THERAPEUTIC COMPOSITIONS COMPRISING MICROBE-TARGETING MOLECULES AND THEIR USE IN METHODS OF PREVENTING AND TREATING INFECTIOUS DISEASE

20240199719 ยท 2024-06-20

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides compositions comprising microbe-targeting molecules (MTMs) that bind microbe-associated molecular patterns, and methods of using the compositions in the prevention and treatment of infectious disease.

Claims

1. A composition comprising a collectin-based engineered microbe-targeting molecule (MTM) comprising at least one collectin microbe-binding domain and at least one additional domain, wherein the collectin microbe-binding domain comprises the carbohydrate recognition domain (CRD) of a collectin selected from the group consisting of (i) mannose-binding lectin (MBL), (ii) surfactant protein A (SP-A), (iii) surfactant protein D (SP-D), (iv) collectin liver 1 (CL-L1), (v) collectin placenta 1 (CL-P1), (vi) conglutinin collectin of 43 kDa (CL-43), (vii) collectin of 46 kDa (CL-46), (viii) collectin kidney 1 (CL-K1), (ix) conglutinin, and (x) a sequence variant having at least 85% sequence identity to any one of (i)-(ix), and wherein the at least one additional domain is one or more domains selected from the group consisting of (xi) a collectin cysteine-rich domain, (xii) a collectin collagen-like domain, (xiii) a collectin coiled-coil neck domain, (xiv) a ficolin short N-terminal domain, (xv) a ficolin collagen-like domain, (xvi) a TLR transmembrane helix, (xvii) a TLR C-terminal cytoplasmic signaling domain, (xviii) an oligomerization domain, (xix) a signal domain, (xx) an anchor domain, (xxi) a collagen-like domain, (xxii) a fibrinogen-like domain, (xxiii) an immunoglobulin domain, (xxiv) an immunoglobulin-like domain, and (xxv) a sequence variant having at least 85% sequence identity to any one of (xi)-(xxiv).

2. The composition of claim 1, wherein the collectin microbe-binding domain comprises the CRD of MBL or a sequence variant thereof having at least 85% sequence identity to the CRD of MBL.

3. The composition of claim 1 or 2, wherein the CRD of MBL comprises the amino acid sequence of any one of SEQ ID NOs:1, 2, 3, 4, and 5 or a sequence variant thereof having at least 85% sequence identity to any one of SEQ ID NOs:1, 2, 3, 4, and 5.

4. The composition of claim 1, wherein the at least one additional domain is an immunoglobulin domain.

5. The composition of claim 1 or 4, wherein the immunoglobulin domain comprises the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

6. The composition of claim 1 or 4, wherein the MTM is one or more of SEQ ID NOs: 6-9, or a sequence variant thereof having at least 85% sequence identity to any one of SEQ ID NOs:6-9.

7. A composition comprising a ficolin-based engineered microbe-targeting molecule (MTM) comprising at least one ficolin microbe-binding domain and at least one additional domain, wherein the ficolin microbe-binding domain comprises the fibrinogen-like domain of a ficolin selected from the group consisting of (i) ficolin 1, (ii) ficolin 2, (iii) ficolin 3, and (iv) a sequence variant having at least 85% sequence identity to any one of (i)-(iii), and wherein the at least one additional domain is one or more domains selected from the group consisting of (v) a ficolin short N-terminal domain, (vi) a ficolin collagen-like domain, (vii) a collectin cysteine-rich domain, (viii) a collectin collagen-like domain, (ix) a collectin coiled-coil neck domain, (x) a TLR transmembrane helix, (xi) a TLR C-terminal cytoplasmic signaling domain, (xii) an oligomerization domain, (xiii) a signal domain, (xiv) an anchor domain, (xv) a collagen-like domain, (xvi) a fibrinogen-like domain, (xvii) an immunoglobulin domain, (xviii) an immunoglobulin-like domain, and (xix) a sequence variant having at least 85% sequence identity to any one of (v)-(xviii).

8. The composition of claim 7, wherein the ficolin microbe-binding domain comprises the fibrinogen-like domain of any one of SEQ ID NOs:21, 22 and 23, or a sequence variant thereof having at least 85% sequence identity to any one of SEQ ID NOs:21, 22 and 23.

9. The composition of claim 7 or 8, wherein the at least one additional domain is an immunoglobulin domain.

10. The composition of any one of claims 7-9, wherein the immunoglobulin domain comprises the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

11. A composition comprising a toll-like receptor (TLR)-based engineered microbe-targeting molecule (MTM) comprising at least one TLR microbe-binding domain and at least one additional domain, wherein the TLR microbe-binding domain comprises the N-terminal ligand-binding domain of a TLR selected from the group consisting of (i) TLR1, (ii) TLR2, (iii) TLR3, (iv) TLR4, (v) TLR5, (vi) TLR6, (vii) TLR7, (vii) TLR8, (viii) TLR9, (ix) TLR10, and (x) a sequence variant having at least 85% sequence identity to any one of (i)-(ix), and wherein the at least one additional domain is one or more domains selected from the group consisting of (xi) a TLR transmembrane helix, (xii) a TLR C-terminal cytoplasmic signaling domain, (xiii) a ficolin short N-terminal domain, (xiv) a ficolin collagen-like domain, (xv) a collectin cysteine-rich domain, (xvi) a collectin collagen-like domain, (xvii) a collectin coiled-coil neck domain, (xviii) an oligomerization domain, (xix) a signal domain, (xx) an anchor domain, (xxi) a collagen-like domain, (xxii) a fibrinogen-like domain, (xxiii) an immunoglobulin domain, (xxiv) an immunoglobulin-like domain, and (xxv) a sequence variant having at least 85% sequence identity to any one of (xi)-(xxiv).

12. The composition of claim 11, wherein the TLR microbe-binding domain comprises the N-terminal ligand-binding domain of any one of SEQ ID NOs:24-33 or a sequence variant thereof having at least 85% sequence identity to any one of SEQ ID NOs:24-33.

13. The composition of claim 11 or 12, wherein the at least one additional domain is an immunoglobulin domain.

14. The composition of any one of claims 11-13, wherein the immunoglobulin domain comprises the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

15. A composition comprising one or more engineered MTMs, wherein the one or more engineered MTMs is selected from any of the engineered MTMs of claims 1-14.

16. The composition of claim 15, further comprising at least one naturally-occurring MTM.

17. The composition of claim 15, further comprising one or more antimicrobial agents.

18. The composition of claim 16, further comprising one or more antimicrobial agents.

19. The composition of claim 15, comprising at least two collectin-based engineered MTMs of claim 1, wherein at least one of the collectin-based engineered MTMs is an FcMBL of SEQ ID NO:6, 7, 8 or 9 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:6, 7, 8 or 9.

20. The composition according to any preceding claim, wherein at least a portion of the composition is encapsulated in at least one liposome.

21. The composition according to any preceding claim, wherein the composition comprises an aerosol, a rinse, a spray, a cream, a powder, or an ointment formulated for nasal, oral, and/or ocular administration.

22. A method of treating an infectious disease in a subject comprising administering a therapeutically-effective amount of a composition of any preceding claim to a subject having an infectious disease.

23. A method of preventing an infectious disease in a subject comprising administering a therapeutically-effective amount of a composition of any preceding claim to a subject at risk of developing an infectious disease.

Description

BRIEF DESCRIPTION OF DRAWINGS

[0043] FIG. 1. Diagram showing the structure of exemplary collectins and ficolins.

DETAILED DESCRIPTION

I. Definitions

[0044] As used herein, a or an may mean one or more. As used herein when used in conjunction with the word comprising, the words a or an may mean one or more than one. As used herein another may mean at least a second or more. Furthermore, unless otherwise required by context, singular terms include pluralities and plural terms include the singular.

[0045] As used herein, about refers to a numeric value, including, for example, whole numbers, fractions, and percentages, whether or not explicitly indicated. The term about generally refers to a range of numerical values (e.g., +/?5-10% of the recited value) that one of ordinary skill in the art would consider equivalent to the recited value (e.g., having the same function or result). In some instances, the term about may include numerical values that are rounded to the nearest significant figure.

II. The Present Invention

[0046] As summarized above, the present invention discloses compositions and methods for preventing and/or treating infectious disease, where the compositions comprise microbe-targeting molecules (MTMs) and/or engineered MTMs that have the shared characteristic of binding to one or more microbe-associated molecular patterns (MAMPs).

[0047] The compositions of the present invention comprise one or more MTMs, and optionally one or more therapeutic agents. A MTMs bind to, and in some cases isolates, one or more microbes or microbe components. A therapeutic agent, such as an antimicrobial agent, can optionally be included in the composition to aid in the treatment of one or more known or suspected pathogens. A composition of the present invention can comprise any suitable formulation, including, but not limited, to an aerosol, a rinse, a spray, a cream, a powder, or an ointment that can be administered nasally, orally, and/or ocularly. A method for preventing or treating an infectious disease comprises administering a therapeutically-effective amount of a composition of the invention to a subject (e.g., a human or animal subject) in need thereof. In some aspects, the formulation can be suitable for treating skin or mucosal inflammation.

[0048] The compositions and methods described herein can be used to prevent one or more pathogens from entering a subject, e.g., into the eye(s), nose, mouth, and/or respiratory system, including the airway, lungs and blood vessels, and blood; to decrease the pathogen load on the subject; and/or to treat a subject having one or more infections.

[0049] MTMs defined herein can be used to contact, and optionally isolate, microbes and microbial components based on the identity of the MAMP produced by the microbe, rather than the identity of microbe itself. While some MAMPs are produced by only a single species of microbe, other MAMPs are shared across species. Thus, while some MTMs of the invention bind to only MAMPs of a particular species of microbe, other MTMs of the invention can bind to MAMPs produced by all members of a particular class, order, family, genus or sub-genus of microbe.

[0050] As used herein, MTM and engineered MTM refers to any of the molecules described herein (or described in patents or patent application incorporated by reference) that can bind to a microbe or microbe component. The terms microbe-targeting molecule and microbe-binding molecule are used interchangeably herein.

MAMPs

[0051] Before discussing the MTMs of the invention, it will be helpful to understand the molecules to which the MTMs bind. As indicated above, each of the MTMs of the invention binds to at least one microbe-associated molecular pattern (MAMP). Some MTMs bind at least two, at least three, at least four, at least five, or more than five MA.MPs.

[0052] As used herein and throughout the specification, the term microbe-associated molecular patterns or MAMPs refers to molecules, components or motifs associated with or secreted or released by microbes or groups of microbes (whole and/or lysed and/or disrupted) that are generally recognized by corresponding pattern recognition receptors (PRRs) of the MTM microbe-binding domains defined herein. In some aspects, the MAMPs encompass molecules associated with cellular components released during cell damage or lysis. Examples of MAMPs include, but are not limited to, microbial carbohydrates (e.g., lipopolysaccharide or LPS, mannose), endotoxins, microbial nucleic acids (e.g., bacterial, fungal or viral DNA or RNA; e.g., nucleic acids comprising a CpG site), microbial peptides (e.g., flagellin), peptidoglycans, lipoteichoic acids, N-formylmethionine, lipoproteins, lipids, phospholipids or their precursors (e.g., phosphochloline), and fungal glucans.

[0053] In some aspects, microbe components comprise cell wall or membrane components known as pathogen-associated molecular patterns (PAMPs) including lipopolysaccharide (LPS) endotoxin, lipoteichoic acid, and attached or released outer membrane vesicles. In some aspects, a microbe comprises a host cell membrane and a pathogen component or a PAMP.

[0054] In some aspects, microbe components comprise damage-associated molecular patterns (DAMPs), also known as danger-associated molecular patterns, danger signals, and alarmin. These biomolecules can initiate and sustain a non-infectious inflammatory response in a subject, in contrast to PAMPs which initiate and sustain an infectious pathogen-induced inflammatory response. Upon release from damaged or dying cells, DAMPs activate the innate immune system through binding to pattern recognition receptors (PRRs). DAMPs include portions of nuclear and cytosolic proteins, ECM (extracellular matrix), mitochondria, granules, ER (endoplasmic reticulum), and plasma membrane.

[0055] In some aspects, MAMPs include carbohydrate recognition domain (CRD)-binding motifs. As used herein, the term carbohydrate recognition domain (CRD)-binding motifs refers to molecules or motifs that are bound by a molecule or composition comprising a CRD (i.e. CRDs recognize and bind to CRD-binding motifs). As used herein, the term carbohydrate recognition domain or CRD refers to one or more regions, at least a portion of which, can bind to carbohydrates on a surface of microbes or pathogens. In some aspects, the CRD can be derived from a lectin, as described herein. In some aspects, the CRD can be derived from a mannose-binding lectin (MBL). Accordingly, in some aspects, MAMPs are molecules, components or motifs associated with microbes or groups of microbes that are recognized by lectin-based MTMs (collectin-based MTMs) described herein that have a CRD domain. In one embodiment, MAMPs are molecules, components, or motifs associated with microbes or groups of microbes that are recognized by mannose-binding lectin (MBL).

[0056] In some aspects, MAMPs are molecules, components or motifs associated with microbes or groups of microbes that are recognized by a C-reactive protein (CRP)-based MTMs (collectin-based MTMs).

[0057] For clarity MAMPs as used herein includes microbe components such as MAMPs, PAMPs and DAMPs as defined above.

[0058] When necessary, and unless otherwise detectable without pre-treatment, MAMPs can be exposed, released or generated from microbes in a sample by various sample pretreatment methods. In some aspects, the MAMPs can be exposed, released or generated by lysing or killing at least a portion of the microbes in the sample. Without limitations, any means known or available to the practitioner for lysing or killing microbe cells can be used. Exemplary methods for lysing or killing the cells include, but are not limited to, physical, mechanical, chemical, radiation, biological, and the like. Accordingly, pre-treatment for lysing and/or killing the microbe cells can include application of one or more of ultrasound waves, vortexing, centrifugation, vibration, magnetic field, radiation (e.g., light, UV, Vis, IR, X-ray, and the like), change in temperature, flash-freezing, change in ionic strength, change in pH, incubation with chemicals (e.g. antimicrobial agents), enzymatic degradation, and the like.

Microbes

[0059] As used herein, the term microbe, and the plural microbes, generally refers to microorganism(s), including bacteria, virus, fungi, parasites, protozoan, archaea, protists, e.g., algae, and a combination thereof. The term microbe encompasses both live and dead microbes. The term microbe also includes pathogenic microbes or pathogens, e.g., bacteria causing diseases such as sepsis, plague, tuberculosis and anthrax; protozoa causing diseases such as malaria, sleeping sickness and toxoplasmosis; and fungi causing diseases such as ringworm, candidiasis or histoplasmosis.

[0060] In some aspects, the microbe is a human pathogen, in other words a microbe that causes at least one disease in a human.

[0061] In some aspects, the microbe is a Gram-positive bacterial species, a Gram-negative bacterial species, a mycobacterium, a fungus, a parasite, protozoa, or a virus. In some aspects, the Gram-positive bacterial species comprises bacteria from the class Bacilli. In some aspects, the Gram-negative bacterial species comprises bacteria from the class Gammaproteobacteria. In some aspects, the mycobacterium comprises bacteria from the class Actinobacteria. In some aspects, the fungus comprises fungus from the class Saccharomyces.

[0062] In some aspects, the microbe is Staphylococcus aureus, Streptococcus pyogenes, Klebsiella pneumoniae, Pseudomonas aeruginosa, Mycobacterium tuberculosis, Candida albicans, or Escherichia coli. In some aspects, the microbe is S. aureus strain 3518, S. pyogenes strain 011014, K. pneumoniae strain 631, E. coli strain 41949, P. aeruginosa strain 41504, C. albicans strain 1311, or M. tuberculosis strain H37Rv.

[0063] In some aspects, the microbe is Bartonella henselae, Borrelia burgdorferi, Campylobacter jejuni, Campylobacterfetus, Chlamydia trachomatis, Chlamydia pneumoniae, Chylamydia psittaci, Simkania negevensis, Escherichia coli (e.g., 0157:H7 and K88), Ehrlichia chafeensis, Clostridium botulinum, Clostridium perfringens, Clostridium tetani, Enterococcus faecalis, Haemophilus influenzae. Haemophilius ducreyi, Coccidioides immitis, Bordetella pertussis, Coxiella burnetii, Ureaplasma urealyticum, Mycoplasma genitalium, Trichomatis vaginalis, Helicobacter pylori, Helicobacter hepaticus, Legionella pneumophila, Mycobacterium tuberculosis, Mycobacterium bovis, Mycobacterium africanum, Mycobacterium leprae, Mycobacterium asiaticum, Mycobacterium avium, Mycobacterium celatum, Mycobacterium celonae, Mycobacterium fortuitum, Mycobacterium genavense, Mycobacterium haemophilu Mycobacterium intracellulare, Mycobacterium kansasii, Mycobacterium malmoense, Mycobacterium marinum, Mycobacterium scrofulaceum, Mycobacterium simiae, Mycobacterium szulgai, Mycobacterium ulcerans, Mycobacterium xenopi, Corynebacterium diptheriae, Rhodococcus equi, Rickettsia aeschlimannii, Rickettsia africae, Rickettsia conorii, Arcanobacterium haemolyticum, Bacillus anthracia, Bacillus cereus, Lysteria monocytogenes. Yersinia pestis, Yersinia enterocolitica, Shigella dysenteriae, Neisseria meningitides, Neisseria gonorrhoeae, Streptococcus bovis, Streptococcus hemolyticus, Streptococcus mutans, Streptococcus pyogenes, Streptococcus pneumoniae, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus pneumoniae, Staphylococcus saprophyticus, Vibrio cholerae, Vibrio parahaemolyticus, Salmonella typhi, Salmonella paratyphi, Salmonella enteritidis, Treponema pallidum, Human rhinovirus, Human coronavirus such as SARS-COV-2, Dengue virus, Filoviruses (e.g., Marburg and Ebola viruses), Hantavirus, Rift Valley virus, Hepatitis B, C, and E, Human Immunodeficiency Virus (e.g., HIV-1, HIV-2), HHV-8, Human papillomavirus, Herpes virus (e.g., HV-I and HV-II), Human T-cell lymphotrophic viruses (e.g., HTLV-I and HTLV-II), Bovine leukemia virus, Influenza virus, Guanarito virus, Lassa virus, Measles virus, Rubella virus, Mumps virus, Chickenpox (Varicella virus), Monkey pox, Epstein Bahr virus, Norwalk (and Norwalk-like) viruses, Rotavirus, Parvovirus B19, Hantaan virus, Sin Nombre virus, Venezuelan equine encephalitis, Sabia virus, West Nile virus, Yellow Fever virus, causative agents of transmissible spongiform encephalopathies, Creutzfeldt-Jakob disease agent, variant Creutzfeldt-Jakob disease agent, Candida, Cryptcooccus, Cryptosporidium, Giardia lamblia, Microsporidia, Plasmodium vivax, Pneumocystis carinii, Toxoplasma gondii, Trichophyton mentagrophytes, Enterocytozoon bieneusi, Cyclospora cayetanensis, Encephalitozoon hellem, or Encephalitozoon cuniculi, among other viruses, bacteria, archaea, protozoa, and fungi. In yet other aspects, the microbe is a bioterror agent (e.g., B. anthracis, and smallpox).

[0064] As used herein, microbe component and microbial component refer to any part of a microbe such as cell wall components, cell membrane components, cell envelope components, cytosolic components, intracellular components, nucleic acid (DNA or RNA), or organelles in the case of eukaryotic microbes. In some aspects, the microbial component comprises a component from a Gram-positive bacterial species, a Gram-negative bacterial species, a mycobacterium, a fungus, a parasite, a virus, or any microbe described herein or known in the art.

MTMs

[0065] As summarized above, the invention is directed to compositions and methods of using the compositions, where the compositions comprise MTMs that have the shared characteristic of binding to one or more MAMPs. The compositions of the invention can be used in the treatment and prevention of infectious diseases in a subject.

[0066] As will be apparent, while the MTMs of the invention include naturally-occurring molecules and proteins, the engineered MTMs of the invention are those have been manipulated in some manner by the hand of man. As used herein and throughout the specification, the term engineered MTM includes any non-naturally-occurring MTM. Engineered MTMs of the invention retain the binding specificity to a MAMP of the wild-type (i.e. naturally-occurring) molecule on which the engineered MTM is based.

[0067] The MTMs of the invention are defined based on their binding activity, therefore both naturally-occurring and engineered MTMs will comprise at least one microbe-binding domain, i.e. a domain that recognizes and binds to one or more MAMPs (including, at least two, at least three, at least four, at least five, or more) as described herein. A microbe-binding domain can be a naturally-occurring or a synthetic molecule. In some aspects, a microbe-binding domain can be a recombinant molecule.

[0068] Acceptable microbe-binding domains for use in the MTMs of the invention are limited only in their ability to recognize and bind at least one MAMP. In some aspects, the microbe-binding domain may comprise some or all of a peptide; polypeptide; protein; peptidomimetic; antibody; antibody fragment; antigen-binding fragment of an antibody; carbohydrate-binding protein; lectin; glycoprotein: glycoprotein-binding molecule; amino acid; carbohydrate (including mono-; di-; tri- and poly-saccharides); lipid; steroid; hormone; lipid-binding molecule; cofactor; nucleoside; nucleotide; nucleic acid; DNA; RNA; analogues and derivatives of nucleic acids; peptidoglycan; lipopolysaccharide; small molecule; endotoxin; bacterial lipopolysaccharide; and any combination thereof.

[0069] In particular aspects, the microbe-binding domain can be a microbe-binding domain of a lectin. An exemplary lectin is mannose binding lectin (MBL) or other mannose binding molecules. Non-limiting examples of acceptable microbe-binding domains also include microbe-binding domains from toll-like receptors, nucleotide oligomerization domain-containing (NOD) proteins, complement receptors, collectins, ficolins, pentraxins such as serum amyloid and C-reactive protein, lipid transferases, peptidoglycan recognition proteins (PGRs), and any combinations thereof. In some aspects, microbe-binding domains can be microbe-binding molecules described in the international patent application publication no. WO 2013/012924, the contents of which are incorporated by reference in their entirety.

[0070] The MTMs of the invention will typically have one or more domains in addition to a microbe-binding domain. Such domains include, but are not limited to, an oligomerization domain, a signal domain, an anchor domain, a collagen-like domain, a fibrinogen-like domain, an immunoglobulin domain, and an immunoglobulin-like domain.

[0071] Engineered MTMs of the invention include, but are not limited to, MTMs identical to a naturally-occurring MTM but having at least one amino acid change in comparison to the wild-type molecule on which they are based. Such sequence-variant engineered MTMs have at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity, though in all cases less than 100% sequence identity, to the wild-type molecule on which they are based. The changes may be any combination of additions, insertions, deletions and substitutions, where the altered amino acids may be naturally-occurring or non-naturally-occurring amino acids, and conservative or non-conservative changes.

[0072] Engineered MTMs of the invention also include, but are not limited to, MTMs that comprise domains from two or more different MTMs, i.e. fusion proteins. Such domain-variant engineered MTMs have domains from 2, 3, 4, 5 or more different proteins. For example, MTMs can be a fusion protein comprising a microbe-binding domain and an oligomerization domain, or a fusion protein comprising a microbe-binding domain and a signal domain, or a fusion protein comprising a microbe-binding domain, an oligomerization domain, and signal domain, to name a few examples. In each case, the domains within a domain-variant engineered MTM are from at least two different proteins. Other examples of such MTMs include fusion proteins comprising at least the microbe-binding domain of a lectin and at least a part of a second protein or peptide, e.g., but not limited, to an Fc portion of an immunoglobulin.

[0073] Engineered MTMs of the invention further include, but are not limited to, MTMs that comprise domains from two or more different MTMs, wherein at least one of the domains is a sequence variant of the wild-type domain upon which it is based, i.e. having at least one amino acid change in comparison to the wild-type molecule on which it is based. These sequence- and domain-variant engineered MTMs have domains from 2, 3, 4, 5 or more different proteins, and at least one of the domains has at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity, though in all cases less than 100% sequence identity, to the wild-type domain on which it is based. The changes may be any combination of additions, insertions, deletions and substitutions, where the altered amino acids may be naturally-occurring or non-naturally-occurring amino acids, and conservative or non-conservative changes.

[0074] As non-limiting examples of the MTMs used in the compositions and methods of the invention, three broad categories of suitable MTMs are defined in the following paragraphs, namely: (i) collectin-based MTMs, (ii) ficolin-based MTMs, and (iii) toll-like receptor-based MTMs. It should be understood that these three categories are not the only categories of MTMs encompassed by the invention.

Collectin-based MIMs

[0075] The MTMs of the invention include collectin-based MTMs. These MTMs are either naturally-occurring collectin proteins or engineered MTM fusion proteins that comprise at least one collectin microbe-binding domain, such as the lectin carbohydrate-recognition domain (CRD), and at least one additional domain

[0076] Collectins (collagen-containing C-type lectins) are a family of collagenous calcium-dependent lectins that function in defense, thus playing an important role in the innate immune system. They are soluble molecules comprising pattern recognition receptors (PRRs) within the microbe-binding domain that recognize and bind to particular oligosaccharide structures or lipids displayed on the surface of microbes, i.e. MAMPs of oligosaccharide origin. Upon binding of collectins to a microbe, clearance of the microbe is achieved via aggregation, complement activation, opsonization, and activation of phagocytosis.

[0077] Members of the family have a common structure, characterized by four parts or domains arranged in the following N- to C-terminal arrangement: (i) a cysteine-rich domain, (ii) a collagen-like domain, (iii) a coiled-coil neck domain, and (iv) a microbe-binding domain which includes a C-type lectin domain, also termed the carbohydrate recognition domain (CRD). The functional form of the molecule is a trimer made up of three identical chains. MAMP recognition is mediated by the CRD in presence of calcium. See FIG. 1.

[0078] There are currently nine recognized members of the family: (i) mannose-binding lectin (MBL; mannose-binding lectin; e.g. SEQ ID NO:1), (ii) surfactant protein A (SP-A; SEQ ID NO:13), (iii) surfactant protein D (SP-D; SEQ ID NO:14), (iv) collectin liver 1 (CL-L1; SEQ ID NO:15), (v) collectin placenta 1 (CL-P1; SEQ ID NO:16), (vi) conglutinin collectin of 43 kDa (CL-43; SEQ ID NO:17), (vii) collectin of 46 kDa (CL-46; SEQ ID NO:18), (viii) collectin kidney 1 (CL-K1; SEQ ID NO:19), and (ix) conglutinin (SEQ ID NO:20). Each of these proteins is an MTM of the invention.

TABLE-US-00001 MBL(Homosapiens;GenBank:AAH69338.1; SEQIDNO:1): MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSS PGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPG NPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLINGEIMTFEKVKALCVKFQA SVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTG NRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH LAVCEFPI SurfactantproteinA(SP-A;Homosapiens; GenBank:AAA36632.1;SEQIDNO:13): MTFKNNTTLSLFRLENSEPLHKGYITTRELHQLALANLIF MENCADLHFPPQMRKCFPIPGTSCLFCPKTKTLFPVLHLA NQYLCFLCQHKHCFPQTREPDSQPSQATSRCVLSIKFTSS IYINSHNYTLILTCIIVRVLCPPVGCKSYKDRGHIHLAHP SVPSTCHGSYQLTSTQYIVWISKYDSNFQHPKLVYSPTEP AQVEHMQCFLCMCLQREEREALLLLPRVTILTRLSAESTD ERDGDSEPVNAVCRTALAFVPHESNVMLGIHNLLIWLL SurfactantproteinD(SP-D;Homosapiens; GenBank:AAB59450.1;SEQIDNO:14): MLLELLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMC SSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQ AGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE GALGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARG LAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGP PGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQH LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLL CTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKT EGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW NDRACGEKRLVVCEF Collectinliver1(CL-L1;alsoknownas collectin-10;Homosapiens;NCBIReference Sequence:NP_006429.2;SEQIDNO:15): MNGFASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCA THTISPGPKGDDGEKGDPGEEGKHGKVGRMGPKGIKGELG DMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCD CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRETEEKFY YIVQEEKNYRESLTHCRIRGGMLAMPKDEAANTLIADYVA KSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPS DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK Collectinplacenta1(CL-P1;Homosapiens; GenBank:BAB72147.1;SEQIDNO:16): MKDDFAEEEEVQSEGYKRFGIQEGTQCTKCKNNWALKESI ILLYILCALLTITVAILGYKVVEKMDNVTGGMETSRQTYD DKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENN SFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN VVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANN DTLEDMNSQLNSFTGQMENITTISQANEQNLKDLQDLHKD AENRTAIKENQLEERFQLFETDIVNIISNISYTAHHLRTL TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLR MQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQLIKNFTI LQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGP AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQ GPSGDPGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVPG PRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSS HLVFINTREEQQWIKKQMVGRESHWIGLTDSERENEWKWL DGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF QCEDVNNFICEKDRETVLSSAL Conglutinincollectin(CL-43;Bostaurus; GenBank:AAI16148;SEQIDNO:17): MLPLPLSILLLLTQSQSFLGEEMDVYSEKTLTDPCTVVVC APPADSLRGHDGRDGKEGPQGEKGDPGPPGMPGPAGREGP SGRQGSMGPPGTPGPKGEPGPEGGVGAPGMPGSPGPTGLK GERGTPGPGGAIGPQGPSGAMGPPGLKGDRGDPGEKGAKG ETSVLEVDTLRQRMRNLEGEVQRLQNIVTQYRKAVLEPDG QAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAEN EAVTQLVRAKNKHAYLSMNDISKEGKFTYPTGGSLDYSNW APGEPNNRAKDEGPENCLEIYSDGNWNDIECREERLVICE F Collectinof46kDa(CL-46;Bostaurus; GenBank:AAM34742;SEQIDNO:18): MLLLPLSVLLLLTQPWRSLGAEMKIYSQKTLANGCTLVVC RPPEGGLPGRDGQDGREGPQGEKGDPGSPGPAGRAGRPGP AGPIGPKGDNGSAGEPGPKGDTGPPGPPGMPGPAGREGPS GKQGSMGPPGTPGPKGDTGPKGGMGAPGMQGSPGPAGLKG ERGAPGELGAPGSAGVAGPAGAIGPQGPSGARGPPGLKGD RGDPGERGAKGESGLADVNALKQRVTILEGQLQRLQNAFS RYKKAVLFPDGQAVGKKIFKTAGAVKSYSDAQQLCREAKG QLASPRSAAENEAVAQLVRAKNNDAFLSMNDISTEGKFTY PTGESLVYSNWASGEPNNNNAGQPENCVQIYREGKWNDVP CSEPLLVICEF Collectinkidney1(CL-K1;alsoknownas collectin-11;Homosapiens;GenBank: BAF43301.1;SEQIDNO:19): MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVP GLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVG RHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRK AIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEE KRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLAR VFIGINDLEKEGAFVYSDHSPMRTENKWRSGEPNNAYDEE DCVEMVASGGWNDVACHTTMYFMCEFDKENM Conglutinin(Bostaurus;GenBank:BAA04983; SEQIDNO:20): MLLLPLSVLLLLTQPWRSLGAEMTTFSQKILANACTLVMC SPLESGLPGHDGQDGRECPHGEKGDPGSPGPAGRAGRPGW VGPIGPKGDNGFVGEPGPKGDTGPRGPPGMPGPAGREGPS GKQGSMGPPGTPGPKGETGPKGGVGAPGIQGFPGPSGLKG EKGAPGETGAPGRAGVTGPSGAIGPQGPSGARGPPGLKGD RGDPGETGAKGESGLAEVNALKQRVTILDGHLRRFQNAFS QYKKAVLEPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKG QLASPRSSAENEAVTQMVRAQEKNAYLSMNDISTEGRFTY PTGEILVYSNWADGEPNNSDEGQPENCVEIFPDGKWNDVP CSKQLLVICEF

[0079] The MTMs of the invention also include other collectin-based molecules that bind to one or more MAMPs, e.g. those MTMs comprising at least a portion (e.g. domain) of a lectin-based molecule in the case of an engineered MTM. As used herein, the term collectin-based molecule refers to a molecule comprising a microbe-binding domain derived from a collectin, such as a lectin. The term lectin as used herein refers to any molecule including proteins, natural or genetically modified (e.g., recombinant), that interacts specifically with saccharides (e.g., carbohydrates). The term lectin as used herein can also refer to lectins derived from any species, including, but not limited to, plants, animals (e.g. mammals, such as human), insects and microorganisms, having a desired carbohydrate binding specificity. Examples of plant lectins include, but are not limited to, the Leguminosae lectin family, such as ConA, soybean agglutinin, peanut lectin, lentil lectin, and Galanthus nivalis agglutinin (GNA) from the Galanthus (snowdrop) plant. Other examples of plant lectins are the Gramineae and Solanaceae families of lectins. Examples of animal lectins include, but are not limited to, any known lectin of the major groups S-type lectins, C-type lectins, P-type lectins, and I-type lectins, and galectins. In some aspects, the carbohydrate recognition domain can be derived from a C-type lectin, or a fragment thereof. C-type lectin can include any carbohydrate-binding protein that requires calcium for binding (e.g., MBL). In some aspects, the C-type lectin can include, but are not limited to, collectin, DC-SIGN, and fragments thereof. Without wishing to be bound by theory, DC-SIGN can generally bind various microbes by recognizing high-mannose-containing glycoproteins on their envelopes and/or function as a receptor for several viruses such as HIV and Hepatitis C.

[0080] Collectin-based engineered MTMs of the invention are MTMs that comprise at least a microbe-binding domain of a collectin. These MTMs may also include one or more of the other domains of a collectin, e.g. a cysteine-rich domain, a collagen-like domain, and/or a coiled-coil neck domain, as well as one or more domains not typically found in a collectin, such as an oligomerization domain, a signal domain, an anchor domain, a collagen-like domain, a fibrinogen-like domain, an immunoglobulin domain, and/or an immunoglobulin-like domain. When a collectin-based engineered MTM has each of the domains of a wild-type collectin, the MTM will be a sequence-variant engineered MTM as defined above. When a collectin-based engineered MTM has fewer that all of the domains of a wild-type collectin, the MTM will be a domain-variant engineered MTM or a sequence- and domain-variant engineered MTM as defined above.

[0081] Collectin-based engineered MTMs comprise a microbe-binding domain derived from at least one carbohydrate-binding protein selected from the group consisting of: MBL; SP-A; SP-D; CL-L1, CL-P1; CL-34; CL-46; CL-K1, conglutinin; maltose-binding protein; arabinose-binding protein; glucose-binding protein; Galanthus nivalis agglutinin; peanut lectin; lentil lectin; DC-SIGN; and C-reactive protein; and any combinations thereof.

MBL

[0082] In particular aspects and embodiments of the invention, the MTM may be MBL, whether full-length human MBL (SEQ ID NO:1), mature human MBL without the signal sequence (e.g. SEQ ID NO:2), a truncated human MBL that retains microbe surface-binding (e.g. SEQ ID NO:3), the carbohydrate recognition domain (CRD) of human MBL (e.g. SEQ ID NO:4), or the neck and carbohydrate recognition domain of human MBL (e.g. SEQ ID NO:5), whether used alone or in combination with a second protein in the form of a fusion protein, such as a FcMBL protein as defined herein.

TABLE-US-00002 Theaminoacidsequenceoffull- lengthhumanMBL(SEQIDNO:1; GenBank:AAH69338.1)is: MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSS PGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPG NPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLINGEIMTFEKVKALCVKFQA SVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTG NRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH LAVCEFPI Theaminoacidsequenceofmature humanMBLwithoutthesignal sequenceis: (SEQIDNO:2) ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG EPGOGLRGLQGPPGKLGPPGNPGPSGSPGPKGOKGDPGKS PDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL INGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE EAFLGITDEKTEGOFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPI Theaminoacidsequenceofatruncated MBLthatretainsmicrobesurface- bindingis: (SEQIDNO:3) AASERKALQTEMARIKKWLTFSLGKQVGNKFFLINGEIMT FEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGIT DEKTEGQFVDLIGNRLTYTNWNEGEPNNAGSDEDCVLLLK NGQWNDVPCSTSHLAVCEFPI Theaminoacidsequenceofthe carbohydraterecognitiondomain (CRD)ofhumanMBLis: (SEQIDNO:4) VGNKFFLINGEIMTFEKVKALCVKFQASVATPRNAAENGA IQNLIKEEAFLGITDEKTEGQFVDLIGNRLTYTNWNEGEP NNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI Theaminoacidsequenceoftheneck andcarbohydraterecognitiondomain ofMBLis: (SEQIDNO:5) PDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPI

[0083] The truncated forms of the naturally-occurring protein include portions of any one of SEQ ID NOs:1-5 lacking 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80 or more amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0084] Alternatively, the truncated forms of the naturally-occurring protein of any one of SEQ ID NOs:1-5 have a deletion of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50% of the amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0085] As to particularly useful truncated forms of the protein, one example is the full-length amino acid sequence of the carbohydrate recognition domain (CRD) of MBL, shown in SEQ ID NO:4. In addition, suitable CRDs include CRDs having an amino acid sequence of about 10 to about 110 amino acid residues, or about 50 to about 100 amino acid residues, of SEQ ID NO:4. In some aspects, the microbe-binding domain can have an amino acid sequence of at least about 5, at least about 10, at least about 15, at least about 20, at least about 30, at least about 40, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, at least about 100, at least about 110 amino acid residues or more, of SEQ ID NO:4. Accordingly, in some aspects, the carbohydrate recognition domain of an engineered MBL protein can comprise SEQ ID NO:4. In some aspects, the carbohydrate recognition domain of an engineered MBL protein can comprise a fragment of SEQ ID NO:4 as defined above. Also, exemplary amino acid sequences of such fragments include, but are not limited to, ND, EZN (where Z is any amino acid, e.g., P), NEGEPNNAGS (SEQ ID NO:10) or a fragment thereof comprising EPN, GSDEDCVLL or a fragment thereof comprising E, and LLLKNGQWNDVPCST (SEQ ID NO:11) or a fragment thereof comprising ND. Modifications to such CRD fragments, e.g., by conservative substitution (i.e., where an amino acid is replace by an amino acid within the same class of amino acids, where the classes are: aliphatic amino acids (G, A, L, V, I); hydroxyl or sulfur/selenium-containing amino acids (S, C, U. T, M); aromatic amino acids (F, Y, W); basic amino acids (H, K, R); and acidic amino acids (D, E, N, Q)), are also within the scope described herein. In some aspects, the MBL or a fragment thereof used in the microbe surface-binding domain of the engineered MBLs described herein can be a wild-type molecule or a recombinant molecule.

[0086] The sequence variants of the naturally-occurring protein and the truncated forms thereof (e.g. SEQ ID NOs:1-5) include proteins having at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity to any one of SEQ ID NOs:1-5, or truncated forms thereof, that retain the ability to reduce platelet activation in blood of the protein upon which they are based.

Engineered MTM Comprising MBL

[0087] In other particular aspects and embodiments of the invention, the MTM is an engineered MTM comprising MBL, as defined above, and a second protein in the form of a fusion protein. An exemplary fusion protein comprises some or all of naturally-occurring MBL, such as the carbohydrate recognition domain (CRD) of MBL, and a portion of an immunoglobulin, such as the Fc domain. In use, the Fc domain dimerizes and strengthens the avidity and affinity of the binding by MBLs to monomeric sugars. In some aspects, the N-terminus of fusion proteins can further comprise an oligopeptide linker adapted to bind a solid substrate and orient the CRD of the MBL domain away from a substrate to which it is immobilized. As discussed above, engineered forms of MBLs are known in the art and include each of the forms of MBL disclosed in U.S. Pat. No. 9,150,631, U.S. Patent Pub. 2016/0311877, U.S. Patent Pub. 2019/0077850, U.S. Pat. No. 9,593,160, U.S. Pat. No. 10,435,457, U.S. Patent Pub. 2015/0173883 and International Application Publication No. WO 2011/090954, the entire disclosures of which are hereby incorporated by reference in their entirety.

[0088] FcMBL is a specific engineered form of MBL of the invention that comprises the neck and CRD domains of MBL linked to an IgG Fc domain. Proline 81 of mature MBL (SEQ ID NO:2) is a convenient N-terminal point at which to begin the sequence of this engineered construct. For example, the neck and CRD domains (SEQ ID NO:5) of MBL are fused downstream (C-terminal) to the Fc domain of human IgG (Fc?). The Fc domain may include the CH2-CH3 interface of the IgG Fc domain, which contains the binding sites for a number of Fc receptors including Staphylococcal protein A. In use, the Fc domain dimerizes and strengthens the avidity and affinity of the binding by MBLs to monomeric sugars. FcMBL is described in detail in U.S. Pat. No. 9,150,631, the entire disclosure of which is hereby incorporated by reference in its entirety.

[0089] Specific examples of FcMBLs that may be used in each of the aspects and embodiments of the invention include, but are not limited to, proteins where the neck and CRD domains of MBL are linked to an Fc component of human IgG1, with examples of the resulting constructs set forth in SEQ ID NOs:6, 7 and 9, and proteins where the CRD domain alone of MBL is linked to an Fc component of human IgG1, with an example of the resulting construct set forth in SEQ ID NO:8.

TABLE-US-00003 FcMBL.81(SEQIDNO:6): EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGAPDGDSSLA ASERKALQTEMARIKKWLTFSLGKQVGNKFFLINGEINIT FEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGIT DEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLK NGQWNDVPCSTSHLAVCEFPI AKT-FcMBL(SEQIDNO:7): AKTEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKENWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGAPDGDS SLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLINGEI MTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLG ITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLL LKNGQWNDVPCSTSHLAVCEFPI FcMBL.111(SEQIDNO:8): EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGATSKQVGNK FFLINGEEVITFEKVKALCVKFQASVATPRNAAENGAIQN LIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNA GSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI FcMBL(SEQIDNO:9): AKTEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKENWYVDGVEVHNAKIKPR EEQYDSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTIPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGAPDGDS SLAASERKALQTEMARIKKWLTESLGKQVGNKFFLINGEI MTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLG ITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLL LKNGQWNDVPCSTSHLAVCEFPI

[0090] In SEQ ID NO:9, the residues with a single underscore correspond to the Fc portion, the residues with a double underscore correspond to the MBL neck, and those residues without underscore correspond to the MBL carbohydrate-binding domain.

[0091] Various genetically engineered versions of the MTM (e.g., FcMBL) are described in International Application Pub. Nos. WO 2011/090954 and WO 2013/012924, as well as U.S. Pat. Nos. 9,150,631 and 9,593,160, the contents of each of which are incorporated herein by reference in their entireties. Lectins and other mannose binding molecules are also described in, for example, U.S. Pat. Nos. 9,150,631 and 9,632,085, and PCT application publication nos. WO/2011/090954, WO2013012924 and WO/2013/130875, the contents of all of which are incorporated herein by reference in their entireties.

[0092] In aspects where the MTM is FcMBL, the Fc region or a fragment thereof can comprise at least one mutation, e.g., to modify the performance of the engineered MBL. For example, in some aspects, the half-life of the engineered MBL described herein can be increased, e.g., by mutating the lysine (K) at the residue 232 to alanine (A) as shown in the Fc domain sequence provided in SEQ ID NO:12. Other mutations, e.g., located at the interface between the CH2 and CH3 domains shown in Hinton et al (2004) J Biol Chem. 279:6213-6216 and Vaccaro C. et al. (2005) Nat Biotechnol. 23: 1283-1288, can be also used to increase the half-life of the IgG1 and thus the engineered MBL.

TABLE-US-00004 SEQIDNO:12: EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGA

[0093] In some aspects and embodiments, the FcMBL of the invention comprises or consists of an amino acid sequence having at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity to any one of SEQ ID NOs:6-9, that retain the active of protein upon which they are based.

[0094] The exemplary MBL sequences provided herein are not construed to be limiting. For example, while the exemplary sequences provided herein are derived from a human species, amino acid sequences of the same carbohydrate recognition domain in plants and other animal species such as mice, rats, porcine, bovine, feline, and canine are known in the art and within the scope described herein.

Other Collectins

[0095] In addition to the aspects and embodiments of the invention defined above that comprise the collectin MBL (whether naturally-occurring or engineered), the present invention encompasses use of any other collectin in an MTM that binds MAMPs, when used in conjunction with the methods and compositions of the invention. Thus, any of the following additional collectins may also be used in the aspects and embodiments of the invention as defined herein: (i) surfactant protein A (SP-A; SEQ ID NO:13), (ii) surfactant protein D (SP-D; SEQ ID NO:14), (iii) collectin liver 1 (CL-L1; SEQ ID NO:15), (iv) collectin placenta 1 (CL-P1; SEQ ID NO:16), (v) conglutinin collectin of 43 kDa (CL-43; SEQ ID NO:17), (vi) collectin of 46 kDa (CL-46; SEQ ID NO:18), (vii) collectin kidney 1 (CL-K1; SEQ ID NO:19), and (viii) conglutinin (SEQ ID NO:20).

[0096] As with MBL, both naturally-occurring collectins and engineered forms of the proteins may be used in the invention. Engineered forms of the proteins include, but are not limited to, truncated forms of the naturally-occurring proteins, sequence variants of the naturally-occurring proteins, sequence variants of the truncated forms of the proteins, fusion proteins comprising the naturally-occurring protein, fusion proteins comprising the truncated forms of the proteins, and fusion proteins comprising the sequence variants.

[0097] The truncated forms of the naturally-occurring collectins include portions of any one of SEQ ID NOs:13-20 lacking 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80 or more amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0098] Alternatively, the truncated forms of the naturally-occurring protein of any one of SEQ ID NOs:13-20 have a deletion of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50% of the amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0099] The sequence variants of the naturally-occurring protein and the truncated forms thereof (e.g. SEQ ID NOs:13-20) include proteins having at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity to any one of SEQ ID NOs: 13-20, or truncated forms thereof, that retain the activity of the protein upon which they are based.

Ficolin-based MTMs

[0100] Ficolins are a family of lectins that activate the lectin pathway of complement activation upon binding to a pathogen. Ficolins are soluble molecules comprising pattern recognition receptors (PRRs) within a microbe-binding domain that recognize and selectively bind acetylated compounds, typically N-acetylglucosamine (GlcNAc), produced by pathogens. The lectin pathway is activated by binding of a ficolin to an acetylated compound on the pathogen surface, which activates the serine proteases MASP-1 and MASP-2, which then cleave C4 into C4a and C4b, and cleave C2 into C2a and C2b. C4b and C2b then bind together to form C3-convertase of the classical pathway, leading to the eventual lysis of the target cell via the remainder of the steps in the classical pathway.

[0101] Members of the family have a common structure, characterized by three parts or domains arranged in the following N- to C-terminal arrangement: (i) a short N-terminal domain, (ii) a collagen-like domain, and (iii) a fibrinogen-like domain that makes up the microbe-binding domain. The functional form of the molecule is a trimer made up of three identical chains. See FIG. 1.

[0102] There are currently three recognized members of the family: ficolin 1 (M-ficolin), ficolin 2 (L-ficolin), and ficolin 3 (H-ficolin). Each of these proteins is an MTM of the invention. The amino acid sequences of the human forms of the proteins are provided in the following paragraphs, with the fibrinogen-like domain underlined:

TABLE-US-00005 Ficolin1precursor-NP_001994.2- Homosapiens SEQIDNO:21 MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVG LEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGA PGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD LLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQR RMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQG SSELRVDLVDFEGNHQFAKYKSEKVADEAEKYKLVLGAFV GGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWY ADCHASNINGLYLMGPHESYANGINWSAAKGYKYSYKVSE MKVRPA Ficolin2isoformaprecursor- NP_004099.2-Homosapiens SEQIDNO:22 MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGL EGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPP GKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHELSGWHT IYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWA TYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFED NYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNN QSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYL RGTHGSFANGINWKSGKGYN Ficolin3isoform1precursor- NP_003656.2-Homosapiens SEQIDNO:23 MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKV VLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDP VNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF CDMDTEGGGWLVFQRRQDGSVDFERSWSSYRAGFGNQESE FWLGNENLHQLTLQGNWELRVELEDENGNRTFAHYATERL LGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDS SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGID WASGRGVGHPYRRVRMMLR

[0103] As with the collectins, both naturally-occurring ficolins and engineered forms of the proteins may be used in the invention. Engineered forms of the proteins include, but are not limited to, truncated forms of the naturally-occurring proteins, sequence variants of the naturally-occurring proteins, sequence variants of the truncated forms of the proteins, fusion proteins comprising the naturally-occurring protein, fusion proteins comprising the truncated forms of the proteins, and fusion proteins comprising the sequence variants.

[0104] The truncated forms of the naturally-occurring ficolins include portions of any one of SEQ ID NOs:21-23 lacking 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80 or more amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0105] Alternatively, the truncated forms of the naturally-occurring protein of any one of SEQ ID NOs:21-23 have a deletion of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50% of the amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0106] The sequence variants of the naturally-occurring protein and the truncated forms thereof (e.g. SEQ ID NOs:21-23) include proteins having at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity to any one of SEQ ID NOs:21-23, or truncated forms thereof that retain the activity of the protein upon which they are based.

[0107] The MTMs of the invention also include other ficolin-based molecules that bind to one or more MAMPs (acetylated compounds for the ficolins), e.g. those MTMs comprising at least a portion (e.g. domain) of a ficolin-based molecule in the case of an engineered MTM. As used herein, the term ficolin-based molecule refers to a molecule comprising a microbe-binding domain derived from a ficolin. The term ficolin as used herein refers to any molecule including proteins, natural or genetically modified (e.g., recombinant), that interacts specifically with acetylated compounds (e.g., GlcNAc). The term ficolin as used herein can also refer to ficolins derived from any species, including, but not limited to, plants, animals (e.g. mammals, such as human), insects and microorganisms, having the desired binding specificity.

[0108] Ficolin-based engineered MTMs of the invention are MTMs that comprise at least a microbe-binding domain of a ficolin, e.g. the fibrinogen-like domain of a ficolin. These MTMs may also include one or more of the other domains of a ficolin, e.g. a short N-terminal domain and/or a collagen-like domain, as well as one or more domains not typically found in a ficolin, such as a collectin cysteine-rich domain, a collectin collagen-like domain, a collectin coiled-coil neck domain, a TLR transmembrane helix, a TLR C-terminal cytoplasmic signaling domain, an oligomerization domain, a signal domain, an anchor domain, a collagen-like domain, a fibrinogen-like domain, an immunoglobulin domain, and an immunoglobulin-like domain. When a ficolin-based engineered MTM has each of the domains of a wild-type ficolin, the MTM will be a sequence-variant engineered MTM as defined above. When a ficolin-based engineered MTM has fewer that all of the domains of a wild-type ficolin, the MTM will be a domain-variant engineered MTM or a sequence- and domain-variant engineered MTM as defined above.

[0109] Ficolin-based engineered MTMs comprise a microbe-binding domain comprising at least one fibrinogen-like domain of a ficolin selected from the group consisting of ficolin 1, ficolin 2, and ficolin 3.

[0110] In certain aspects, the at least one additional domain is an immunoglobulin domain. For example, the immunoglobulin domain may comprise the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

[0111] In some aspects, the MITMs and engineered MTMs of the invention comprise a microbe-binding domain comprising the fibrinogen-like domain of ficolin 1 of SEQ ID NO:21, optionally with an immunoglobulin domain of SEQ ID NO:12. In other aspects, the MTMs and engineered MTMs of the invention comprise a microbe-binding domain comprising the fibrinogen-like domain of ficolin 2 of SEQ ID NO:22, optionally with an immunoglobulin domain of SEQ ID NO:12. In further aspects, the MTMs and engineered MTMs of a microbe-binding domain comprising the fibrinogen-like domain of ficolin 3 of SEQ ID NO:23, optionally with an immunoglobulin domain of SEQ ID NO:12.

[0112] In some aspects, the engineered MTMs of the invention comprise an microbe-binding domain having an amino acid sequence selected from SEQ ID NO:21-SEQ ID NO:23, or an amino acid sequence that is at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to any one of SEQ ID NO:21-SEQ ID NO:23, but less than 100% identical, and that retains the microbe-binding activity of the wild-type protein.

[0113] In some aspects, the ficolin-based engineered MTMs comprise a ficolin microbe-binding domain comprising the fibrinogen-like domain of any one of SEQ ID NOs:21, 22 and 23 or a sequence variant thereof having at least 85% sequence identity to any one of SEQ ID NOs:21, 22 and 23 and an immunoglobulin domain comprising the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

[0114] In some aspects, the microbe-binding domain comprising a fibrinogen-like domain of a ficolin from a primate, mouse, rat, hamster, rabbit, or any other species as described herein.

[0115] The exemplary sequences provided herein for the ficolins are not to be construed as limiting. For example, while the exemplary sequences provided herein are derived from a human, amino acid sequences of ficolins from other species such as mice, rats, porcine, bovine, feline, and canine are known in the art and within the scope described herein.

Toll-like Receptor-based MIMs

[0116] Toll-like receptors (TLRs) comprise a family of proteins that are integral to the proper functioning of the innate immune system. The proteins are type I integral membrane proteins (i.e. single-pass, membrane-spanning receptors) that are typically found on the surface of sentinel cells, such as macrophages and dendritic cells, but can also be found on the surface of other leukocytes including natural killer cells, T cells and B cells, and non-immune cells including epithelial cell, endothelial cells, and fibroblasts. After microbes have gained entry to a subject, such as a human, through the skin or mucosa, they are recognized by TLR-expressing cells, which leads to innate immune responses and the development of antigen-specific acquired immunity. TLRs thus recognize MAMPs by microbes.

[0117] Members of the family have a common structure, characterized by three parts or domains arranged in the following N- to C-terminal arrangement: (i) an N-terminal ligand-binding domain, i.e. the microbe-binding domain, (ii) a single transmembrane helix (? 20 amino acids), and (iii) a C-terminal cytoplasmic signaling domain.

[0118] The ligand-binding domain is a glycoprotein comprising 550-800 amino acid residues (depending on the identity of the TLR), constructed of tandem copies of leucine-rich repeats (LRR), which are typically 22-29 residues in length and that contains hydrophobic residues spaced at distinctive intervals. The receptors share a common structural framework in their extracellular, ligand-binding domains. The domains each adopt a horseshoe-shaped structure formed by the leucine-rich repeat motifs.

[0119] The functional form of a TLR is a dimer, with both homodimers and heterodimers being known. In the case of heterodimers, the different TLRs in the dimer may have different ligand specificities. Upon ligand binding, TLRs dimerize their ectodomains via their lateral faces, forming m-shaped structures. Dimerization leads to downstream signaling.

[0120] A set of endosomal TLRs comprising TLR3, TLR7, TLR8 and TLR9 recognize nucleic acids derived from viruses as well as endogenous nucleic acids in context of pathogenic events. Activation of these receptor leads to production of inflammatory cytokines as well as type I interferons (interferon type I) to help fight viral infection.

[0121] There are a number of recognized human members of the family, including TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, and TLR10. Each of these proteins may be used as an MTM of the invention. The amino acid sequences of the human forms of the proteins are provided in the following paragraphs, with the extracellular domain that comprises the N-terminal ligand-binding domain underlined:

TABLE-US-00006 TLR1(toll-likereceptor1precursor)-NCBIReference Sequence:NP003254.2 (SEQIDNO:24) MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL WTSDILSLSKLRILIISHNRIQYLDISVEKFNQELEYLDLSHNKLVKISCHPTVNLKHLD LSENAFDALPICKEFGNMSQLKELGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED PEGLQDENTESLHIVEPINKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDERDEDYSGTSLK ALSIHQVVSDVEGEPQSYIYEIESNMNIKNFTVSGTRMVHMLCPSKISPFLHLDESNNLL TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAENSL TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL TEQAKK TLR2(toll-likereceptor2precursor)-NCBIReference Sequence:NP_001305722.1 (SEQIDNO:25) MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSESSLGSLEHLDLSYNYLSNLSSSWF KPLSSLTELNLLGNPYKTLGETSLESHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTEHES ELSTGETNSLIKKETERNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVELVPCLLSQHLK SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLESLNLPQLK ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALEL LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV QELENENPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDES HERLEDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGEWVNLRA AIKS TLR3(toll-likereceptor3precursor)-NCBIReference Sequence:NP_003256.1 (SEQIDNO:26) NQLRRLPAANFTRYSQLTSLDVGENTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLEGLELNNVQLGPSLTEK LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL EYFFLEYNNIQHLESHSLHGLENVRYLNLKRSFTKQSISLASLPKIDDESFQWLKCLEHL NMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN NLARLWKHANPGGPIYFLKGLSHLHILNLESNGEDEIPVEVEKDLFELKIIDLGLNNLNT LPASVENNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRENPEDCTCESIAWFVNW INETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV LLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKE DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK NSVH TLR4(toll-likereceptor4isoformD)-NCBIReference Sequence:NP_612567.1 (SEQIDNO:27) MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSEKLPEYESNLTNLEHL DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNEDSL NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKEDKSALEGLCNLTIEEFRLAYLDYYLDDI IDLFNCLTNVSSESLVSVTIERVKDESYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDEGTTSLKYLDLSENGVITMSSNELG LEQLEHLDFQHSNLKQMSEFSVELSLRNLIYLDISHTHTRVAENGIENGLSSLEVLKMAG NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTEPY KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA NIIHEGEHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI TLR5(toll-likereceptor5precursor)-NCBIReference Sequence:NP_003259.2 (SEQIDNO:28) MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSENYIRT VTASSEPFLEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLEH LFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSEGKLNSLKSIDESSN QIFLVCEHELEPLQGKTLSFESLAANSLYSRVSVDWGKCMNPERNMVLEILDVSGNGWTV DITGNESNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFV FSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLIGELYSSNFYGLP KVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK INLTANLIHLSENRLENLDILYELLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLEL GENMLQLAWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVESHLTALRGLSLNSNRLTV LSHNDLPANLEILDISRNQLLAPNPDVEVSLSVLDITHNKFICECELSTEINWLNHTNVT IAGPPADIYCVYPDSESGVSLESLSTEGCDEEEVLKSLKFSLFIVCTVTLTLELMTILTV TKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFSSKDETWVQNALLKHLDTQYS DQNRENLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHELRDGWCLEAFSYAQGRCL SDLNSALIMVVVGSLSQYQLMKHQSIRGEVQKQQYLRWPEDLQDVGWELHKLSQQILKKE KEKKKDNNIPLQTVATIS TLR6(toll-likereceptor6precursor)-NCBIReference Sequence:NP_006059.2 (SEQIDNO:29) MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS QNYIAELQVSDMSELSELTVLRLSHNRIQLLDLSVEKENQDLEYLDLSHNQLQKISCHPI VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK FLSELTRGSTLLNETLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDETYS KTTLKALTIEHITNQVFLFSQTALYTVESEMNIMMLTISDTPFIHMLCPHAPSTEKELNE TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH KENCTWVESIVVLNLSSNMLTDSVERCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV AFNSLTDLPGCGSESSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL VPYLEKEDIQICLHERNEVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLEWANIRAA FNMKLTLVTENNDVKS TLR7(toll-likereceptor7precursor)-NCBIReference Sequence:NP_057646.1 (SEQIDNO:30) GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDERCNCVPIPLGSKNNMCIKRLQIKP RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI QEDDENNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHELPSLIQLDLSENFELQVYRASM NLSQAFSSLKSLKILRIRGYVFKELKSENLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCREKNK EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP LAELRYLDESNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLEKNLLKLEELDISKN SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL ILFSLSISVSLELMVMMTASHLYFWDVWYIYHECKAKIKGYQRLISPDCCYDAFIVYDTK DPAVTEWVLAELVAKLEDPREKHENLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ AHPYFWQCLKNALATDNHVAYSQVEKETV TLR8(toll-likereceptor8isoform1)-UniProtKB/ Swiss-Prot:Q9NR97.1 (SEQIDNO:31) MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLELSNTQIKYISEE DEKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNESNL EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEEDPHSNFYHFTRPLIKPQCA AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLINN RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT DKYNLESKSLVELVESGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL NLPASLTELHINDNMLKEENWILLQQFPRLELLDLRGNKLLELTDSLSDFTSSLRTLLLS HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI GDERRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLEWQTLRN VVLTENDSRYNNMYVDSIKQY TLR9(toll-likereceptor9precursor)-NCBIReference Sequence:NP_059138.1 (SEQIDNO:32) MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHESMAA PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTEL AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLEMDGNCYY KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDERPNCSTLNETLDLS RNNLVTVQPEMFAQLSHLQCLRISHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS FTELPRLEALDLSYNSQPFGMQGVGHNESFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL RALDESGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL RDNYLAFFKWWSLHELPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISEVAPGE FSKAKELRELNLSANALKTVDHSWEGPLASALQILDVSANPLHCACGAAFMDELLEVQAA VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVEDKTQSAVADWVYNELRGQLEECRG RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLEVLAHTDRVSGLLRASFLLAQQRLLE DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHE YNRNFCQGPTAE TLR10(toll-likereceptor10isoforma)-NCBIReference Sequence:NP001017388.1 (SEQIDNO:33) FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEENKELRYLDLSNNRLKSVTWYLLAGLR YLDLSENDEDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVELGERTLPHY EEGSLPILNTTKLHIVLPMDTNEWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR TIKLEHVHERVEYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP ETVVNMNLSYNKLSDSVERCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNELTD LPGCSHESRLSVLNIEMNFILSPSLDEVQSCQEVKTLNAGRNPERCTCELKNFIQLETYS EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLEWANLRAAINVNVL ATREMYELQTFTELNEESRGSTISLMRTDCL

[0122] As with the collectins, both naturally-occurring TLR and engineered forms of the proteins may be used in the invention. Engineered forms of the proteins include, but are not limited to, truncated forms of the naturally-occurring proteins, sequence variants of the naturally-occurring proteins, sequence variants of the truncated forms of the proteins, fusion proteins comprising the naturally-occurring protein, fusion proteins comprising the truncated forms of the proteins, and fusion proteins comprising the sequence variants.

[0123] The truncated forms of the naturally-occurring TLRs include portions of any one of SEQ ID NOs:24-33 lacking 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80 or more amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0124] Alternatively, the truncated forms of the naturally-occurring protein of any one of SEQ ID NOs:24-33 have a deletion of at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50% of the amino acids from the amino-terminus of the protein, or the carboxy-terminus of the protein, or internally within the protein, or any combination thereof.

[0125] The sequence variants of the naturally-occurring protein and the truncated forms thereof (e.g. SEQ ID NOs:24-33) include proteins having at least 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity to any one of SEQ ID NOs:24-33, or truncated forms thereof that retain the activity of the protein upon which they are based.

[0126] The MTMs of the invention also include other TLR-based molecules that bind to one or more MAMPs, e.g. those MTMs comprising at least a portion (e.g. domain) of a TLR-based molecule in the case of an engineered MTM. As used herein, the term TLR-based molecule refers to a molecule comprising a microbe-binding domain (i.e. an N-terminal ligand-binding domain) derived from a TLR. The term TLR as used herein refers to any molecule including proteins, natural or genetically modified (e.g., recombinant), that interacts specifically with an MAMP and that has a Toll IL-1 receptor (TIR) domain in their signaling domain. The term TLR as used herein can also refer to TLR derived from any species, including, but not limited to, plants, animals (e.g. mammals, such as human), insects and microorganisms, having the desired binding specificity.

[0127] TLR-based engineered MTMs of the invention are MTMs that comprise at least a microbe-binding domain of a TLR, e.g. the N-terminal ligand-binding domain of a TLR. These MTMs may also include one or more of the other domains of a TLR, e.g. a transmembrane helix and/or a C-terminal cytoplasmic signaling domain, as well as one or more domains not typically found in a TLR, such as a ficolin short N-terminal domain, a ficolin collagen-like domain, a collectin cysteine-rich domain, a collectin collagen-like domain, a collectin coiled-coil neck domain, an oligomerization domain, a signal domain, an anchor domain, a collagen-like domain, a fibrinogen-like domain, an immunoglobulin domain, and an immunoglobulin-like domain. When a TLR-based engineered MTM has each of the domains of a wild-type TLR, the MTM will be a sequence-variant engineered MTM as defined above. When a TLR-based engineered MTM has fewer that all of the domains of a wild-type TLR, the MTM will be a domain-variant engineered MTM or a sequence- and domain-variant engineered MTM as defined above.

[0128] TLR-based engineered MTMs comprise a microbe-binding domain comprising at least one N-terminal ligand-binding domain of a TLR selected from the group consisting of TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, and TLR10.

[0129] In certain aspects of this embodiment, the at least one additional domain is an immunoglobulin domain. For example, the immunoglobulin domain may comprise the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

[0130] In some aspects, the MITMs and engineered MTMs of the invention comprise a microbe-binding domain comprising the N-terminal ligand-binding domain of TLRI of SEQ ID NO:24, or the N-terminal ligand-binding domain of TLR2 of SEQ ID NO:25, or the N-terminal ligand-binding domain of TLR3 of SEQ ID NO:26, or the N-terminal ligand-binding domain of TLR4 of SEQ ID NO:27, or the N-terminal ligand-binding domain of TLR5 of SEQ ID NO:28, or the N-terminal ligand-binding domain of TLR6 of SEQ ID NO:29, or the N-terminal ligand-binding domain of TLR7 of SEQ ID NO:30, or the N-terminal ligand-binding domain of TLR8 of SEQ ID NO:31, or the N-terminal ligand-binding domain of TLR9 of SEQ ID NO:32, or the N-terminal ligand-binding domain of TLR10 of SEQ ID NO:33. In each of these examples, MTMs and engineered MTMs may further comprise an immunoglobulin domain of SEQ ID NO:12.

[0131] In some aspects, the engineered MTMs of the invention comprise an microbe-binding domain having an amino acid sequence selected from SEQ ID NO:24-SEQ ID NO:33, or an amino acid sequence that is at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to any one of SEQ ID NO:24-SEQ ID NO:33, but less than 100% identical, and that retains the microbe-binding activity of the wild-type protein.

[0132] In certain aspects of this embodiment, the TLR-based engineered MTMs comprise a TLR microbe-binding domain comprising the N-terminal ligand-binding domain of any one of SEQ ID NOs:24-33 or a sequence variant thereof having at least 85% sequence identity to any one of SEQ ID NOs:24-33 and an immunoglobulin domain comprising the amino acid sequence of SEQ ID NO:12 or a sequence variant thereof having at least 85% sequence identity to SEQ ID NO:12.

[0133] In some aspects, the microbe-binding domain comprising a N-terminal ligand-binding domain of a TLR from a primate, mouse, rat, hamster, rabbit, or any other subject as described herein.

[0134] The exemplary sequences provided herein for the TLRs are not to be construed as limiting. For example, while the exemplary sequences provided herein are derived from a human, amino acid sequences of TLRs from other species such as mice, rats, porcine, bovine, feline, and canine are known in the art and within the scope described herein.

[0135] In some further aspects, the MTMs of the invention are those described in at least one of the following: U.S. provisional application Nos. 61/296,222, 61/508,957, 61/604,878, 61/605,052, 61/605,081, 61/788,570, 61/846,438, 61/866,843, 61/917,705, 62/201,745, 62/336,940, 62/543,614; PCT application Nos. PCT/US2011/021603, PCT/US2012/047201, PCT/US2013/028409, PCT/US2014/028683, PCT/US2014/046716, PCT/US2014/071293, PCT/US2016/045509, PCT/US2017/032928; U.S. patent application Ser. Nos. 13/574,191, 14/233,553, 14/382,043, 14/766,575, 14/831,480, 14/904,583, 15/105,298, 15/415,352, 15/483,216, 15/668,794, 15/750,788, 15/839,352, 16/059,799, 16/302,023, 16/553,635; and U.S. Pat. Nos. 9,150,631, 9,593,160, 9,632,085, 9,791,440, and 10,435,457; the contents of each of which are incorporated by reference herein in their entireties.

Labels

[0136] The MTMs of the present invention may be labeled to allow them to be detected after binding to microbes or microbial components from a sample. The identity of the detectable label is limited only in that it can be discerned by the human eye or via a detector in the context of the detection device. Suitable detectable labels include colored or fluorescent particles, such a Europium particles or colloidal gold. Other acceptable labels include latex, which may itself be tagged with colored or fluorescent dyes, and magnetic or paramagnetic components. A further detectable label is a plasmonic fluor, wherein instead of assaying for a color change, one detects fluorescence. Ultrabright fluorescent nanolabels can also be used to improve the limit of detection in the detection devices of the invention, compared with conventional fluorophores.

[0137] Other detectable labels include, but are not limited to, an enzyme (e.g., peroxidase, alkaline phosphatase, glucose oxidase), a metal (e.g., gold for electron microscopy applications), a fluorescent marker (e.g., for immunofluorescence and flow cytometry applications, including CYE dyes, fluorescein isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine), a fluorescence-emitting metals (e.g., .sup.152Eu), a radioactive marker (e.g., radioisotopes for diagnostic purposes, including .sup.3H, .sup.131I, .sup.35S, .sup.14C, and .sup.125I), a chemiluminescent marker (e.g., luminol, luciferin, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester), and a protein tag (e.g., biotin, phycobiliprotein, c-Myc, HA, VSV-G, HSV, FLAG, V5, or HIS).

Compositions Comprising MTMs

[0138] The invention also includes compositions comprising one or more of types of MTMs defined herein, i.e. both naturally-occurring MTMs and engineered MTMs. As indicated above, particular MTMs can be defined based on (i) structural terms (e.g. based on the components of the MTM; the amino acid sequence of the MTM; the nucleic acid sequence of the MTM; etc.), (ii) functional terms (e.g. the identity of the MAMP bound by the PRR portion of the microbe-binding domain; the affinity or avidity of binding to the MAMP; etc.), or (iii) both structural and functional terms. When a composition is defined as comprising two or more types of MTMs, it should be understood that types of MTMs in the composition differ based on structural and/or functional terms from each other. When there is more than one type of MTM in a composition, the composition is said to comprise a mixture of different types of MTMs within the composition.

[0139] The compositions may comprise different types of MTMs within one category of MTMs, as defined herein, or the compositions may comprise different types of MTMs within two or more different categories of MTMs, as defined herein. Thus, the compositions of the invention include cocktails of different types of MTMs, wherein the composition can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more different types of MTMs within a single composition.

[0140] The compositions of the invention may comprise mixtures of naturally-occurring MTMs (e.g. MBLs), mixture of both naturally-occurring MTMs (e.g. MBLs) and the engineered MTMs defined herein (e.g. FcMBLs), or mixtures of only engineered MTMs (e.g., FcMBLs).

[0141] Depending on the manner in which the MTMs are used, the compositions comprising one or more different type of MTM may include carriers and diluents. Suitable carriers and diluents are commonly known and will vary depending on the MTM being used and the mode of use. Examples of suitable carriers and diluents include water, buffered water, saline, buffered saline, dextrose, glycerol, ethanol, and combinations thereof, propylene glycol, polysorbate 80 (Tween-80T?), poly(ethylene)glycol 300 and 400 (PEG 300 and 400), hydrophilic and hydrophobic carriers, and combinations thereof. Hydrophobic carriers include, for example, fat emulsions, lipids, PEGylated phospholipids, polymer matrices, biocompatible polymers, lipospheres, vesicles, particles, and liposomes, other stabilizing agents, solubilizing agents and surfactants, buffers and preservatives, tonicity agents, bulking agents, and lubricating agents

[0142] The compositions of the invention may also comprise one or more therapeutic agents, such as an antimicrobial agent. An MTM binds to one or more microbes or microbe components. An antimicrobial agent can optionally be included to treat (e.g. kill or inactivate) one or more known or suspected pathogens.

[0143] When the compositions comprise one or more antimicrobial agents, suitable agents include, but are not limited to, antibiotics, antivirals and antifungals. Antibiotics can be from classes including but not limited to Cephalosporin, Glycopeptide, Cyclic lipopeptide, Aminoglycoside, Macrolide, Oxazolidinone, Fluoroquinolones, Lincosamides, or Carbapenem. Antifungals can be from classes including but not limited to Polyenes, Azoles, Nucleoside Analog, Echinocandin, or Allylamine. Antivirals can be from classes including but not limited to CCR5 anatonists, Fusion inhibitors, Nucleoside/Nucleotide reverse transcriptase inhibitors (NRTIs), Non-nucleoside reverse transcriptase inhibitors (NNRTIs), Nucleotide reverse transcriptase inhibitors (NtRTIs), Integrase inhibitors, Protease inhibitors, DNA polymerase inhibitors, Guanosine analogs, Interferon-alpha, M2 ion channel blockers, Nucleoside inhibitors, NS5A polymerase inhibitors, NS3/4A protease inhibitors, Neuraminidase inhibitors, Nucleoside analogs, and Direct acting antivirals (DAAs). Examples of antimicrobials include but are not limited to aminoglycosides, ansamycins, beta-lactams, bis-biguanides, carbacephems, carbapenems, cationic polypeptides, cephalosporins, fluoroquinolones, glycopeptides, iron-sequestering glycoproteins, linosamides, lipopeptides, macrolides, monobactams, nitrofurans, oxazolidinones, penicillins, polypeptides, quaternary ammonium compounds, quinolones, silver compounds, sulfonamides, tetracyclines, and any combinations thereof.

[0144] Some exemplary antibiotics that may be included in the compositions of the invention include, but are not limited to, broad penicillins, amoxicillin (e.g., Ampicillin, Bacampicillin, Carbenicillin Indanyl, Mezlocillin, Piperacillin, Ticarcillin), Penicillins and Beta Lactamase Inhibitors (e.g., Amoxicillin-Clavulanic Acid, Ampicillin-Sulbactam, Benzylpenicillin, Cloxacillin, Dicloxacillin, Methicillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin Tazobactam, Ticarcillin Clavulanic Acid, Nafcillin), Cephalosporins (e.g., Cephalosporin I Generation, Cefadroxil, Cefazolin, Cephalexin, Cephalothin, Cephapirin, Cephradine), Cephalosporin II Generation (e.g., Cefaclor, Cefamandole, Cefonicid, Cefotetan, Cefoxitin, Cefprozil, Cefmetazole, Cefuroxime, Loracarbef), Cephalosporin III Generation (e.g., Cefdinir, Ceftibuten, Cefoperazone, Cefixime, Cefotaxime, Cefpodoxime proxetil, Ceftazidime, Ceftizoxime, Ceftriaxone), Cephalosporin IV Generation (e.g., Cefepime), Macrolides and Lincosamides (e.g., Azithromycin, Clarithromycin, Clindamycin, Dirithromycin, Erythromycin, Lincomycin, Troleandomycin), Quinolones and Fluoroquinolones (e.g., Cinoxacin, Ciprofloxacin, Enoxacin, Gatifloxacin, Grepafloxacin, Levofloxacin, Lomefloxacin, Moxifloxacin, Nalidixic acid, Norfloxacin, Ofloxacin, Sparfloxacin, Trovafloxacin, Oxolinic acid, Gemifloxacin, Perfloxacin), Carbapenems (e.g., Imipenem-Cilastatin, Meropenem), Monobactams (e.g., Aztreonam), Aminoglycosides (e.g., Amikacin, Gentamicin, Kanamycin, Neomycin, Netilmicin, Streptomycin, Tobramycin, Paromomycin), Glycopeptides (e.g., Teicoplanin, Vancomycin), Tetracyclines (e.g., Demeclocycline, Doxycycline, Methacycline, Minocycline, Oxytetracycline, Tetracycline, Chlortetracycline), Sulfonamides (e.g., Mafenide, Silver Sulfadiazine, Sulfacetamide, Sulfadiazine, Sulfamethoxazole, Sulfasalazine, Sulfisoxazole, Trimethoprim-Sulfamethoxazole, Sulfamethizole), Rifampin (e.g., Rifabutin, Rifampin, Rifapentine), Oxazolidinones (e.g., Linezolid, Streptogramins, Quinupristin Dalfopristin), Bacitracin, Chloramphenicol, Fosfomycin, Isoniazid, Methenamine, Metronidazole, Mupirocin, Nitrofurantoin, Nitrofurazone, Novobiocin, Polymyxin, Spectinomycin, Trimethoprim, Colistin, Cycloserine, Capreomycin, Ethionamide, Pyrazinamide, Para-aminosalicylic acid, Erythromycin ethylsuccinate, and the like.

[0145] Some exemplary antifungals that may be included in the compositions of the invention include, but are not limited to, polyene antifungals, Amphotericin B, Candicidin, Filipin, Hamycin, Natamycin, Nystatin, Rimocidin, imidazole antifungals, triazole antifungals, thiazole antifungals, Bifonazole, Butoconazole, Clotrimazole, Econazole, Fenticonazole, Isoconazole, Ketoconazole, Luliconazole, Miconazole, Omoconazole, Oxiconazole, Sertaconazole, Sulconazole, Tioconazole, Triazoles[edit], Albaconazole, Efinaconazole, Epoxiconazole, Fluconazole, Isavuconazole, Itraconazole, Posaconazole, Propiconazole, Ravuconazole, Terconazole, Voriconazole, Abafungin, Allylamines, amorolfin, butenafine, naftifine, terbinafine, Echinocandins, Anidulafungin, Caspofungin, Micafungin, Aurones, Benzoic acid, Ciclopirox, Flucytosine, 5-fluorocytosin, Griseofulvin, Haloprogin, Tolnaftate, Undecylenic acid, Triacetin, Crystal violet, Castellani's paint, Orotomide, Miltefosine, Potassium iodide, Coal tar, Copper(II) sulfate, Selenium disulfide, Sodium thiosulfate, Piroctone olamine, Iodoquinol, clioquinol, Acrisorcin, Zinc pyrithione, and Sulfur. Additional antifungals known in the art can also be used.

[0146] Some exemplary antivirals that may be included in the compositions of the invention include, but are not limited to, Abacavir, Acyclovir, Adefovir, Amantadine, Ampligen, Amprenavir, antiretroviral, Arbidol, Atazanavir, Atripla, Boceprevir, Cidofovir, Combivir, Daclatasvir, Darunavir, Delavirdine, Dasabuvir, Didanosine, Docosanol, Dolutegravir, Doravirine, Ecoliever, Edoxudine, Efavirenz, Elbasvir, Emtricitabine, Enfuvirtide, Entecavir, Etravirine, Famciclovir, Fomivirsen, Fosamprenavir, Foscarnet, Fosfonet, Fusion inhibitor, Ganciclovir, Gemcitabine, Glecaprevir, Grazoprevir, Ibacitabine, Idoxuridine, Imiquimod, Imunovir, Indinavir, Inosine, Integrase inhibitor, Interferon, Interferon type I, Interferon type II, Interferon type III, Lamivudine, Ledipasvir, Lopinavir, Lopiravir, Loviride, Maraviroc, Methisazone, Moroxydine, Nelfinavir, Nevirapine, Nexavir, Nitazoxanide, Norvir, Nucleoside analogues, Ombitasvir, Oseltamivir (Tamiflu), Paritaprevir, Peglyated Interferon-alpha, Peginterferon alfa-2a, Penciclovir, Peramivir, Pibrentasvir, Pleconaril, Podophyllotoxin, Protease inhibitor, Pyramidine, Raltegravir, Reverse transcriptase inhibitor, Ribavirin, Rilpivirine, Rimantadine, Ritonavir, Saquinavir, Simeprevir, Sofosbuvir, Stavudine, Synergistic enhancer (antiretroviral), Telaprevir, Telbivudine, Tenofovir, Tenofovir disoproxil, Tipranavir, Trifluridine, Trizivir, Tromantadine, Truvada, Valaciclovir (Valtrex), Valganciclovir, Velpatasvir, Vicriviroc, Vidarabine, Viramidine, Voxilaprevir, Zalcitabine, Zanamivir (Relenza), Zidovudine. Additional antivirals known in the art can also be used.

[0147] The compositions of the invention can take many different forms, varying widely based on (i) the identity of the MTMs in the composition, (ii) the identity of other components in the composition, and (iii) the intended use of the composition, to name only a few of the relevant factors.

[0148] For pharmaceutical uses, the compositions of the invention may further comprise pharmaceutically acceptable carriers and diluents when administered to or used on a living subject. Suitable carriers and diluents are commonly known and will vary depending on the MTM being used or administered and the mode of use or administration. Examples of suitable carriers and diluents include saline, buffered saline, dextrose, water-for-injection, glycerol, ethanol, and combinations thereof, propylene glycol, polysorbate 80 (Tween-80?), poly(ethylene)glycol 300 and 400 (PEG 300 and 400), PEGylated castor oil (e.g. Cremophor EL), poloxamer 407 and 188, a cyclodextrin or a cyclodextrin derivative (including HPCD ((2-hydroxypropyl)-cyclodextrin) and (2-hydroxyethyl)-cyclodextrin), hydrophilic and hydrophobic carriers, and combinations thereof. Hydrophobic carriers include, for example, fat emulsions, lipids, PEGylated phospholipids, polymer matrices, biocompatible polymers, lipospheres, vesicles, particles, and liposomes, other stabilizing agents, solubilizing agents and surfactants, buffers and preservatives, tonicity agents, bulking agents, and lubricating agents. The formulations comprising MTMs will typically have been prepared using MTMs proteins from cultures prepared in the absence of any non-human components, such as animal serum (e.g., bovine serum albumin).

[0149] As described above, a composition of the present invention can comprise any suitable formulation, including but not limited to an aerosol, a rinse, a spray, a cream, a powder, or an ointment that can be administered nasally, orally, and/or ocularly.

[0150] In some aspects, a composition of the present invention comprises an aerosolized composition. The composition can comprise a solution, e.g., a liquid, of MTMs that can be aerosolized by any aerosol generating/delivery device as known in the art (described below). The aerosolized particles can be of a suitable size for deposition into the lungs, including the smaller airways and alveoli, or onto a carrier or inert surface. An exemplary sized particle can range from about 1 micron to about 5 microns, for example, about 1 micron, or about 2 microns, or about 3 microns, or about 4 microns, or about 5 microns.

[0151] An aerosolized composition can be delivered to a subject, e.g., via the nose, eyes or mouth, by any aerosol generating/delivery device as known in the art. In some aspects, the delivery device comprises a nebulizer where the nebulizer can comprise a small volume nebulizer, a large volume nebulizer, or an ultrasound nebulizer. In some aspects, the delivery device comprises a metered-dose inhaler. In these aspects, the inhaler can include spacers or holding chambers. In some aspects, the delivery device comprises a dry-powder inhaler.

[0152] The aerosolized composition can be administered to a subject preventatively to prevent one or more pathogens from entering a subject, e.g., into the eye(s), nose, mouth, and/or respiratory system including the airway, lungs and blood vessels, and blood. The MTMs of the composition act by binding to one or more microbes or microbe components and preventing the one or more microbe or microbe components, thus immobilizing it and preventing it from entering the eye(s), nose, mouth, and/or respiratory system including the airway, lungs and blood vessels, and ultimately the blood. Aerosol administration enables a direct, topical application of the composition to the target site, such as the lung, which may be particularly advantageous in preventing a respiratory-transmitted infection such as SARS-COV-2.

[0153] In some aspects, a composition of the present invention comprises an ocular rinse or ointment. The composition can be mixed with any suitable biocompatible ocular rinses that are known in the art. The composition can be administered to a subject by dropping the rinse into the eye, or applying an ointment proximate to the eye, e.g., the eye-lids.

[0154] In some aspects, a composition of the present invention comprises a mouth rinse. The composition can be mixed with any suitable biocompatible mouth rinses that are known in the art. The composition can be administered to a subject's mouth by swooshing, gargling and/or swallowing the rinse.

[0155] In some aspects, a composition of the present invention comprises a nasal rinse, spray or ointment. The composition can be mixed with any suitable biocompatible nasal rinses or spray that are known in the art. The composition can be administered to a subject by dropping or spraying into the nose, or applying an ointment in or proximate to the nose, e.g., the nostrils, to prevent pathogens from binding to the nasal mucosa. For example, the compositions of the present invention can be used to block binding of SARS-COV-2 to ACE2 receptors in the nasal cavity.

[0156] In some aspects, the composition can be delivered via any suitable delivery device. In some aspects, the delivery device can be configured to deliver liquids and powders formulations. In some aspects, the delivery device can be configured to deliver liquid formulations, for example, via a pipette, a rhinyle catheter and squirt tube, a squeeze bottle, a metered dose spray pump, a single or duo-dose spray device, a nasal pressurized metered-dose inhaler, or a device comprising a suitable geometry for targeting anterior nose as it relate to the spray plume. In some aspects, the delivery device can be configured to deliver powder formulations, for example, via a nasal powder inhaler, a nasal powder sprayer, a nasal powder insufflator, or a breath powered bi-directional device.

[0157] As indicated above, the compositions can comprise a carrier. In some aspects, the carrier is a liposome, where the MTM is encapsulated in one or more liposomes. Encapsulation of the MTMs may provide certain characteristics, including but not limited to, altered drug pharmacokinetics and biodistribution, sustained release from the liposome, enhanced delivery to target sites, and protection of the composition from degradation. Any suitable liposome composition and encapsulation method known in the art may be used.

[0158] In some aspects, a portion of the composition can be encapsulated and a portion is not encapsulated, for example to provide a high therapeutic level of treatment to the site, while also maintaining a sustained release of the composition over time.

[0159] In some aspects, the composition comprises an aqueous solution. In some aspects, the composition comprises sodium acetate.

[0160] In some aspects, the composition comprises a pH ranging from 3 to 7.6.

[0161] In some aspects, the composition comprises an MTM concentration ranging between about 0.01% and about 20%, such as between about 0.1% and about 10%, such as between about 0.5% and about 5%.

[0162] In some aspects, the composition comprises at least one antimicrobial agent, DC-SIGN, and a ficolin.

[0163] In some aspects, the composition comprises one or more MTMs, encapsulated or unencapsulated, or a mixture thereof, at a concentration from about 1% to about 99%, for example, greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, greater than about 50%, greater than about 60%, greater than about 70%, greater than about 80%, such as about 81%, such as about 82%, such as about 83%, such as about 84%, such as about 85%, such as about 86%, such as about 87%, such as about 88%, such as about 89%, such as about 90%, such as about 91%, such as about 92%, such as about 93%, such as about 94%, such as about 95%, such as about 96%, such as about 97%, such as about 98%, such as about 99%, such as about 100%.

[0164] In some aspects, the composition comprises an MTM homopolymer. In some aspects, the composition comprises an MTM heterpolymer.

[0165] In any of the above aspects, the composition can be sterile.

[0166] In a nonlimiting example, the composition can comprise unencapsulated MTM and encapsulated MTM, where the MTM comprises FcMBL, in an aqueous solution comprising sodium acetate having a pH of about 3.2, where the composition is formulated for aerosolized delivery to animal or human nasal and oral cavities, where the particles of the aerosol comprise a diameter from about 2 microns to about 4 microns, and where the unencapsulated MTM is in the aqueous solution at a concentration of about 30 mg/mL.

[0167] In a nonlimiting example, the composition can comprise unencapsulated MTM and encapsulated MTM, where the MTM comprises a lectin, in an aqueous solution comprising sodium acetate having a pH of about 3.2, where the composition is formulated for aerosolized delivery to animal or human nasal and oral cavities, where the particles of the aerosol comprise a diameter from about 2 microns to about 4 microns, and where the unencapsulated MTM is in the aqueous solution at a concentration of about 10 mg/mL.

[0168] In a nonlimiting example, the composition can comprise unencapsulated MTM and encapsulated MTM, where the encapsulated MTM comprises truncated MBL, in an aqueous solution comprising sodium acetate having a pH of about 3.2, where the composition is formulated for aerosolized delivery to animal or human nasal and oral cavities, where the particles of the aerosol comprise a diameter from about 1 microns to about 5 microns.

[0169] Any of the compositions described herein can be administered to a subject after exposure to a pathogen, for example, to decrease the pathogen load on the subject, to treat a subject having one or more infections, and to prevent the spread of pathogens to others. In some aspects, if a subject is exposed to a known pathogen, a particular antimicrobial, based on the pathogen, can be selected and added to the composition.

Methods

[0170] The invention includes methods of treating infectious disease in a subject. Exemplary methods include a method of treating an infectious disease in a subject comprising administering a therapeutically-effective amount of a composition of the present invention to a subject having an infectious disease. The therapeutically-effective amount will be sufficient to decrease or lessen at least one symptom of the infectious disease.

[0171] The invention includes methods of preventing infectious disease in a subject. Exemplary methods include a method of preventing an infectious disease in a subject comprising administering a therapeutically-effective amount of a composition of the present invention to a subject at risk of developing an infectious disease. Such preventing can be used to block entry of the microbe into the body of the subject and/or block development of disease in the subject when the microbe has already entered the body of the subject. In this context, blocking entry should be understood to mean passage of the microbe through the skin, tissue (e.g. lung tissue or tissue of the nose), conjunctiva (e.g. eye tissue) or other barrier between the cells of the body and the environment. The therapeutically-effective amount will be sufficient to decrease or lessen the amount of microbe entering the body, or the amount sufficient to (i) decrease or lessen the numbers of microbe in the body and/or (ii) decrease or lessen growth of the microbe in the body.

Subject

[0172] As used herein, a subject may be human, a non-human primate, bird, horse, cow, goat, sheep, a companion animal, such as a dog, cat or rodent, or other mammal.

INCORPORATION BY REFERENCE

[0173] References and citations to other documents, such as patents, patent applications, patent publications, journals, books, papers, web contents, have been made throughout this disclosure. All such documents are hereby incorporated herein by reference in their entirety for all purposes.

[0174] In some aspects, compositions, methods, systems, and assays are further described in at least one of the following: U.S. provisional application numbers 61/296,222, 61/508,957, 61/604,878, 61/605,052, 61/605,081, 61/788,570, 61/846,438, 61/866,843, 61/917,705, 62/201,745, 62/336,940, 62/543,614; PCT application numbers PCT/US2011/021603, PCT/US2012/047201, PCT/US2013/028409, PCT/US2014/028683, PCT/US2014/046716, PCT/US2014/071293, PCT/US2016/045509, PCT/US2017/032928; U.S. patent application Ser. Nos. 13/574,191, 14/233,553, 14/382,043, 14/766,575, 14/831,480, 14/904,583, 15/105,298, 15/415,352, 15/483,216, 15/668,794, 15/750,788, 15/839,352, 16/059,799, 16/302,023, 16/553,635; and U.S. Pat. Nos. 9,150,631, 9,593,160, 9,632,085, 9,791,440, and 10,435,457; the contents of each of which are incorporated by reference herein in their entireties.

EQUIVALENTS

[0175] Various modifications of the invention and many further aspects thereof, in addition to those shown and described herein, will become apparent to those skilled in the art from the full contents of this document, including references to the scientific and patent literature cited herein. The subject matter herein contains important information, exemplification and guidance that can be adapted to the practice of this invention in its various aspects and equivalents thereof.