration such as oral, percutaneous or parenteral administration; or topical administration such as via inhalation, a nose spray, eye drops or via a cream, gel, shampoo or the like. For example, in preparing the compositions in oral dosage form, any of the usual pharmaceutical media may be employed, such as, for example, water, glycols, oils, alcohols and the like in the case of oral liquid preparations such as suspensions, syrups, elixirs and solutions: or solid carriers such as starches, sugars, kaolin, lubricants, binders, disintegrating agents and the like in the case of powders, pills, capsules and tablets. Because of their ease in administration, tablets and capsules represent the most advantageous oral dosage unit form, in which case solid pharmaceutical carriers are obviously employed. For parenteral compositions, the carrier will usually comprise sterile water, at least in large part, though other ingredients, for example, to aid solubility, may be included. Injectable solutions, for example, may be prepared in which the carrier comprises saline solution, glucose solution or a mixture of saline and glucose solution. Injectable suspensions may also be prepared in which case appropriate liquid carriers, suspending agents and the like may be employed. In the compositions suitable for percutaneous administration, the carrier optionally comprises a penetration enhancing agent and/or a suitable wettable agent, optionally combined with suitable additives of any nature in minor proportions, which additives do not cause any significant deleterious effects on the skin. Said additives may facilitate the administration to the skin and/or may be helpful for preparing the desired compositions. These compositions may be administered in various ways, e.g. as a transdermal patch, as a spot-on or as an ointment.
(414) It is especially advantageous to formulate the aforementioned pharmaceutical compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used in the specification and claims herein refers to physically discrete units suitable as unitary dosages, each unit containing a predetermined quantity of active ingredient calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. Examples of such dosage unit forms are tablets (including scored or coated tablets), capsules, pills, powder packets, wafers, injectable solutions or suspensions, teaspoonfuis, tablespoonfuls and the like, and segregated multiples thereof.
(415) The present compounds can be used for systemic administration such as oral, percutaneous or parenteral administration; or topical administration such as via inhalation, a nose spray, eye drops or via a cream, gel, shampoo or the like. The compounds are preferably orally administered. The exact dosage and frequency of administration depends on the particular compound of Formula (I) used, the particular condition being treated, the severity of the condition being treated, the age, weight, sex. extent of disorder and general physical condition of the particular patient as well as other medication the individual may be taking, as is well known to those skilled in the art. Furthermore, it is evident that said effective daily amount may be lowered or increased depending on the response of the treated subject and/or depending on the evaluation of the physician prescribing the compounds of the instant invention.
(416) The compounds of the present invention may be administered alone or in combination with one or more additional therapeutic agents. Combination therapy includes administration of a single pharmaceutical dosage formulation which contains a compound according to the present invention and one or more additional therapeutic agents, as well as administration of the compound according to the present invention and each additional therapeutic agent in its own separate pharmaceutical dosage formulation. For example, a compound according to the present invention and a therapeutic agent may be administered to the patient together in a single oral dosage composition such as a tablet or capsule, or each agent may be administered in separate oral dosage formulations.
(417) Therefore, an embodiment of the present invention relates to a product containing as first active ingredient a compound according to the invention and as further active ingredient one or more anticancer agent, as a combined preparation for simultaneous, separate or sequential use in the treatment of patients suffering from cancer. The one or more other medicinal agents and the compound according to the present invention may be administered simultaneously (e.g. in separate or unitary compositions) or sequentially in either order. In the latter case, the two or more compounds will be administered within a period and in an amount and manner that is sufficient to ensure that an advantageous or synergistic effect is achieved. It will be appreciated that the preferred method and order of administration and the respective dosage amounts and regimes for each component of the combination will depend on the particular other medicinal agent and compound of the present invention being administered, their route of administration, the particular condition, in particular tumour, being treated and the particular host being treated. The optimum method and order of administration and the dosage amounts and regime can be readily determined by those skilled in the art using conventional methods and in view of the information set out herein.
(418) The weight ratio of the compound according to the present invention and the one or more other anticancer agent(s) when given as a combination may be determined by the person skilled in the art. Said ratio and the exact dosage and frequency of administration depends on the particular compound according to the invention and the other anticancer agent(s) used, the particular condition being treated, the severity of the condition being treated, the age, weight, gender, diet, time of administration and general physical condition of the particular patient, the mode of administration as well as other medication the individual may be taking, as is well known to those skilled in the art. Furthermore, it is evident that the effective daily amount may be lowered or increased depending on the response of the treated subject and/or depending on the evaluation of the physician prescribing the compounds of the instant invention. A particular weight ratio for the present compound of Formula (I) and another anticancer agent may range from 1/10 to 10/1, more in particular from 1/5 to 5/1, even more in particular from 1/3 to 3/1.
(419) The following examples further illustrate the present invention.
EXAMPLES
(420) Several methods for preparing the compounds of this invention are illustrated in the following examples. Unless otherwise noted, all starting materials were obtained from commercial suppliers and used without further purification.
(421) Hereinafter, the terms: ‘ACN’ or ‘CAN’ means acetonitrile, ‘DCM’ means dichloromethane, ‘DCE’ means dichloroethane, ‘DIEA’ means N,N-diisopropylethylamine, “DIAD’ means diisopropyl diazodicarboxylate. ‘IT means hours(s), “min’ means minute(s). ‘DMF’ means dimethylformamide, ‘DSC means differential scanning calorimetry, ‘EtOAc’ or ‘AcOEt’ means ethyl acetate, ‘Et.sub.20’ means diethyl ether, ‘EtOH’ means ethanol, ‘THE’ means tetrahydrofuran, ‘HPLC means High-performance Liquid Chromatography, ‘HBTU’ means 1-bis(dimethylamino)methylene-benzotriazoliumhexafluorophosphate(1-)3-oxide, ‘iPrOH’ means isopropyl alcohol, TEA means trifluoroacetic acid, NaBH.sub.4 means sodium borohydride, TBAF means tetrabutylammonium fluoride, K2CO3 means potassium carbonate, MgSOi means magnesium sulfate, Na?S0.sub.4 means sodium sulfate, Et.sub.3N means triethylamine. PPh.sub.3 means triphenyl phosphine, NaHCO.sub.3 means sodium hydrogenocarbonate, ‘LC/MS’ means Liquid Chromatography/Mass Spectrometry, ‘MeOH’ means methanol, ‘NMR’ means Nuclear Magnetic Resonance, ‘rt’ means room temperature, “SFC” means supercritical fluid chromatography, “M.P.’ or ‘m.p.’ means melting point, ‘OR’ means optical rotation.
(422) As understood by a person skilled in the art, compounds synthesised using the protocols as indicated may exist as a solvate e.g. hydrate, and/or contain residual solvent or minor impurities. Compounds isolated as a salt form, may be integer stoichiometric i.e. mono- or di-salts, or of intermediate stoichiometry.
(423) When a stereocenter is indicated with ‘RS’ this means that a racemic mixture was obtained at the indicated centre, unless otherwise indicated.
(424) The stereochemical configuration for centres in some compounds may be designated “R” or “S” when the mixture(s) was separated; for some compounds, the stereochemical configuration at indicated centres has been designated as “*R” (first eluted from the column in case the column conditions are described in the synthesis protocol and when only one stereocentre present) or “*S” (second eluted from the column in case the column conditions are described in the synthesis protocol and when only one stereocentre present) when the absolute stereochemistry is undetermined (even if the bonds are drawn stereospecifically) although the compound itself has been isolated as a single stereoisomer and is enantiomerically pure.
(425) For example, it will be clear that compound 11A
(426) ##STR00042##
(427) Compounds having two stereocentres of which only the stereochemical configuration of one stereocentre is indicated by * (e.g. *R or *S) (see for example compound 14A or 14B), follow a similar rule as above. This means that the absolute stereoconfiguration of the stereocentre indicated by * is undetermined (even if the bonds are drawn stereospecifically) although the compound is enantiomerically pure at the indicated centre.
(428) For compounds such as for example 31, 32, 35, 36, 54A, 54B, 54C, 54D, 66A, 66B, 66C, 66D, 68A and 68B, wherein the stereochemical configuration of two stereocentres is indicated by * (e.g. *R or *S), the absolute stereochemistry of the stereocentres is undetermined (even if the bonds are drawn stereospecifically), although the compound itself has been isolated as a single stereoisomer and is enantiomerically pure. In this case, the configuration of the first stereocentre is independent of the configuration of the second stereocentre in the same compound.
(429) For example, for Compound 31
(430) ##STR00043##
(431) this means that the compound is
(432) ##STR00044##
(433) The paragraphs above about stereochemical configurations, also apply to intermediates.
(434) The term “enantiomerically pure” as used herein means that the product contains at least 80% by weight of one enantiomer and 20% by weight or less of the other enantiomer. Preferably the product contains at least 90% by weight of one enantiomer and 10% by weight or less of the other enantiomer. In the most preferred embodiment the term “enantiomerically pure” means that the composition contains at least 99% by weight of one enantiomer and 1% or less of the other enantiomer.
(435) When an intermediate or compound in the experimental part below is indicated as ‘HCl salt’ or ‘TFA salt’ without indication of the number of equivalents of HCl or TFA, this means that the number of equivalents of HCl or TFA was not determined.
(436) A skilled person will realize that, even where not mentioned explicitly in the experimental protocols below, typically after a column chromatography purification, the desired fractions were collected and the solvent was evaporated.
(437) A. Preparation of the Intermediates
(438) Preparation of Intermediate 1:
(439) ##STR00045##
(440) A mixture of 1,4-dioxan-8-azaspiro[4.6]undecane (1 g, 6.36 mmol) (CAS[16803-07-9]); 4-chloro-6-(2,2,2-trifluoroethyl)thieno[2,3-J]pyrimidine (CAS[16283 17-85-0]) (1.46 g, 5.78 mmol) prepared as described in Journal of Medicinal Chemistry (2016), 59(3), 892-913; and DIEA (3 mL, 17.35 mmol) in iPrOH (60 mL) was heated at 80° C. for 3h. The mixture was cooled to rt, poured into ice water extracted with EtOAc twice. The combined organic layers were washed with brine, dried over MgS04, filtered and evaporated till dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 40 g. Mobile phase: 97% DCM, 3% MeOH (+10% NH.sub.4OH)). The fractions containing product were collected and evaporated to dryness yielding 2.28 g (yield 106%) of 8-(6-(2,2,2 trifluoroethyl) thieno[2,3-d]pyrimidin-4-yl)-1,4-dioxa-8-azaspiro[4.6]undecane (1-1) that was used without further purification in the next step.
(441) The compound in the Table below was prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(442) TABLE-US-00001 INTERMEDIATE NUMBER STRUCTURE YIELD Intermediate 2
Preparation of Intermediate 3:
(443) ##STR00047##
(444) Intermediate 1 (90 mg, 0.24 mmol) in HCl (1 mL, 6N) was stirred at reflux for 5 h. The reaction mixture was cooled to rt, poured into ice water, basified with a solution of NaOH (3N) and the product was extracted with DCM. The organic layer was separated, dried over MgS04, filtered and evaporated till dryness to give 58 mg (yield 73%) of 1-(6-(2,2,2-trifluoroethyl)thieno[2,3-d]pyrimidin-4-yl)azepan-4-one.
(445) Preparation of Intermediate 4:
(446) ##STR00048##
(447) A mixture of (R)-tert-butyl 4-(benzylamino)azepane-1-carboxylate (160 mg, 0.53 mmol) (CAS[1391730-07-6]), and a solution of HCl in dioxane (1.5 mL/4N, 6 mmol) in MeOH (3 mL) was stirred at rt for 6 h. The mixture was evaporated to dryness giving 129 mg of intermediate 4 that was used without further purification in the next step.
(448) Similarly prepared from(S)-tert-butyl 4-(benzylamino)azepane-1-carboxylate (CAS[1391730-08-7]) was intermediate 5:
(449) ##STR00049##
Preparation of Intermediate 6:
(450) ##STR00050##
(451) Under N.sub.2 flow, 2,2-difluoroethylamine (0.39 mL, 5.5 1 mmol) was added to a solution of tert-butyl 4-oxoazepane-1-carboxylate (350 mg, 1.38 mmol), (CAS[188975-88-4]), and acetic acid (0.17 mL, 3.03 mmol) in THF (5 mL). The mixture was stirred at rt for 30 min, then NaBH(OAc).sub.3 (643 mg, 3.03 mmol) was added and the mixture was stirred at rt overnight. The mixture was poured into ice water and decanted, the aqueous layer was extracted with DCM (×2). The organic layers were combined, washed with brine then dried over MgS0.sub.4, and evaporated to give 380 mg of intermediate 6 tert-butyl 4-((2,2-difluoroethyl)amino)azepane-1-carboxylate. The crude product was used directly for the next step without any purification.
(452) Preparation of Intermediate 7:
(453) ##STR00051##
an HCl salt
(454) At 5° C., a solution of HCl in dioxane (3.4 mL/4N, 13.65 mmol) was added dropwise to a solution of intermediate 5 (380 mg, 1.37 mmol) in DCM (10 mL), and the mixture was stirred at rt for 5h. The reaction was evaporated to dryness, the residue was taken-up with Et.sub.20 and the white precipitate was filtered off and dried under vacuum to give 350 mg of intermediate 7 as an HCl salt.
(455) Preparation of Intermediate 8:
(456) ##STR00052##
(457) A mixture of 4-chloro-6-(2,2,2-trifluoroethyl)thieno[2,3-<i]pyrimidine (CAS[1628317-85-0]) (3 g, 11.87 mmol), t-butyl N-(azepane-4-yl) carbamate (CAS[45445 1-28-6]) (3.05 g, 14.25 mmol), and DIE A (8.2 ml. 47.5 mmol) in iPrOH (75 mL) was heated at 90° C. for 2 h. The mixture was cooled to rt, then poured out into water and the product was extracted with EtOAc. The organic layer was separated, washed with brine, dried over MgS0.sub.4, filtered, and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 40 g GRACE, Mobile phase: Gradient from 100% DCM to 0.1% NH.sub.4OH, 98% DCM, 2% MeOH). The fractions containing product were collected and evaporated to dryness yielding 4.8 g (yield 94%) of intermediate 8.
(458) Preparation of Intermediate 8a and Intermediate 8B:
(459) ##STR00053##
(460) The enantiomers of racemic mixture of intermediate 8 were separated using chiral SEC (Stationary phase: Chiralpak AD-H 5 μm 250*30 mm, Mobile phase: 82% C0.sub.2, 18% EtOH). The fractions containing product were collected and evaporated to dryness yielding 1.35 g (yield 26%) of first eluted enantiomer 8A (intermediate 8A; I-8A) ([a]=+4.78° (589 nm, c 0.293 w/v %, DMF, 20° C.)) and 1.47 g (yield 29%) of second eluted enantiomer 8B (intermediate 8B; I-8B) ([a]=−4.95° (589 nm, c 0.364 w/v %, DMF, 20° C.)).
(461) Preparation of Intermediate 9:
(462) ##STR00054##
as an HCl salt
(463) At 5° C., HCl (11.6 mL, 46.46 mmol, a 4M solution in dioxane) was added dropwise to a solution of intermediate 8 (2 g, 4.65 mmol) in DCM (50 mL), and the mixture was stirred at rt for 15 h. The reaction mixture was evaporated to dryness. The residue was taken-up with Et.sub.20 and evaporated to dryness twice to give 1.8 g of intermediate 9 as an HCl salt, which was used without any further purification for the next step.
(464) The compounds in the Table below were prepared using an analogous method as described for the preparation of intermediate 9 above, starting from the respective starting materials
(465) TABLE-US-00002 INTERMEDIATE NUMBER STRUCTURE Intermediate 10 (from intermediate 8A)
Preparation of Intermediate 12A:
(466) ##STR00057##
(467) Under N.sub.2 flow, at 10° C., HBTU (188 mg, 0.5 mmol) was added to a solution of (R)-5-Boc azaspiro[2.4] heptane-6 carboxylic acid (CAS[1 129634-44-1]) (120 mg, 0.66 mmol) and DIEA (0.43 mL, 2.49 mmol) in DMF (5 niL). The solution was stirred at 10° C. for 30 min. Then intermediate 9 (200 mg, 0.55 mmol) was added, and the solution was stirred at rt for 15 h. The reaction mixture was then poured into cooled water, and K.sub.2C0.sub.3 10%. The product was extracted with EtOAc, the organic layer was washed with brine, dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 um 24 g, Mobile phase: Gradient from 0.1% NH.sub.4OH, 98% DCM, 2% MeOH to 0.1% NH4OH, 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 100 mg (yield 36%) of intermediate 12A. The compound in the Table below was prepared using an analogous method as described for the preparation of intermediate 12A above, starting from the respective starting materials
(468) TABLE-US-00003 INTERMEDIATE NUMBER STRUCTURE YIELD Intermediate 12B from (S)-5-Boc azaspiro[2.4]heptane- 6 carboxylic acid
Preparation of Intermediate 13:
(469) ##STR00059##
(470) Under N.sub.2 flow, a solution of intermediate 3 (223 mg, 0.68 mmol). L-valine ethyl ester hydrochloride (CAS: [17609-47-1]), (308 mg, 1.70 mmol) and acetic acid (78,u L. 1.35 mmol) in THF (6 mL) was stirred at rt for 3h. NaBH(OAc); (308 mg; 1.7 mmol) was added and the mixture was stirred at rt overnight. The mixture was poured into ice water, separated and the aqueous layer was extracted with EtOAc twice. The organic layers were combined, washed with brine, dried over MgS0.sub.4 and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 24 g MERCK, Mobile phase: 97% DCM, 3% MeOH (+10% NH4OH)). The fractions containing product were collected and evaporated to dryness yielding 176 mg of intermediate 13 (yield 26%). The product was further purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 24 g, Mobile phase: 60% HEPTANE, 35% AcOEt, 5% MeOH (+10% NH.sub.4OH)). The fractions containing product were collected and evaporated to dryness yielding 82 mg of intermediate 13.
(471) Preparation of Intermediate 14:
(472) ##STR00060##
as a TFA salt
(473) TFA (1.6 ml, 20.9 mmol) was added at rt to a solution of intermediate 8 (0.9 g, 2.1 mmol) in DCM (9 mL), and the mixture was stirred at rt overnight. The reaction mixture was evaporated to dryness giving 1.5 g of intermediate 14 as a TFA salt, which was used without any further purification for the next step.
(474) The compounds in the Table below were prepared using an analogous method as described for the preparation of intermediate 14 above, starting from the respective starting materials.
(475) TABLE-US-00004 INTERMEDIATE NUMBER STRUCTURE Intermediate 15 (from intermediate 8A)
Preparation of Intermediate 17:
(476) ##STR00063##
(477) Tert-Butyl 4-formyl-1H-pyrazole-1-carboxylate (CAS [821767-61-7]), (122 mg, 0.62 mmol) was added at 10° C., under N.sub.2 to a solution of intermediate 15 (183 mg, 0.55 mmol) in MeOH (7 mL). The mixture was stirred at rt for 5 h. Then NaBH.sub.4 (3 1 mg. 0.83 mmol) was added portion wise and the mixture was stirred at rt for 15 h. The mixture was poured into ice water, extracted with DCM. The organic layer was dried over MgSO.sub.t, filtered and evaporated to dryness giving 0.35 g of crude compound. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 40 g, Mobile phase: Gradient from 0.1% NH.sub.4OH, 97% DCM, 3% MeOH to 0.1% NH.sub.4OH, 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 150 mg (yield 39%) of intermediate 17.
(478) Preparation of Intermediate 18:
(479) ##STR00064##
(480) A solution of 2-bromoethoxy-tert-butyldimethylsilane(CAS [86864-60-0]), (2.44 mL; 11.37 mmol), 1H-pyrazole-4-carbaldehyde (CAS [35344-95-7]), (0.91 g: 9.5 mmol) and K2CO3 (1.57 g:11.37 mmol) in ACN (18 mL) was refluxed for 2 h. The mixture was cooled, poured into ice water and a saturated NaHCO.sub.3 solution, the aqueous layer was extracted with EtOAc. The organic layer was separated, dried over MgS0.sub.4, filtered and evaporated to dryness giving a crude compound which was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 120 g, Mobile phase: Gradient from 100% DCM, 0% MeOH to 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 1.56 g (yield 65%) of intermediate 18.
(481) Preparation of Intermediate 19:
(482) ##STR00065##
(483) The compound was prepared using an analogous method as described for the preparation of intermediate 17, starting from the respective starting materials intermediate 15 and intermediate 18.
(484) Preparation of Intermediate 20a and 20B:
(485) ##STR00066##
(486) The enantiomers of raeemie mixture of ter-Butyl-3-(1-amino-2-methylpropyl)azetidine-1-carboxylate (CAS [1782590-67-3]). (900 mg, 3.94 mmol) were separated using chiral SFC (Stationary phase: Lux Cellulose-2 5 μm 250*30 mm, Mobile phase: 85% CO, 15% MeOH(0.3% iPrNH.sub.2)). The fractions containing product were collected and evaporated to dryness yielding 390 mg (yield 43%) of first eluted enantiomer 20A and 331 mg (yield 37%>) of second eluted enantiomer 20B
(487) Preparation of Intermediate 21
(488) ##STR00067##
(489) Under N.sub.2 flow, a solution of intermediate 3 (473 mg, 1.44 mmol), intermediate 20B (33 1 mg, 1.45 mmol) and acetic acid (85 μL. 1.49 mmol) in THF (19 mL) was stirred at rt overnight. Then NaBH(OAc).sub.3 (918 mg, 4.33 mmol) was added portion wise and the mixture was stirred at rt for 24h. The mixture was carefully poured into ice water, basified with NaOH and extracted with EtOAc. The organic layers were combined, dried over MgSOi, filtered and evaporated to dryness giving 1.1 g of crude compound. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 40 g, Mobile phase: 65% heptane, 5% MeOH, 35% EtOAc). The fractions containing product were collected and evaporated to dryness yielding 565 mg of intermediate 21 (yield 72%).
(490) Preparation of Intermediate 21A AND 21B
(491) ##STR00068##
(492) The mixture of diasteromers INTERMEDIATE 2 1 (240 mg, 0.44 mmol) was separated using chiral SFC (Stationary phase: CHIRACEL OJ-H 5 μm 250*3 0 mm, Mobile phase: 85% CO.sub.2, 15% MeOH(0.3% iPrNH.sub.2)). The fractions containing product were collected and evaporated to dryness yielding 84 mg (yield 11%) of first eluted isomer 2 1A and 97 mg (yield 13%) of second eluted isomer 2IB.
(493) Preparation of Intermediate 22
(494) ##STR00069##
(495) The compound was prepared using an analogous method as described for the preparation of intermediate 21, starting from the respective starting materials intermediate.} and intermediate 20A
(496) Preparation of Intermediate 22A AND 22B
(497) ##STR00070##
The mixture of diastereomers in INTERMEDIATE 22 (240 mg, 0.44 mmol) was separated using chiral SFC (Stationary phase: CHIRALPAK-AD-H 5 μm 250*30 mm, Mobile phase: 70% C0.sub.2, 30% iPrOH(0.3% iPrNH.sub.2)). The fractions containing product were collected and evaporated to dryness yielding 96 mg (yield 11%) of first eluted isomer 22A and 110 mg (yield 12%) of second eluted isomer 22B
Preparation of Intermediate 27
(498) ##STR00071##
(499) Under nitrogen atmosphere, acetic acid (139 μL; 2.43 mmol) was added at rt to a solution of intermediate 3 (400 mg; 1.21 mmol) in THF (15 mL) followed by addition of N-Boc-N-methylethylenediamine (CAS [12 1492-06-6]) (423 mg; 2.43 mmol). The mixture was stirred at room temperature for 5 hours then NaBH(OAc).sub.3 (772 mg; 3.64 mmol) was added and the mixture was stirred at rt for 24h. The mixture was poured into a mixture of ice water and a 10% solution of K2CO3, then extracted with EtOAc, washed with brine and the organic layer was dried over MgS0.sub.4, filtered and evaporated to dryness to give 0.6 g or residue. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 300 g MERCK, Mobile phase: 0.1% NH.sub.4OH, 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 460 mg (72%) of intermediate 27.
(500) Preparation of Intermediate 28
(501) ##STR00072##
(502) Acetic acid (101 μL; 1.76 mmol) was added under nitrogen atmosphere, at rt to a solution of intermediate 27 (430 mg; 0.88 mmol) and 1-methyl-1H-pyrazole-4-carbaldehyde CAS [25016-1 1-9]) (194 mg; 1.76 mmol) in THF (15 mL). The mixture was stirred at rt for 3 hours. Subsequently, NaBH(OAc).sub.3 (561 mg; 2.65 mmol) was added port ion wise and the mixture was stirred at rt for 15 hours. The mixture was poured into a mixture of water, and a 10% solution of K2CO3. EtOAc was added and stirred at rt for 15 min and extracted with EtOAc (×2). The organic layers were combined, dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 24 g GRACE, Mobile phase: Gradient from 0.1% NH.sub.4OH, 97% DCM, 3% MeOH to 0.1% NH.sub.4OH, 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 420 mg (82%) of intermediate 28.
(503) Preparation of Intermediate 33
(504) ##STR00073##
(505) Under N2, to a solution of intermediate 3 (255 mg; 0.78 mmol), Ethyl-4(Aminomethyl)Benzoate (277 mg; 1.55 mmol) in a mixture of THE (7 mL) and acetic acid (67 μL; 1.16 mmol) were stirred at rt for 3h. Then, NaBH(OAc).sub.3 (361 mg; 1.7 mmol) was added and the mixture was stirred at rt overnight. The mixture was poured into ice water and was separated. The aqueous layer was extracted twice with EtOAc. The organic layers were combined, washed with brine then dried over MgS0.sub.4, evaporated. The crude (350 mg) was purified by silica gel chromatography (Stationary phase: irregular SiOH 15-40 μm 24 g MERCK, Mobile phase: Gradient from 97% DCM, 3% MeOH (+10% NH.sub.4OH) to 95% DCM, 5% MeOH (+10% NH.sub.4OH)). The fractions containing the product were mixed to give to afford 8 1 mg (21%) of intermediate 33. The compounds in the Table below were prepared using an analogous method as described for the preparation of intermediate 33, starting from respective starting materials.
(506) TABLE-US-00005 INTERMEDIATE NUMBER STRUCTURE YIELD Intermediate 32 from intermediate 3 and N-benzyl-2-{[tert- butyl(dimethyl)siiyl]oxy} ethanamine (CAS: [227805-74-5]
Preparation of Intermediate 35
(507) ##STR00076##
as an HCl salt
(508) A solution of LiOH hydrate (33 mg; 0.79 mmol) was added at rt to a solution of intermediate 33 (65 mg; mmol) in a mixture of THF (4.6 mL) and water (0.5 mL). The reaction mixture was heated at 60° C. for 24 hours. The reaction mixture was evaporated till dryness. The residue was diluted with water, acidified with HCl IN and evaporated till dryness to give 107 mg of intermediate 35 as an HCl salt.
(509) Preparation of Intermediate 42
(510) ##STR00077##
(511) A mixture of 4-chloro-6-(2.2,2-trifluoroethyl)thieno[2,3-<7]pyrimidine (prepared as described in Journal of Medicinal Chemistry (20 16), 59(3), 892-913) (CAS[16283 17-85-0]) (466 mg, 1.82 mmol), 3-Methyl Azepanone (CAS[7487 12-34-7]) (255 mg, 2 mmol), and DIEA (0.94 mL, 5.47 mmol) in iPrOH (TO mL) was heated at 90° C. for 5 h. The mixture was cooled to rt, then poured out into water and the product was extracted with EtOAc. The organic layer was separated, washed with brine, dried over MgS0.sub.4, filtered, and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 1 5-40 μm 24 g, Mobile phase: Gradient from 99% DCM, 1% MeOH(+10% NH.sub.4OH)) The fractions containing product were collected and evaporated to dryness yielding 65 mg (yield 10%) of pure compound. This fraction was freeze-dried from ACN/water, yielding 44 mg of intermediate 42 as a white powder.
(512) The intermediate in the Table below was prepared using an analogous method as described for the preparation of the intermediate above, starting from the respective starting materials
(513) TABLE-US-00006 INTERMEDIATE NUMBER STRUCTURE Intermediate 43 (from 4-chloro- 6-(2,2,2- trifluoroethyl)thieno [2,3-d]pyrimidine and 5- methylazepan- 4-one)
Preparation of Intermediate 44:
Tert-Butyl 4-(Benzyl0xy)Azepane-1-Carboxylate
(514) NaH (60% dispersion in mineral oil) (89 mg; 2.23 mmol) was added at room temperature to a solution of 1H-Azepine-1-carboxylic acid, hexahydro-4-hydroxy-1.1-dimethylethyl ester (CAS [478832-21-2]) (0.4 g; 1.86 mmol) in DMF (7.6 ml.). After 30 minutes benzyl bromide (0.221 mL; 1.86 mmol) was added in one portion and the reaction mixture was kept stirring at room temperature overnight. The mixture was poured into ice and extracted with EtOAc. The organic layer was washed with brine, dried over MgSOi, filtered and the solvent was evaporated. The residue was purified by chromatography over silica gel (15-40 μm, 40 g, eluent: heptane/EtOAc: 100/0 to 0/100). The fractions containing product were collected and evaporated to dryness yielding 0.394 g (69%) of intermediate 44.
(515) Preparation of Intermediate 4 5
4-(Benzyloxy)Azepane as an HCl Salt
(516) HCl (4N in dioxane) (1.88 mL; 7.5 mmol) was added dropwise at 0° C., to a solution of intermediate 44 (0.382 g; 1.25 mmol) in DCM (8 mL), and the mixture was stirred at rt for 15h. The reaction was evaporated to dryness, the residue was taken-up with Et.sub.20 and the white precipitate was filtered off and dried under vacuum yielding: 0.285 g (94%) of intermediate 45 as an HCl salt.
(517) B. Preparation of the Compounds
Example B1
(518) Preparation of Enantiomers B1A and B1B
(519) ##STR00079##
(520) Under N.sub.2 flow, a solution of intermediate 3 (158 mg, 0.48 mmol), isobutylamine ([CAS: 78-81-9]) (191 μL, 1.9 mmol) and acetic acid (60 μL, 1.1 mmol) in THF (3 mL) was stirred at rt for 3 h. NaBH(OAc); (224 mg, 1.06 mmol) was added portionwise and the mixture was stirred at rt overnight. The mixture was poured into ice water and the mixture was separated, the aqueous layer was extracted with EtOAc (×2).The organic layers were combined, washed with brine then dried over MgS0.sub.4 and evaporated. The residue was purified by chromatography over silica gel (stationary phase: irregular SiOH 15-40 μm 24 g MERCK, mobile phase: gradient from 96% DCM, 4% MeOH (+10% NH.sub.4OH) to 90% DCM, 10% MeOH (+10% NH.sub.4OH)). The fractions containing product were collected and evaporated to dryness yielding 123 mg (yield 66%) of racemic N-isobutyl-1-(6-(2,2,2-trifluoroethyl)thieno[2,3-d]pyrimidin-4-yl)azepan-4-amine.
(521) The two enantiomers were separated by chiral SEC (Stationary phase: CHIRALCEL OJ-H 5, um 250×20 mm, mobile phase: 90% CO2, 10% iPrOH(0.3% iPrNH.sub.2)). The product containing fractions were collected and evaporated to dryness yielding 47 mg (yield 10%) of first eluted enantiomer A and 48 mg (yield 10%>) of second eluted enantiomer B.
(522) Both enantiomers were separately freeze-dried with ACN/water 20/80 to give compound B1A (enantiomer A) (0.041 g) and compound BIB (enantiomer B) (0.051 g).
(523) NMR compound B1A: .sup.1H NMR (500 MHz, DMSO-7J,) δ ppm 8.33 (s, 1H) 7.60 (s, 1H) 4.08 (q, J=11.0 Hz, 2H) 3.86-3.98 (m, 2H) 3.69-3.85 (m, 2H) 2.61 (br s, IH) 2.46 (br s, 1H) 2.29 (br d, J=6.6 Hz, 2H) 2.00 (br d, J=6.6 Hz, 2H) 1.5 1-1.78 (m, 4H) 1.34-1.45 (m, IH) 0.83 (dd, J=6.5, 3.6 Hz, 6H)
Example B2
(524) Preparation of Compound 3:
(525) ##STR00080##
as an HCl salt
(526) A mixture of (R)-N-benzylazepan-4-amine, intermediate 4 (129 mg, 0.465 mmol), 4-chloro-6-(2,2,2-trifluoroethyl)thieno[2,3]pyrimidine (CAS[16283 17-85-0]), (118 mg, 0.465 mmol), prepared as described in Journal of Medicinal Chemistry (2016), 59(3), 892-913. and DIEA (0.32 mL, 1.86 mmol) in ACN (5 ml.) was stirred at rt overnight. The solution was cooled and the residue was poured into cooled water. K2CO3 (solid) was added, and the mixture was extracted with DCM, the organic layer was dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (stationary phase: irregular bare silica 40 g, mobile phase: gradient from 100% DCM, 0% MeOH to 97% DCM, 3% MeOH, 0.1% NH4OH). The fractions containing product were collected and evaporated to dryness yielding 117 mg (yield 60%) of (R)N-benzyl-1-(6-(2,2,2-trifluoroethyl) thieno[2,3-d]pyrimidin-4-yl)azepan-4-amine. This residue was dissolved in acetone, and converted into hydrochloric acid salt b y treatment with HCl (4N in dioxane), the precipitate was filtered and the solid was dried providing 115 mg (yield 48.5%) of COMPOUND 3 C21H23F3N4S. 1.7HC1. 1.4H.sub.20, m.p.: 134° C. (Kofler), optical rotation: +59.1° (365 nm, DMF, 20° C., c=3.03 mg/mL).
(527) .sup.1H NMR (500 MHz, DMSO-J,) δ ppm 9.22 (br s, 2H) 8.44 (s, 1H) 7.67 (s, 1H) 7.52-7.58 (m, 2H) 7.37-7.44 (m, 3H) 4.07-4.19 (m, 5H) 3.99-4.06 (m. 1H) 3.75-3.86 (m, 2H) 3.20 (br s, 1H) 2.47 (br s, 1H) 2.24 (br d, J=12.3 Hz, 1H) 2.03-2.13 (m, 1H) 1.97 (q, J=9.9 Hz, 1H) 1.80 (br d,/=11.0 Hz, 1H) 1.59-1.71 (m, 1H)
Example B3
(528) Preparation of Compound 4:
(529) ##STR00081##
as an HCl salt
(530) Similarly prepared as compound 3 starting from (S)-N-benzylazepan-4-amine, and intermediate 5, was (S)-N-benzyl-1-(6-(2,2,2-trifluoroethyl)thieno[2,3-d]pyrimidin-4-yl)azepan-4-amine (97 mg, yield 50%). This compound was dissolved in acetone, and converted into hydrochloric acid salt by treatment with HCl (4N in dioxane), the precipitate was filtered and the solid was dried providing 80 mg (yield 34%) of compound 4 C21H23F3N4S. 1.6HC1. 1H.sub.20, m.p.: 230° C. (Kofler), optical rotation: −60.6° (365 nm, DMF, 20° C., c=2.84 mg/mL).
Example B4
(531) ##STR00082##
Preparation of Compound 3A and Alternative Preparation of Compounds 3 and 4
(532) A mixture of N-benzylazepan-4-amine (166 mg, 0.8 1 mmol), (CAS[1565450-95-4]), 4-chloro-6-(2,2,2-trifluoroethyl)thieno[2,3-d]pyrimidine (CAS[16283 17-85-0]), (186 mg, 0.74 mmol), prepared as described in Journal of Medicinal Chemistry (2016), 59(3), 892-913, and DIPEA (0.26 mL, 1.48 mmol) in iPrOH (5 mL) was heated at 90° C. overnight. The solution was cooled to rt then concentrated, and the residue was taken up with DCM, the organic layer was washed with water, dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (stationary phase: irregular SiOH 15-40 μm 24 g MERCK, mobile phase: gradient 95% DCM, 5% MeOH (+10% NH.sub.4OH)). The fractions containing product were collected and evaporated to dryness yielding 223 mg (yield 72%) of racemic N -benzyl-1(6-(2,2,24rifluoroethyl)thieno[2,3-d]pyrimidin-4-yl)azepan-4-amine compound 3A. The two enantiomers were separated by chiral SEC (stationary phase: CHIRALCEL OJ-H 5 μm 250×20 mm, mobile phase: 80% C0.sub.2, 20% EtOH (0.3% iPrNH.sub.2)). The product containing fractions were collected and evaporated to dryness yielding respectively 103 mg (yield 33%) of the first eluted enantiomer A that corresponds to compound 3 of absolute configuration (R) and 102 mg (yield 33%) of the second eluted enantiomer B that corresponds to compound 4 of absolute configuration (S).
(533) Each enantiomer was separately dissolved in acetone, and converted into hydrochloric acid salt by treatment with HCl (4N in dioxane), the precipitate was filtered and the solid was dried providing 100 mg of compound 3 C.sub.2iH.sub.23F3N.sub.4S. 3.4HC1. 2.7H.sub.20, m.p.: 130° C. (Kofler; gum) and 98 mg of compound 4 C.sub.2iH.sub.23F.sub.3N.sub.4S. 2.4HC1. 1H.sub.20, m.p.: 224° C. (Kofler).
(534) Alternative Preparation of Compound 3A
(535) Under N.sub.2 flow, at rt, a solution of intermediate 3 (1.5 g, 4.55 mmol), Benzylamine, (1.49 mL, 13.66 mmol), and acetic acid (0.52 mL; 9.11 mmol) in MeOH (15 mL) and DCE (15 mL) was stirred at rt for 2h. Then NaBH(OAc )3 (2. 12 g, 10.02 mmol) was added and the mixture was stirred at rt for 48h. The solution was poured out into cooled water, basified with NaOH 3N. The product was extracted with DCM. The organic layer was washed with brine, dried over MgSO.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 24 g Mobile phase: 96% DCM, 4% MeOH (+10% NH.sub.4OH)). The fractions containing the product were collected and evaporated to dryness yielding 1.9 g of compound 3A (yield 99%).
(536) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(537) TABLE-US-00007 COMPOUND NUMBER STRUCTURE Compound 5 and 5a (from intermediate 7)
Example B5
(538) Preparation of Compound 6:
(539) ##STR00084##
(540) Under N 2 flow, a solution of intermediate 3 (250 mg, 0.76 mmol), isoindoline (CAS[496-12-8]) (361 mg, 3.04 mmol) and acetic acid (96 μL, 1.67 mmol) in THE (10 mL) was stirred at rt for 2 h. Then NaBH(OAc).sub.3 (354 mg, 1.67 mmol) was added and the mixture was stirred at rt overnight. The mixture was carefully poured into ice water and extracted with EtOAc. The organic layers were combined, washed with brine, dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 24 g MERCK, Mobile phase: Gradient from 0.1% NH.sub.4OH, 98% DCM, 2% MeOH to 0.1% NH4OH, 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 130 mg of compound 6 (yield 40%). This fraction was crystallized from Et.sub.20, the precipitate was filtered off and dried under vacuum giving 40 mg of compound 6, M.P.=111° C. (DSC).
(541) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(542) TABLE-US-00008 COMPOUND NUMBER STRUCTURE YIELD Compound 7 (from intermediate 3)
Example B6
(543) Preparation of Compound 10A:
(544) ##STR00101##
as an HCl salt
(545) HCl (0.45 niL, 1.8 1 mmol, a 4M solution in dioxane) was added dropwise, at 5° C., to a solution of intermediate 12A (TOO mg, 0.18 mmol) in DCM (3 mL), and the mixture was stirred at rt for 15 h. The reaction mixture was evaporated to dryness, the residue was taken-up with Et.sub.20 and the solvent was again evaporated to dryness (×2) to give a solid residue (60 mg) of compound TOA as an HCl salt (M.P=220° C. Kofler).
(546) The compound in the Table below was prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(547) TABLE-US-00009 COMPOUND NUMBER STRUCTURE Compound 10B (from intermediate 12B) M.P = 205° C. (Kofler)
Example B7
(548) Preparation of Compound 11:
(549) ##STR00103##
(550) 1-Methyl-1H-pyrazole-4-carbaldehyde (CAS: [25016-1 1-9]) (100 mg, 0.9 mmol) was added drop wise at 20° C., to a solution of intermediate 9 (300 mg, 0.9 mmol) and Et.sub.3N (0.23 mL, 1.64 mmol) in MeOH (5 ml.). The mixture was stirred at rt for 4 h. The mixture was cooled to 0° C. then NaBH.sub.4 (47 mg, 1.23 mmol) was added portionwise and the mixture was stirred at rt for 15 h. The mixture was poured into ice water containing NH.sub.4C.sub.1-10%, and extracted with DCM three times. The organic layers were gathered, washed with brine, dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 24 g GRACE, Mobile phase: Gradient from 0.1% NH.sub.4OH, 97% DCM, 3% MeOH to 0.1% NH.sub.4OH, 95% DCM, 5% MeOH). The fractions containing product were collected and evaporated to dryness yielding 140 mg (yield 40%) of compound 11.
(551) The compound in the Table below was prepared using an analogous method as described for the preparation of compound 11, starting from the respective starting material
(552) TABLE-US-00010 COMPOUND NUMBER STRUCTURE Compound 69 (from intermediate 14 and 4-pyrimidine- carboxaldehyde CAS[2435-50-9])
Example B8
(553) Preparation of Compound 11A and 11B:
(554) ##STR00105##
(555) The enantiomers of racemic mixture of compound ff (135 mg) were separated using chiral SFC (Stationary phase: Chiralpak AD-H 5 μm 250*30 mm, Mobile phase: 60% C0.sub.2, 40% iPrOH(0.3% iPrNH.sub.2)). The fractions containing product were collected and evaporated to dryness yielding 62 mg (yield 46%) of first eluted enantiomer Compound 11A and 65 mg (yield 48%) of second eluted enantiomer (the free base of Compound 1IB). Compound 11A was freeze-dried with acetonitrile/water (20/80) to give 46 mg of compound if A. The free base of compound 11B was dissolved in 2 ml ACN, HCl 6N in iPrOH (2eq) were added drop wise at 10° C., then Et.sub.20. The mixture was triturated, filtered, and dried yielding 25 mg of compound 1IB (as an HCl salt).
(556) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(557) TABLE-US-00011 COMPOUND NUMBER STRUCTURE Compound 13A (from intermediate 3)
(558) NMR compound 9B: .sup.1H NMR (500 MHz, DMSO-J,) δ ppm 8.90 (br s, 2H) 8.41 (s, 1H) 7.67 (s, 1H) 7.35 (d, J=7.6 Hz, IH) 6.96-7.15 (m, 2H) 3.97-4.25 (m, 6H) 3.81-3.91 (m, 2H) 3.33 (br s, 1H) 2.46 (br s, J=1.9 Hz, IH) 2.32 (s, 3H) 2.27 (s, 4H) 2.06-2.15 (m, IH) 1.98 (q, J=10.1 Hz, IH) 1.84 (br d, J=9.5 Hz, IH) 1.66 (q, J=11.2 Hz, IH)
(559) NMR compound 7B: .sup.1H NMR (500 MHz, DMSO-J,) δ ppm 9.60 (br s, 2H) 8.56 (br s, IH) 7.83 (br d, J=6.6 Hz, IH) 7.74 (br s, IH) 7.34 (br t, J=8.8 Hz, 1H) 7.18 (br s, IH) 3.99-4.29 (m, 6H) 3.85 (br s, 2H) 3.30 (br s, IH) 2.41-2.49 (m, IH) 2.26 (br s, 1H) 1.93-2.17 (m, 2H) 1.84 (br d, J=8.8 Hz, IH) 1.71 (br d, J=1.3 Hz, IH)
Example B9
(560) Preparation of Compound 14A and Compound 14B:
(561) ##STR00122##
(562) Under N.sub.2 flow, a solution of intermediate 13 (82 mg, 0.18 mmol) in THF (3 mL) was added dropwise to a solution of lithium aluminium hydride (6.8 mg, 0.18 mmol) in THF (2 mL) at 5° C. The mixture was stirred for 4 h at 5° C. EtOAc was added dropwise to the solution followed by slow addition of water. The reaction mixture was extracted with EtOAc, the organic layer was washed with water, dried over MgS0.sub.4, filtered and evaporated till dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular bare silica 24 g, Mobile phase: 0.5% NH.sub.4OH, 95% DCM, 5% MeOH). The product containing fractions were collected and evaporated to dryness yielding 29 mg (yield 39%) of racemic mixture. The mixture was separated using chiral SEC (Stationary phase: CHIRALPAK AD-H 5 μm 250×20 mm, Mobile phase: 75% C0.sub.2, 25% iPrOH (0.3% iPrNH.sub.2)). The fractions containing product were collected and evaporated to dryness yielding 10 mg (yield 46%) of first eluted isomer A and 10 mg (yield 48%) of second eluted isomer B.
(563) Isomer A was freeze-dried with ACN/water 20/80 to give 0.009 g (12%>) of compound 14A.
(564) Isomer B was freeze-dried with ACN/water 20/80 to give 0.008 g (11%} of compound 14B.
Example B10
(565) Preparation of Compound 15:
(566) ##STR00123##
(567) Under N.sub.2 flow, at 0° C., DIAD (0.219 mL; 1.11 mmol) was added to a solution of intermediate 2 (0.3 g, 0.905 mmol), phenol (CAS: [108-95-2]), (102 mg, 1.09 mmol) and PPI13 (371 mg; 1.42 mmol) in THF (8 mL). The mixture was allowed to reach rt and was stirred overnight. The reaction mixture was evaporated to dryness.
(568) The crude product was purified by column chromatography over silica gel (eluent: heptane/EtOAc from 1/0 to 3/1). The desired fraction was collected and concentrated to give 0.211 g of crude compound which was purified by chromatography via reverse phase (stationary phase: YMC-actus Triart-C 18 μm 30*150 mm, mobile phase: gradient from 40% NH4HCO3 0.2%, 60% ACN to 0% NH4HCO3 0.2%, 100% ACN). The product containing fractions were collected and evaporated to dryness to give 0.145 g (yield 39%) of product, which was crystallized from DIPE under sonication, the precipitate was filtered and dried, yielding: 0.095 g (yield 26%) of compound 15.
Example B11
(569) Preparation of Compound 16:
(570) ##STR00124##
as an HCl salt
(571) Under N 2 flow, a solution of intermediate 3 (200 mg, 0.544 mmol), 4-methylbenzylamine (CAS[104-84-7]) (66 mg, 0.544 mmol), and NaBH(OAc).sub.3 (224 mg, 1.06 mmol) in DCE (10 mL) was stirred at rt overnight. A saturated NaHCO.sub.3 solution (10 mL) and DCM (10 mL) were added, the mixture was separated, the aqueous layer was extracted with DCM (10 mL×2).The organic layers were combined, washed with water then dried over Na.sub.2S04 and evaporated giving 300 mg of crude compound. The residue was purified by chromatography over silica gel (stationary phase: Kromasil 150*25 mm*10 μm, mobile phase: gradient from 47% water (0.05% ammonia hydroxide v/v), 53% ACN to 37% water (0.05% ammonia hydroxide v/v), 63% ACN). The product containing fractions were collected and evaporated to dryness, the residue was dissolved in ACN (3 mL), water (20 mL) and HC1 (12M, 0.15 mL) were slowly added in turn. The clear solvent was freeze-dried yielding 250 mg (yield 97%) of compound 16 as an HCl salt. (m.p.: 262-264° C.).
(572) 1H NMR (400 MHz, DMSO-d6) δ ppm 9.55 (br s, 2H), 8.57 (s, IB), 7.74 (s, IH), 7.46 (br d, 0.1=7.5 Hz, 211), 7.17 (br d, 0.1=7.5 Hz, 2H), 4.15 (br d, J=11.0 Hz, 6H), 3.83 (br d. J=9.7 Hz, 2H), 3.14 (br d, J=13.2 Hz, 1H), 2.48-2.38 (m, 1H), 2.28 (s, 4H), 2.14-1.96 (m. 2H), 1.84-1.71 (m. 2H).
(573) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(574) TABLE-US-00012 COMPOUND NUMBER STRUCTURE Compound 17 (from intermediate 3 and 3- (methylaminomethyl) benzylamine, CAS [1035316-05-2])
Example B12
(575) Preparation of Compound 26:
(576) ##STR00132##
as an HCl salt
(577) HC1 (0.74 mL, 2.94 mmol, a 4M solution in dioxane) was added dropwise, at 5° C., to a solution of intermediate 17 (150 mg, 0.29 mmol) in DCM (5 mL), and the mixture was stirred at rt for 4 h. The reaction mixture was evaporated to dryness, the residue was taken-up with Et.sub.20, filtered off and dried under vacuum overnight to give a precipitate (69 mg) of compound 26 as an HCl salt (m.p.=156° C. (Kofler). optical rotation: +40.24° (365 nm, DMF, 20° C., c=2.79 mg/mL)).
(578) .sup.1H NMR (400 MHz, DMSO-J,) δ ppm 9.18 (br s, 2H) 8.52 (s, 1H) 7.79 (s, 2H) 7.71 (s, 1H) 3.95-4.25 (m, 6H) 3.62-3.91 (m, 2H) 3.15 (br s, 1H) 2.43 (br s, 1H) 2.15-2.26 (m, 1H) 2.03-2.13 (m, 1H) 1.74-1.99 (m, 2H) 1.55-1.72 (m, 1H)
Example B13
(579) Preparation of Compound 27:
(580) ##STR00133##
(581) At rt, TBAF (0.35 mL; 0.35 mmol, 1M in THF) was added dropwise to a solution of intermediate 19 (200 mg; 0.35 mmol) in THF (10 mL) and the reaction mixture was stirred at room temperature for 5h.
(582) The reaction mixture was poured into a 10% aqueous solution of K2CO3 and extracted with EtOAc. The organic layer was washed with 10%>aqueous K2CO3 (2×30 niL), water (30 niL) and brine (30 mL), dried over MgS04, filtered and evaporated to dryness to give 150 mg of crude compound. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 24 g, Mobile phase: gradient from 0.1% NH4OH, 95% DCM, 5% MeOH to 0.1% NH.sub.4OH, 90% DCM, 10% MeOH). The product containing fractions were collected and evaporated to dryness yielding 34 mg (yield 21%) of product which was purified via reverse phase (stationary phase: YMC-actus Triart-C18 10 μm 30*150 mm, mobile phase: gradient from 75% NH4HCO3 (0.2%), 25% ACN to 35% NH4HCO3 (0.2%), 65% ACN). The fractions containing product were collected and evaporated to dryness to give 25 mg (yield 16%>) of compound which was freeze-dried with ACN/water yielding 17 mg (yield 11%) of compound 27. The compound in the Table below was prepared using an analogous method as described for the preparation of compound above, starting from the respective starting material
(583) TABLE-US-00013 COMPOUND NUMBER STRUCTURE Compound 50 (from intermediate 32)
Example B14
(584) Preparation of Compound 28:
(585) ##STR00135##
(586) 1-Methyl-1H-imidazole-5-carboxaldehyde (CAS [39021-62-0]), (100 mg, 0.91 mmol) was added at 10° C., under N.sub.2 flow to a solution of intermediate 15 (150 mg, 0.45 mmol) in MeOH (6 mL). The mixture was stirred at rt for 5 h. Then NaBH.sub.4 (26 mg, 0.68 mmol) was added and the mixture was stirred at rt for 15 h. The mixture was poured into ice water, extracted with DCM. The organic layer was dried over MgSOi, filtered and evaporated to dryness giving 350 mg of crude compound. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 40 g, Mobile phase: Gradient 0.5% NH.sub.4OH, 93% DCM, 7% MeOH). The fractions containing product were collected and evaporated to dryness yielding 113 mg (yield 59%) of compound which was freeze-dried with ACN and water yielding 66 mg of compound 28
(587) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(588) TABLE-US-00014 COMPOUND NUMBER STRUCTURE YIELD Compound 29 (from intermediate 15)
Example B15
(589) Preparation of Compound 31:
(590) ##STR00138##
(591) HC1 (0.4 mL, 1.6 mmol, a 4M solution in dioxane) was added drop wise, at 5° C., to a solution of intermediate 21A (84 mg, 0.16 mmol) in MeOH (4 mL), and the mixture was stirred at rt for 24 h. The reaction mixture was evaporated to dryness, cooled by an iced-water bath, the residue was taken-up with Et.sub.20, a precipitate was filtered off and dried under vacuum overnight to give a solid compound (67 mg, ) of compound 3 1 as an HCl salt m.p.=184° C. (Kofler), (optical rotation: +13.97° (589 nm, DMF, 20° C., c=3.15 mg/ml_)).
(592) .sup.1H NMR (500 MHz, DMSO-J,) δ ppm 8.44 (s, 1H) 8.23-8.36 (m, 1H) 7.68 (s, 1H) 4.12-4.27 (m, 5H) 3.91 (br d, J=7.3 Hz, 4H) 3.58-3.70 (m, 2H) 3.39-3.46 (m, IH) 3.22 (br s, IH) 2.43 (br s, IH) 2.20 (br d, J=12.3 Hz, IH) 1.83-2.13 (m, 4H) 1.60 (q, 7=11.2 Hz, IH) 0.93 (d, J=6.6 Hz, 3H) 0.88 (d, J=7.3 Hz, 3H)
(593) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(594) TABLE-US-00015 COMPOUND NUMBER STRUCTURE Compound 32 (from intermediate 21B)
Example B18
(595) Preparation of Compound 39
(596) ##STR00144##
as an HCl salt
(597) TFA (1.05 mL; 13.75 mmol) was added drop wise, at 5° C., to a solution of intermediate 28 (200 mg; 0.34 mmol) in DCM (12 mL), and the mixture was stirred at rt for 48 hours. The mixture was then evaporated to dryness then the residue was taken up with DCM and H.sub.20 basified with NaOH 3N. The organic layer was extracted (×3 times), dried over MgS0.sub.4 and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular bare silica 40 g, Mobile phase: 1% NH40H, 90% DCM, 10% MeOH). The fractions containing product were collected and evaporated to dryness yielding 110 mg (66%). This fraction was dissolved in ACN (2 mL) and converted with HCl (4M in dioxane) in an HCl salt (75 mg).
Example B20
(598) Preparation of Compound 44
(599) ##STR00145##
(600) A mixture of 4-chloro-6-(2,2,2-trifluoroethyl)thieno[2,3-</]pyrimidine prepared as described in Journal of Medicinal Chemistry (20 16), 59(3). 892-913 (CAS[16283 17-85-0]) (0.248 g; 0.98 mmol), intermediate 45 (4-benzyloxyazepane HCl salt) (0.285 g), TEA (0.5 1 ml; 2.95 mmol) in iPrOH (8 mL) were heated at 90° C. for 1 h30. The solution was cooled to rt, concentrated and the residue was taken-up with DCM, the organic layer was washed with water, dried over MgSOi, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (40 g, 15-40 μm, eluent: DCM/MeOH: 100/0 to 90/10). The fractions containing product were collected, evaporated to dryness. The residue was freeze-dried with acetonitrile/water 20/80 yielding: 0.308 g of compound 44 (74%).
Example B23
(601) Preparation of Compound 49
(602) Compound 49 in the Table below was prepared using an analogous method as described for the preparation of INTERMEDIATE 12A and 12B, starting from the respective starting materials
(603) TABLE-US-00016 COMPOUND NUMBER STRUCTURE Compound 49 (from intermediate 35 and methylamine hydrochloride, CAS [593-51-1])
Example B24
(604) Preparation of Compound 65
(605) ##STR00147##
(606) Under N.sub.2 flow, at rt. titanium (IV) ethoxide (CAS[3087-36-3]), (0.52 mL; 2.52 mmol) was added to a solution of intermediate-3 (4 10 mg, 1.25 mmol),and 1-methyl 4,5,6,7 tetrahydroindazole-4amine (CAS[927803-64-3]), (205 mg, 1.36 mmol) in MeOH (8 mL). The solution was stirred at rt for 1 h. Then NaBH(OAc), (804 mg, 3.79 mmol) was added and the mixture was stirred at rt for 2 days. The solution was poured out into cooled water, basified with K2CO3 powder, DCM was added and the mixture was filtered through a pad of Celite®. The product was extracted with DCM. The organic layer was combined, washed with brine, dried over MgS0.sub.4, filtered and evaporated to dryness. The residue was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40, um 40 g Mobile phase: Gradient from 100% DCM, 0% MeOH to 0.2% NH.sub.4OH, 95% DCM, 5% MeOH). The fractions containing the product were collected and evaporated to dryness giving 4 17 mg (yield 72%) of Compound 65.
(607) The compounds in the Table below were prepared using an analogous method as described above, starting from the respective starting materials.
(608) TABLE-US-00017 COMPOUND NUMBER STRUCTURE YIELD Compound 66 (from intermediate 3 and 2H-Indazol-4- amine, 4,5,6,7- tetrahydro-2-methyl-, hydrochloride (CAS[1803561-52-5]))
Example B25
(609) Preparation of Compound 65A, 65B, 65C and 65D
(610) ##STR00151##
(611) Compound 65 (41 7 mg; 0.9 mmol) was separated using chiral SFC (Stationary phase: Chiralpak AD-H 5 μm 250*30 mm, Mobile phase: 65% C0.sub.2, 35% EtOH(0.3% iPrNH.sub.2)). The fractions containing the products were collected and evaporated to dryness yielding 81 mg (yield 14%) of first eluted diastereomer A. This fraction was freeze-dried from ACN/water, yielding 79 mg of compound 65A as a white powder (optical rotation=−20° (589 nm, c=2.60 mg/mL, DMF, 20° C.)) and yielding 67 mg (yield 12%) of second eluted diastereomer B. This fraction was freeze-dried from ACN/water, yielding 60 mg of compound 65B. as a white powder (optical rotation=−21.72° (589 nm, c=2.44 mg/mL, DMF, 20° C.)) and yielding 84 mg (yield 15%) of third eluted diastereomer C. This fraction was freeze-dried from ACN/water, yielding 83 mg of compound 65C as a white powder (optical rotation=+10.74° (589 nm, c=2.42 mg/mL, DMF, 20° C.)) and yielding 50 mg (yield 9%) of fourth eluted diastereomer D. This fraction was freeze-dried from ACN/water, yielding 44 mg of compound 65D as a white powder (optical rotation=+11.34° (589 nm, c=2.38 mg/mL. DMF, 20° C.)).
(612) The compounds in the Table below were prepared using an analogous method as described for the preparation of compound above, starting from the respective starting materials
(613) TABLE-US-00018 COMPOUND NUMBER STRUCTURE Compound 66A, Compound 66B, Compound 66C and Compound 66D from SFC separation of Compound 66 (Stationary phase: CHIRALPAK AD-H 5 μm 250*30 mm, Mobile phase: 65% CO.sub.2, 35% EtOH(0.3% iPrNH.sub.2))
Example B26
(614) Preparation of Compound 68A, 68B and 68C
(615) ##STR00156##
(616) The compound 68(2 14 mg) was purified by chromatography over silica gel (Stationary phase: irregular SiOH 15-40 μm 40 g Mobile phase: 0.2% NH.sub.4OH, 98% DCM, 2% MeOH). The fractions containing the first eluted compound were collected and evaporated to dryness giving 92 mg (yield 47%) of the first mixture of diastereoisomers A and B and the fractions containing the second eluted compound were collected and evaporated to dryness giving 35 mg of the second mixture of diastereoisomers C. The first mixture of diastereoisomers A and B (92 mg) were separated using chiral SFC (Stationary phase: Lux Cellulose-2 5 μm 250*2 1.2 mm, Mobile phase: 60% C0.sub.2, 40% EtOH(0.3% iPrNH.sub.2)). The fractions containing the first eluted diastereo isomer A were collected and evaporated to dryness yielding 41 mg of compound (yield 14%) which was dissolved in 2 niL of ACN, 3eq of HCl 4N in dioxane (71 μL; 0.28 mmol) were added dropwise at 10° C., Et.sub.20 was added and after 30 mn, the solution was evaporated to dryness, Et.sub.20 was added and a precipitate was filtered and dried giving 20 mg of compound 68A (MP=136° C./kofler). The fractions containing the second eluted diastereoisomer B were collected and evaporated to dryness yielding 42 mg (yield 22%) which were dissolved in 2 ml, of ACN, 3eq of HCl 4N in dioxane (210 μL; 0.84 mmol) were added dropwise at 10° C., Et.sub.20 was added and after 30mn, the solution was evaporated to dryness, Et.sub.20 was added and a precipitate was filtered and dried giving 18 mg of compound 68B (M P=150° C./kofier). The second mixture of diastereoisomers C which was obtained during the first purification over silica gel was purified using SFC (Stationary phase: NH.sub.2 5 μm 150*30 mm, Mobile phase: 90% CO?, 10% MeOH(0.3% iPrNH.sub.2)). The fractions containing the diastereoisomers C were collected and evaporated to dryness yielding 14 mg (yield 7%) of compound 68C (mixture of cis or mixture of trans).
Example B27
(617) Preparation of Compound 54A, 54B, 54C and 54D.
(618) ##STR00157##
(619) The compound 54 (570 mg) was purified using chiral SFC (Stationary phase: CHIRALPAK AD-H 5 μm 250*30 mm, Mobile phase: 80% C0.sub.2, 20% EtOH(0.3% iPrNH.sub.2)) yielding 237 mg of a first eluted mixture of diastereoisomers A and B112 mg of a second eluted diastereoisomer C and 93 mg of a third eluted diastereoisomer D. A second separation was made on the mixture of diastereoisomers A and B using CHIRALPAK IC 5 μm 250*21 0.2 mm, mobile phase: 60% C0.sub.2, 40% EtOH(0.3% iPrNH.sub.2)) yielding 116 mg of a first eluted diastereoisomer A and 100 mg of a second eluted diastereoisomer B. The diastereoisomer A was dissolved in 5 mL of MeOH, 2eq of HCl 4N in dioxane (133 μL; 0.53 mmol) were added dropwise at 10° C., Et.sub.20 was added and after 30mn. the solution was evaporated to dryness, Et.sub.20 was added and a precipitate was filtered and dried giving 116 mg of compound 54A as an HCl salt (MP=160° C./kofler).
(620) The diastereoisomer B was dissolved in 5 mL of MeOH, 2eq of HCl 4N in dioxane (114 μL; 0.46 mmol) were added drop wise at 10° C., Et.sub.20 was added and after 30mn, the solution was evaporated to dryness, Et.sub.20 was added and a precipitate was filtered and dried giving 104 mg of compound 54B as an HCl salt (MP=160° C./kofler).
(621) The diastereoisomer C was dissolved in 5 ml of MeOH, 2eq of HCl 4N in dioxane (128 μL; 0.5 1 mmol) were added dropwise at 10° C., Et.sub.20 was added and after 30mn, the solution was evaporated to dryness, Et.sub.20 was added and a precipitate was filtered and dried giving 123 mg (yield 17%) of compound 54C as an HCl salt (MP=160° C./kofler).
(622) The diastereoisomer D was dissolved in 5 mL of MeOH, 2eq of HCl 4N in dioxane (106 μL; 0.42 mmol) were added dropwise at 10° C., Et.sub.20 was added and after 30mn, the solution was evaporated to dryness, Et.sub.20 was added and a precipitate was filtered and dried giving 95 mg (yield 13%) of compound 54D as an HCl salt (MP=160° C./kofler).
(623) Analytical Part
(624) NMR
(625) NMR experiments were carried out using a Broker Avance 500 spectrometer equipped with a Broker 5 mm BBFO probe head with z gradients and operating at 500 MHz for the proton and 125 MHz for carbon, or using a Broker Avance DRX 400 spectrometer using internal deuterium lock and equipped with reverse double-resonance (1H .sup.13C, SEI) probe head with z gradients and operating at 400 MHz for the proton and 100 MHz for carbon. Chemical shifts (δ) are reported in parts per million (ppm). J values are expressed in Hz.
(626) LCMS (Liquid Chromatography/Mass Spectrometry)
(627) General Procedure
(628) The High Performance Liquid Chromatography (HPLC) measurement was performed using a EC pump, a diode-array (DAD) or a UV detector and a column as specified in the respective methods. If necessary, additional detectors were included (see table of methods below).
(629) Flow from the column was brought to the Mass Spectrometer (MS) which was configured with an atmospheric pressure ion source. It is within the knowledge of the skilled person to set the tune parameters (e.g. scanning range, dwell time . . . ) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW). Data acquisition was performed with appropriate software. Compounds are described by their experimental retention times (Rt) and ions. If not specified differently in the table of data, the reported molecular ion corresponds to the [M+H].sup.+ (protonated molecule) and/or [M−H].sup.− (deprotonated molecule). In case the compound was not directly ionizable the type of adduct is specified (i.e. [M+NH.sub.4].sup.+, [M+HCOO].sup.−, etc.). For molecules with multiple isotopic patterns (Br, CI . . . ), the reported value is the one obtained for the lowest isotope mass. All results were obtained with experimental uncertainties that are commonly associated with the method used. Hereinafter, “SQD” means Single Quadrupole Detector, “RT” room temperature, “BEH” bridged ethylsiloxane/silica hybrid, “HSS” High Strength Silica, “DAD” Diode Array Detector.
(630) TABLE-US-00019 TABLE la LCMS Method codes (Flow expressed in mL/min; column temperature (T) in ° C.; Run time in minutes). Method Mobile Flow Run code Instrument Column phase gradient Column T time 1 Waters: Waters: A: 95% 84.2% A for 0.343 6.2 Acquity BEH C18 CH.sub.3COONH.sub.4 0.49 min, to 10.5% 40 UPLC ® - DAD (1.7 μm, 7 mM/5% A in 2.18 min, held and Quattro 2.1 × 100 mm) CH.sub.3CN, for 1.94 min, back Micro ™ B: CH.sub.3CN to 84.2% A in 0.73 min, held for 0.73 min. 2 Waters: Waters: BEH A: 95% 84.2% A to 10.5% 0.343 6.1 Acquity ® H- C18 (1.7 μm, CH.sub.3COONH.sub.4 A in 2.18 min, held 40 Class - DAD 2.1 × 100 mm) 7 mM/5% for 1.96 min, back and SQD2 ™ CH.sub.3CN, to 84.2% A in B: CH.sub.3CN 0.73 min, held for 0.73 min. 3 Waters: BEH ®-C18 A: 95% 95% A to 5% A 0.5 3.3 Acquity (1.7 μm, CH.sub.3COONH.sub.4 in 1 min, held for 40 UPLC ® H- 2.1 × 100 mm) 7 mM/5% 1.6 min, back to Class - DAD CH.sub.3CN, 95% A in 0.2 min, and QDa B: CH.sub.3CN held for 0.5 min. 4 Waters: Waters A: 95% From 95% A to 0.5 3.3 Acquity BEH ®C18 CH.sub.3COONH.sub.4 5% A in 1 min, 40 UPLC ® H- (1.7 μm, 7 mM/5% held for 1.6 min, Class - DAD 2.1 × 50 mm) CH.sub.3CN, back to 95% A in and SQD 2 B: CH.sub.3CN 0.2 min, held for 0.5 min. 5 Agilent: 1200 - Phenomenex: A: CF.sub.3COOH 100% A for 1 min, 0.8 10 DAD and Luna-C18 0.1% in water, to 40% A in 4 min, 50 MSD6110 (5 μm, B: CF.sub.3COOH to 15% A in 2 × 50 mm) 0.05% in 2.5 min, back to CH.sub.3CN 100% A in 2 min. 6 Agilent: 1200 - Phenomenex: A: CF.sub.3COOH 90% A for 0.8 min, 0.8 10 DAD and Luna-C18 0.1% in water, to 20% A in 50 MSD6110 (5 μm, B: CF.sub.3COOH 3.7 min, held for 2 × 50 mm) 0.05% in 3 min, back to 90% C¾CN A in 2 min.
Melting Points
(631) For a number of compounds, melting points (MP) were determined with a DSCl (Mettler-Toledo). Melting points were measured with a temperature gradient of 10° C./minute. Maximum temperature was 300° C. Values are peak values.
(632) For a number of compounds, melting points were obtained with a Kofler hot bench (indicated with (K)), consisting of a heated plate with linear temperature gradient, a sliding pointer and a temperature scale in degrees Celsius.
(633) TABLE-US-00020 TABLE lb LCMS and melting point data. Co. No. means compound number; Rt means retention time in min. Co. mp Rt UV LCMS No. (° C.) (min) Area % [M + H].sup.+ Adduct Method 1-13 1.46 88% 459.5 3 3A 1.2 421.3 3 3* 134° C. 2.75 100 421.1 479.3 1 (K) [M + CHXOO].sup.− 4* 230° C. 2.74 100 421.1 479.3 1 (K) [M + CHXOO].sup.− I-1 1.24 93.84 374.4 3 I-2 2.4 97.56 332 330 1 1-3 1.12 100 330.1 328.1 3 5* 244° C. 2.67 100 395.4 453.3 2 (K) [M + CHXOO].sup.− 5a 2.67 97.56 395.4 453.3 2 [M + CHXOO].sup.− B1A 2.35 100 387.1 445.3 1 [M + CHXOO].sup.− BIB 2.35 100 387.1 445.4 1 [M + CHXOO].sup.− I 10* 1.8 100 331.4 389.3 2 [M + CHXOO].sup.− 111* 1.86 100 331.4 389.4 2 [M + CHXOO].sup.− 10B* 2.32 100 454.4 512.3 2 [M + CHXOO].sup.− 6 111.41° c./−27.83 J/ 3.3 96.53 433.2 491.4 1 g .sup.(a) [M + CHXOO].sup.− 7A* 176° C. 3.11 98.39 457.1 515.3 1 (K) [M + CH3COO−]; 455.2 [M + H−] 7B* 180° C. 3.1 100 457.1 515.3 1 (K) [M + CH3COO−]; 455.1 [M + H−] 9A* 156° C. 3.15 97.46 449.1 507.3 1 (K) [M + CH3COO−]; 447.1 [M + H−] 9B* 160° C. 3.15 100 449.1 507.4 1 (K) [M + CH3COO−]; 447.6 [M + H−] 14 3.48 100 408.1 406.1 1 I-8 1.39 98.28 431.4 489.3 4 [M + CH.sub.3COO].sup.− I-12A 1.31 100 554.6 612.4 3 [M + CH.sub.3COO].sup.− 10A* 220° C. 2.43 100 454.2 512.5 1 (K) [M + CH.sub.3COO].sup.− 10B* 205° C. 2.32 100 454.4 512.3 4 (K) [M + CH.sub.3COO].sup.− 11 2.13 97.17 425.1 483.4 1 [M + CH.sub.3COO].sup.− 11B* 2.1 96.63 425.1 483.4 1 [M + CH.sub.3COO].sup.− 11A 2.1 98.27 425.1 483.4 1 [M + CH.sub.3COO].sup.− 14A 2.37 98.19 417.1 475.4 1 [M + CH.sub.3COO].sup.− 14B 2.38 98.13% 417.1 475.3 1 [M + CH.sub.3COO].sup.− 12 94° C. 2.04 99.36 373.4 431.2 2 (K) [M + CH.sub.3COO].sup.− 15 110° C. 3.48 100 408.1 1 (K) 16* 3.04 99.85 435 6 17* 3.18 99.05 464 5 18* 3.01 99.96 465 6 19* 2.83 99.84 435 6 21* 3.72 99.01 451 5 22* 2.93 99.19 451 6 23* 3.00 99.85 435 6 24* 3.56 99.93 385 5 26* 156° C. 2.07 100 411 469.3 1 (K) [M + CH3COO−] 27 2.02 97.57 455.2 513.4 1 [M + CH3COO−] 28 2.28 98.25 425.1 483.3 1 [M + Ch3COO−] 29* 2.39 95.58 422.1 480.2 1 [M + CH3COO−] 30 2.32 96.07 423.1 481.3 1 [M + CH3COO−] 31* 184° C. 2.53 100 442.2 500.4 1 (K) [M + CH3COO]− 32* 190° C. 2.51 100 442.2 500.4 1 (K) [M + CH3COO]− 33* 200° C. 2.52 95.36 442.1 500.2 1 (K) [M + CH3COO]− 34* 188° C. 2.53 100 442.1 500.2 1 (K) [M + CH3COO]− 35* 193° C. 2.53 100 442.2 500.4 1 (K) [M + CH3COO]− 36* 208° C. 2.51 100 442.1 500.4 1 (K) [M + CH3COO]− 39* 2.26 100 482.2 540.5 1 [M + CH3COO−] Int. 42 92° C. 2.8 96.61 344 402.1 1 (K) [M + CH3COO]− 44 3.54 100 100 1 49 2.33 72.15 478.2 536.6 1 [M + CH3COO]− 50 3.13 95.25 465.2 523.4 1 [M + CH3COO]− 52 2.67, 42.17, 444.2 502.4 1 2.69 56.50 [M + CH3COO]− 53 2.86 95.8 506.2 564.5 1 [M + CH3COO−] 54A 160 C. 2.17 98.28 439.1 497.3 1 (K) [M + CH3COO]− 54B 160° C. 2.18 99.45 439.1 497.3 1 (K) [M + CH3COO]− 54C 178° C. 2.17 100 439.1 497.3 1 (K) [M + CH3COO]− 54D 160° C. 2.17 100 439.1 497.3 1 (K) [M + CH3COO]− 55* 110° C. 100 429.1 487.3 1 (K) 57A* 150° C. 2.73 1.05 492.3 550.4 1 (K) [M + CH3COO]− 57B* 2.8 95.73 495.3 550.4 1 [M + CH3COO]− 58A* 3.24 100 481.2 539.4 1 [M + CH3COO−] 58B* 3.24 98.24 481.2 539.4 1 [M + CH3COO−] 58A* 3.24 100 481.2 539.4 1 [M + CH3COO−] 58B* 3.24 98.24 481.2 539.4 1 [M + CH3COO−] 59A 3.32 97.49 477.2 535.3 1 [M + CH3COO]− 59B 3.32 98.01 477.2 535.2 1 [M + CH3COO]− 60A* 3.33 99.34 515.3 573.5 1 [M + CH3COO−] 60B* 3.33 98.73 515.3 573.5 1 [M + CH3COO−] 61* 110° C. 2.21 99.37 524.3 582.5 1 (K) [M + CH3COO−] 62* 130° C. 2.11 99.27 416.1 474.3 1 (K) [M + CH3COO−] 63* 2.29 100 510.3 568.5 1 [M + CH3COO−] 65A 2.33 98.72 465.1 523.2 1 [M + CH3COO]− 65B 2.33 99.22 465.1 523.3 1 [M + CH3COO]− 65C 2.32 99.27 465.2 523.4 1 [M + CH3COO]− 65D 2.33 98.61 465.1 523.3 1 [M + CH3COO]− 66A 2.31 97.71 465.2 523.3 1 [M + CH3COO]− 66B 2.31 97.51 465.2 523.4 1 [M + CH3COO]− 66C 2.31 97.4 254.9 523.4 1 [M + CH3COO]− 66D 2.31 97.49 465.2 523.3 1 [M + CH3COO]− 67A 164° C. 3.11 100 435.1 493.3 1 (K) [M + CH3COO]− 67B 180° C. 3.37 100 435.1 493.3 1 (K) [M + CH3COO]− 68A* 134° C. 3.26 99.21 435.2 493.3 1 (K) [M + CH3COO]− 68B* 150° C. 3.26 99.36 435.2 493.4 1 (K) [M + CH3COO]− 68C 3.34 95.32 435.2 493.4 1 [M + CH3COO]− 69 2.24 97.62 423.1 481.3 2 [M + CH3COO]− I 17 1.22 99.06 511.1 569.3 [M + CH3COO−] I 28 1.32 98.42 582.3 640.3 1 [M + CH3COO−] I 34 0.87 87.31 430.4 488.2 1 [M + CH3COO−] I 35* 0.92 85.27 465.5 3 .sup.(a) (25° C. to 300° C./10° C. min/40 jiL Al) *means hydrochloride salt
SFCMS-Methods
General Procedure for SFC-MS Methods
(634) The SFC measurement was performed using an Analytical Supercritical fluid chromatography (SFC) system composed by a binary pump for delivering carbon dioxide (C0.sub.2) and modifier, an autosampler, a column oven, a diode array detector equipped with a high-pressure flow cell standing up to 400 bars. If configured with a Mass Spectrometer (MS) the flow from the column was brought to the (MS). It is within the knowledge of the skilled person to set the tune parameters (e.g. scanning range, dwell time . . . ) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW). Data acquisition was performed with appropriate software.
(635) TABLE-US-00021 TABLE 2a Analytical SFC-MS Methods (Flow expressed inmL/min; column temperature (T) in ° C.; Run time in minutes, Backpressure (BPR) in bars. Run Method Flow time code column mobile phase Gradient Col T BPR 1 Phenomenex A: CO.sub.2 40% B 3.5 3 Luxcellulose-2 B: MeOH hold 35 103 column (3 μm, (+0.3% 3 min 100 × 4.6 mm) iPrNH.sub.2) 2 Daicel A: CO.sub.2 15% B 3.5 3 Chiralpak ® AD-3 B: EtOH hold 35 103 column (3 μm, 3 min 100 × 4.6 mm) 3 Daicel A: CO.sub.2 20% B 3.5 3 Chiralcel ® OJ-3 B: EtOH hold 35 103 column (3 μm, (+0.3% 3 min 100 × 4.6 mm) iPrNH.sub.2) 4 Daicel A: CO.sub.2 10% B 3.5 3 Chiralcel ® OJ-3 B: iPrOH hold 35 103 column (3 μm, (+0.3% 3 min 100 × 4.6 mm) iPrNH.sub.2) 5 Daicel A: C0.sub.2 30% B 3.5 3 Chiralpak ® AD-3 B: IPrOH hold 35 103 column (3 μη.Math., 3 min 100 × 4.6 mm) 6 Phenomenex A: C0.sub.2 40% B 3.5 3 Lux cellulose 2 B: EtOH hold 35 105 (3 μn.Math., (0.3% 3 min, 100 × 4.6 mm) iPrNH2) 7 Phenomenex A: C0.sub.2 30% B 3.5 3 Lux cellulose 2 B: MeOH hold 35 105 (3 Lim, (0.3% 3 min, 100 × 4.6 mm) iPrNH2) 8 Phenomenex A: C0.sub.2 15% B 3.5 3 Lux cellulose 2 B: MeOH hold 35 105 (3 .urn, (0.3% 3 min. 100 × 4.6 mm) iPrNH2) 9 Daicel A: C0.sub.2 30% B 3.5 3 Chiralpak ® AD-3 B: hold 35 105 (3 μη.Math., MeOH/iPrOH 3 min, lOO × 4.6 mm) 50/50(0.3% iPrNH.sub.2) 10 Daicel B: 20% B 3.5 3 Chiralpak ® AD-3 MeOH(+0.3% hold 35 105 (3 μn.Math., iPrNH.sub.2) 3 min, lOO × 4.6 mm) 11 Daicel B: 30% B 3.5 4 Chiralpak ® AD-3 MeOH(+0.3% hold 35 105 (3 μη.Math., iPrNH.sub.2) 3 min, lOO × 4.6 mm) 12 Daicel A: C0.sub.2 30% B 3.5 6 Chiralpak ® AD-3 B: EtOH hold 35 103 column (3 μη.Math., 3 min 100 × 4.6 mm) 13 Daicel A: C0.sub.2 10% B 3.5 6 Chiraicel ® OJ-3 B: EtOH hold 35 105 (3 μn.Math., (0.3% 3 min, 100 × 4.6 mm iPrNH2) 14 Daicel A: C0.sub.2 30% B 3.5 3 Chiralpak ® AD-3 B: IPOH hold 35 103 column (3 μη.Math., 3 min 100 × 4.6 mm) 15 Daicel A: C0.sub.2 25% B 3.5 3 Chiralcel ® OD-3 B: hold 35 105 (3 Lim. EtOH(+0.3% 3 min, 100 × 4.6 mm) iPrNH2) 16 Daicel A: C0.sub.2 20% B 3.5 10 Chiralpak ® AD-3 B: hold 35 105 (3 μη.Math., MeOH/iPrOH 3 min, lOO × 4.6 mm) 50/50(0.3% iPrNH.sub.2) 17 Daicel A: C0.sub.2 30% B 3.5 3 Chiralpak ® AD-3 B: EtOH hold 35 103 column (3 μη.Math., 3 min 100 × 4.6 mm) 19 Daicel A: C0.sub.2 40% B 3.5 3 Chiralpak ® IC-3 B: hold 35 105 (3 μη.Math., EtOH(+0.3% 3 min, 100 × 4.6 mm) iPrNH.sub.2) 20 Daicel A: C0.sub.2 20% B 3.5 6 Chiralpak ® AD-3 B: EtOH hold 35 103 column (3 μπ.Math., 3 min 100 × 4.6 mm)
(636) TABLE-US-00022 TABLE 2b SFC-MS data (Isomer elution order ‘A’ before ‘B’, ‘B’ before ‘C, ‘C before ‘D’) Isomer Co. uv % Elution SFCMS No. Area order Method 110* 100 A 1 111* 100 B 1 I-8A 100 A 2 I-8B 99.56 B 2 3* 99.72 A 3 4* 99.68 B 3 B1A 99.63 A 4 BIB 96.23 B 4 13A 100 A 5 13B 100 B 5 68A* 100 A 6 68B* 100 B 6 I20A 100 A 8 I20B 98.8 B 8 34* 100 A and D 9 33* 100 B and C 9 57* 100 A 10 57B* 100 B 10 59A 100 A 11 59B 100 B 11 65A 100 A 12 65B 100 B 12 65C 100 C 12 65D 100 D 12 I21A 100 A 13 I21B 100 B 13 58A* 100 A 1 58B* 99.73 B 1 I22A 100 A 14 I22B 99.04 B 14 60A* 99.84 A 15 60B* 98.01 B 15 66A 100 A 16 66B 100 B 16 66C 99.05 C 16 66D 100 D 16 31* 100 A 17 32* 99.60 B 17 35* 98.64 A 17 36* 100 B 17 54A 100 A 19 54B 99.18 B 19 54C 100 C 20 54D 100 D 20 *means hydrochloride salt
Optical Rotation (or)
(637) Optical Rotation is measured with a polarimeter 341 Perkin Elmer. The polarized light is passed through a sample with a path length of 1 decimeter and a sample concentration of 0.2 to 0.4 gram per 100 milliliters. 2 to 4 mg of the product in vial are weight, then dissolved with 1 to 1.2 ml of spectroscopy solvent (DMF for example). The cell is filled with the solution and put into the polarimeter at a temperature of 20° C. The OR is read with 0.004° of precision.
(638) Calculation of the concentration: weight in gram×100/volume in ml
(639) [a] d.sup.20: (read rotation×100)/(1.000 dm×concentration).
(640) .sup.d is sodium D line (589 nanometer) unless another wavelength is specified.
(641) TABLE-US-00023 TABLE 3 OR data: solvent: DMF; temperature: 20° C.; ‘cone’ means concentration (g/100 mL); ‘OR’ means optical rotation. Co. Wavelength No. OR (°) (nm) Conc. 5* +3.85 546 0.286 I10* +42.01 365 0.288 I11* −45.2 365 0.25 I-8A +4.78 589 0.293 I-8B −4.95 589 0.364 B1A −3.73 589 0.295 B1B −4.81 589 0.27 3* +59.08 365 0.303 4* −60.56 365 0.284 11B −5.76 589 0.243 11A +4.94 589 0.324 13A +3.19 589 0.313 13B −4.66 589 0.279 68A* +72.79 365 0.294 68B* −68.05 365 0.266 57A* +13.67 589 0.300 57B* −18.21 589 0.280 59A +8.33 589 0.264 59B −14.17 589 0.247 34* −25 589 0.260 33* +18.04 589 0.388 65A −20 589 0.260 65B −21.72 589 0.244 65C +10.74 589 0.242 65D +11.34 589 0.238 58A* +5.81 589 0.241 58B* −6.67 589 0.285 60A* +22.87 589 0.328 60B* −23.36 589 0.274 52 −8.98 589 0.245 66A −10.81 589 0.259 66B −14.16 589 0.219 66C +8.27 589 0.266 66D +4.03 589 0.248 31* +13.97 589 0.315 32* +26.85 589 0.365 35* −15.16 589 0.31 36* −26.87 589 0.335 54A −46.38 589 0.345 54B +16.99 589 0.312 54C +49.15 589 0.352 54D −24.35 589 0.382 26* +46.24 365 0.279 *means hydrochloride salt
Pharmacological Part
1) Menin/MLL Fluorescence Polarization Assay
(642) To a non-surface binding, black 384-well microtiter plate was added 50 nL 160× test compound in DMSO and 4 μL 2× menin in assay buffer (40 mM TrisHCl, pH 7.5, 50 mM NaCl, 1 mM DTT and 0.001% Tween 20). After incubation of test compound and menin for 10 min at ambient temperature, 4 μL 2×FITC-MBM1 peptide (FITC-β-alanine-SARWRPPARPGT-NH2) in assay buffer was added, the microtiter plate centrifuged at 1000 rpm for 1 min and the assay mixtures incubated for 15 min at ambient temperature. The relative amount of menin -FITC-MBM1 complex present in an assay mixture is determined by measuring the fluorescence polarization (FP) of the FITC label with a BMG Pherastar plate reader (ex. 485 nm/em. 520 nm) at ambient temperature. The final concentrations of reagents in the binding assay are 100 nM menin, 5 nM FITC-MBM1 peptide and 0.625%>DMSO in assay buffer. Dose-response titrations of test compounds are conducted using an 11 point, three-fold serial dilution scheme, starting at 31 μM.
(643) Compound potencies were determined by first calculating % inhibition at each compound concentration according to equation 1:
% inhibition=((HC−LC)−(FP.sub.compound−LC))/(HC−LC))*100 (Eqn 1)
(644) Where LC and HC are the FP values of the assay in the presence or absence of a saturating concentration of a compound that competes with FITC-MBM1 for binding to menin, and FP.sup.compound is the measured FP value in the presence of the test compound. HC and LC FP values represent an average of at least 16 replicates per plate. For each test compound, % inhibition values were plotted vs. the logarithm of the test compound concentration, and the IC.sub.50 value derived from fitting these data to equation 2:
% inhibition=Bottom+(Top−Bottom)/(1+10{circumflex over ( )}((log/C.sub.5o−log[cmpd])*/z)) (Eqn 2)
(645) Where Bottom and Top are the lower and upper asymptotes of the dose-response curve, respectively, IC50 is the concentration of compound that yields 50% inhibition of signal and h is the Hill coefficient.
(646) 2) Menin/MLL Homogenous Time-Resolved Fluorescence (HTRF) Assay
(647) To an untreated, white 384-well microtiter plate was added 40 nL 200× test compound in DMSO and 4 μL 2× terbium chelate-labeled menin (vide infra for preparation) in assay buffer (40 mM Tris .HCl, pH 7.5, 50 mM NaCl, 1 mM DTT and 0.05% Pluronic F-127). After incubation of test compound and terbium chelate-labeled menin for 5 min at ambient temperature, 4 μL 2×FITC-MBM1 peptide (FITC-P-alanine-SARWRFPARPGT-NH2) in assay buffer was added, the microtiter plate centrifuged at 1000 rpm for 1 min and the assay mixtures incubated for 15 min at ambient temperature. The relative amount of menin ⋅FITC-MBM1 complex present in an assay mixture is determined by measuring the homogenous time-resolved fluorescence (HTRF) of the terbium/FITC donor/acceptor fluorphore pair using a BMG Pherastar plate reader (ex. 337 nm/terbium cm. 490 nm/FITC cm. 520 nm) at ambient temperature. The degree of fluorescence resonance energy transfer (the HTRF value) is expressed as the ratio of the fluorescence emission intensities of the FITC and terbium fluorophores (P.sup.m 520 nm//F.sup.em 490 nm). The final concentrations of reagents in the binding assay are 100 pM terbium chelate-labeled menin, 75 nM FITC-MBM1 peptide and 0.5%) DMSO in assay buffer. Dose-response titrations of test compounds are conducted using an 11 point, three-fold serial dilution scheme, starting typically at 25 μM.
(648) Compound potencies were determined by first calculating % inhibition at each compound concentration according to equation 1:
% inhibition=((HC−LC)−(HTRF.sup.compound−LC))/(HC−LC))*100 (Eqn 1)
(649) Where LC and HC are the HTRF values of the assay in the presence or absence of a saturating concentration of a compound that competes with FITC-MBM1 for binding to menin, and HTRF.sup.compound is the measured HTRF value in the presence of the test compound. HC and LC HTRF values represent an average of at least 16 replicates per plate. For each test compound, % inhibition values were plotted vs. the logarithm of the test compound concentration, and the IC50 value derived from fitting these data to equation 2:
% inhibition=Bottom+(Top−Bottom)/(l+10{circumflex over ( )}((log/C.sub.5o−log[cmpd])*/z)) (Eqn 2)
(650) Where Bottom and Top are the lower and upper asymptotes of the dose-response curve, respectively, IC50 is the concentration of compound that yields 50% inhibition of signal and h is the Hill coefficient.
(651) Preparation of Terbium cryptate labeling of Menin: Menin (a. a. l-610-6×his tag) was labeled with terbium cryptate as follows. 2 mg of Menin was buffer exchanged into 1× phosphate buffered saline. 16 uM Menin was incubated with 4-fold molar excess NHS-terbium cryptate (Cisbio Bioassays, Bedford, Mass.) for 2 hours at room temperature. The labeled protein was purified away from free label by running the reaction over a Superdex 200 Increase 10/300 GL column at 0.75 ml/min. Peak fractions were collected, aliquoted and frozen at −80° C.
(652) MENIN Protein Sequence (SEQ ID NO: 1):
(653) TABLE-US-00024 MGLKAAQKTLFPLRS IDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLA VNRVI PTNVPELTFQPSPAPDPPGGLTYFPVADLS IIAALYARFTAQI RGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFI TGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVT WHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPS IDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRP DPLTLYHKGIASAKTYYRDEHI YPYMYLAGYHCRNRNVREALQAWADTA TVIQDYNYCREDEEI YKEFFEVANDVI PNLLKEAASLLEAGEERPGEQ SQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQS LGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPP PPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAAS PPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQS QVQMKKQKV S TPSDYTLS FLKRQRKGLHHHHHH
3) Proliferation Assay
(654) The anti-proliferative effect of menin/MLL protein/protein interaction inhibitor test compounds was assessed in human leukemia cell lines. The cell lines MV-4-1 1 and MOLM14 harbor MEL translocations and express the MEL fusion proteins MLL-AF4 and MLL-AF9, respectively, as well as the wildtype protein from the second allele. Therefore, the MEL rearranged cell lines MV-4-1 1 and MOLM14 exhibit stem cell-like HOXAIMEIS1 gene expression signatures. K562 was used as a control cell line containing two MLL wildtype alleles in order to exclude compounds that display general cytotoxic effects.
(655) MV-4-1 1 and MOLM14 were cultured in RPMI-1640 (Sigma Aldrich) supplemented with 10% fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 μg/ml gentamycin (Gibco). K562 were propagated in RPMI-1640 (Sigma Aldrich) supplemented with 20% fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 μg/ml gentamycin (Gibco). Cells were kept at 0.3-2.5 million cells per ml during culturing and passage numbers did not exceed 25.
(656) In order to assess the anti-proliferative effects, 1,500 MV-4-1 1, 300 MOLM14 or 750 K562 cells were seeded in 200 μl media per well in 96-well round bottom, ultra-low attachment plates (Costar, catalogue number 7007). Cell seeding numbers were chosen based on growth curves to ensure linear growth throughout the experiment. Test compounds were added at different concentrations and the DMSO content was normalized to 0.3%>. Cells were incubated for 8d at 37° C. and 5% C0.sub.2. Spheroid like growth was monitored in real-time by live-cell imaging (IncuCyteZOOM, Essenbio, 4× objective) acquiring one image every four hours for 8d. Confluence (%) as a measure of spheroid size was determined using an integrated analysis tool.
(657) In order to determine the cumulative effect of the test compounds over time, the area under the curve (AUC) in a plot of confluence against time was calculated. Confluence at the beginning of the experiment (t=0) was used as baseline for the AUC calculation.
(658) Absolute IC50 values were calculated according to the following procedure:
% Control=(AUC sample/AUC control)*100
AUC control=mean AUC of control values(cells without compound/DMSO as vehicle control)
(659) A non-linear curve fit was applied using the least squares (ordinary) fit method to the plot of % control versus compound concentration. Based on this, the absolute IC50 value (half maximal inhibitory concentration of the test compound causing an anti-proliferative effect of 50% relative to the vehicle control) was calculated.
(660) TABLE-US-00025 TABLE 4 Biological data in the Menin fluorescence polarization (FP) assay (1), Menin/MLL homogenous time-resolved fluorescence (HTRF) assay (2) and proliferation assay (3). (2) Menin (3) Spheroid (3) Spheroid (1) Menin HTRF assay assay FP assay assay MV-4-11 MOLM14 (3)Spheroid Co. (IC.sub.50 (IC.sub.50 (IC.sub.50 (IC.sub.50 assay No. (μM)) (nM)) (μM)) (μM)) K562 B1A 0.054 50 2.5 11.3 NT B1B 0.44 788 8.9 >15 NT 3 0.038 14 0.44 3.1 9.7 4 0.23 330 2.9 7.6 8.8 5 6.36 9532 NT NT NT 5a 6.15 8285 NT NT NT 6 NT 60 2.2 NT NT 7 NT 55 1.6 NT NT 8 NT 64 1.6 NT NT 9 NT 36 1.4 NT NT .sup. 10B NT 1315 5.0 14.2 NT 11 NT 69 2.0 NT NT .sup. 10A NT 1532 NT NT NT .sup. 9A NT 548 NT NT NT .sup. 9B NT 22 0.9 NT NT .sup. 11B NT 1469 NT NT NT .sup. 11A NT 55 1.6 NT NT 12 NT 5790 NT NT NT .sup. 13A NT 5269 NT NT NT .sup. 13B NT 2456 NT NT NT .sup. 14A NT 4468 NT NT NT .sup. 14B NT 767 NT NT NT 15 NT 606 NT NT NT 16 NT 21 0.8 4.9 NT 17 NT 33 1.3 NT NT 18 NT 563 4.7 NT NT 19 NT 41 2.0 NT NT 21 NT 97 1.0 6.1 NT 22 NT 78 2.5 9.9 NT 23 NT 150 3.1 9.4 NT 24 NT 53 1.2 NT NT 26 NT 27 NT NT NT 27 NT NT NT NT NT 28 NT 149 3.4 NT NT 29 NT 40 2.1 NT NT 30 NT 186 4.45 NT NT 31 NT 34 1.4 NT NT 32 NT 758 NT NT NT 33 NT 27 2 NT NT 34 NT 216 3.2 NT NT 35 NT 1012 NT NT NT 36 NT 170 2.5 NT NT 39 NT 852 NT NT NT 44 NT 137 4.3 NT NT 49 NT 45 1.1 NT NT 50 NT 185 2.3 NT NT 52 NT 20820 NT NT NT 53 NT 204 2.1 NT NT .sup. 54A NT 11888 NT NT NT .sup. 54B NT 13225 NT NT NT .sup. 54C NT 1488 NT NT NT .sup. 54D NT 6764 NT NT NT 55 NT 227 NT NT NT 56 NT 724 NT NT NT .sup. 57A NT 194 2.8 NT NT .sup. 57B NT 222 4.4 NT NT .sup. 58A NT 1552 NT NT NT .sup. 58B NT 888 NT NT NT .sup. 59A NT 709 NT NT NT .sup. 59B NT 1150 NT NT NT .sup. 60A NT 493 5.5 NT NT .sup. 60B NT 295 2.4 NT NT 61 NT 181 NT NT NT 62 NT 724 NT NT NT 63 NT 369 NT NT NT .sup. 65A NT 3496 NT NT NT .sup. 65B NT 284 4.3 NT NT .sup. 65C NT 686 NT NT NT .sup. 65D NT 8694 NT NT NT .sup. 66A NT 7437 NT NT NT .sup. 66B NT 164 3.8 NT NT .sup. 66C NT 5378 NT NT NT .sup. 66D NT 880 NT NT NT .sup. 67A NT 396 3.6 NT NT .sup. 67B NT 348 3.7 NT NT .sup. 68A NT 103 1.9 NT NT .sup. 68B NT 522 NT NT NT .sup. 68C NT 282 4.4 7.7 NT 69 NT 598 NT NT NT NT: not tested NT: not tested