AMINOACYL TRANSFER RNA SYNTHETASES
20240200050 ยท 2024-06-20
Assignee
Inventors
Cpc classification
C12P21/06
CHEMISTRY; METALLURGY
International classification
C12N9/00
CHEMISTRY; METALLURGY
Abstract
The invention provides aminoacyl-tRNA synthetases, compositions thereof, and methods for use thereof.
Claims
1. A Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof, having at least about 85% amino acid sequence identity to the following polypeptide sequence: MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLK RFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCG ENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYN LLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTK FGKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSG KAPRAQYVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVE MEKGADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLR RGKKNYCLICWK (SEQ ID NO: 1), and comprising an alteration at an amino acid position selected from the group consisting of Y37, L71, V72, Q179, D182, and Q195 and having tRNA synthetase activity.
2. The Tyrosyl-tRNA Synthetase (TyrRS) polypeptide of claim 1, further comprising an alteration at an amino acid position wherein: i) Y37 is Y37A, Y37D, Y37E, Y37G, Y37H, Y37I, Y37L, Y37M, Y37Q, Y37T, or Y37V; ii) L71 is L71V, L71D, L71I, L71M, L71R, L71T, or L71V; iii) V72 is V72A, V72H, V72I, V72L, V72M, V72Q, V72R, V72S, or V72T; iv) Q179 is Q179A, Q179D, Q179E, Q179G, Q179H, Q179L, Q179M, Q179N, Q179P, Q179S, Q179T, or Q179V; v) D182 is D182G, or D182S; vi) F183 is F183A, F183D, F183G, F183H, F183I, F183L, F183N, F183P, F183Q, F183R, F183T, or F183V; vii) L186 is L186E, L186S, or L186V; and viii) Q195 is Q195A, Q195E, Q195G, Q195H, Q195I, Q195K, Q195L, Q195M, Q195S, Q195T, or Q195V.
3. The Tyrosyl-tRNA Synthetase (TyrRS) polypeptide of claim 1, wherein the TyrRS polypeptide comprises a combination of alterations selected from (1) Y37L and L71V, (2) Y37G, L71T, and D182S, (3) L71V and L186A, (4) Y37V and L71V, (5) Y37L, L71V, and L186A, and (6) L71I, V72V, Q179Q, D182G, F183M, L186A, and Q195Q.
4. A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, having at least about 85% amino acid sequence identity to the following polypeptide sequence: MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTI GDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKM LGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV IDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEG VEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRN TKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQ RDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADK LTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVV MDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEA ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFY YVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQV MVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVA ALNVDALTENQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQ DRALMQEALLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLV VVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVV G (SEQ ID NO: 2), and comprising an alteration at an amino acid position selected from the group consisting of M40, L41, S496, Y499 and Y527 and having tRNA synthetase activity.
5. The Leucyl-tRNA Synthetase (LeuRS) polypeptide of claim 4, wherein the alteration is selected at an amino acid position selected from the following: i) M40 is M40A, M40G, M40L, M40P, M40Q, or M40S; ii) L41 is L41A, L41E, L41G, L41H, L41N, L41P, L41T, or L41V; iii) S496 is S496A, S496G, or S496T; iv) Y499 is Y499A, Y499C, Y499F, Y499G, Y499H, Y499I, Y499L, Y499N, Y499S, Y499T, or Y499V; v) Y527 is Y527C, Y527D, Y527F, Y527G, Y527H, Y527I, Y527N, Y527R, Y527S, Y527T, or Y527V; vi) H537 is H537A, H537C, H537F, H537L, or H537S.
6. The Leucyl-tRNA Synthetase (LeuRS) polypeptide of claim 4, wherein the LeuRS polypeptide comprises a combination of alterations selected from (1) M40G and S496T, (2) S496T and H537G, (3) S496G and H537G, (4) L41P, S496G, and H537G, (5) M40P, S496G, H537G, (6) L41G and H537G, (7) M40A and H537G, and (8) M40G, L41P, S496GY499A, Y527C, and H537G.
7. The polypeptide of claim 1, wherein the polypeptide has aminoacylation activity specific for one or more noncanonical amino acid.
8. The polypeptide of claim 7, wherein the noncanonical amino acid(s) is selected from one or more of O-methyl-L-tyrosine (OmeY); p-acetyl-L-phenylalanine (AcF); p-azido-L-phenylalanine (AzF); p-propargyloxy-L-phenylalanine (OPG); 4-azidomethyl-L-phenylalanine (AzMF); 4-borono-L-phenylalanine (BPhe); 3,4-dihydroxy-L-phenylalanine (DOPA); O-(2-Bromoethyl)-tyrosine (Obey); 4-iodo-L-phenylalanine (IPhe); L-?-aminocaprylic acid (AC); NE-azido-L-lysine (AzK); 3-Amino-L-tyrosine (ATyr); 4-Amino-L-phenylalanine (APhe); dimethyl-L-lysine (DMK); Boc-L-lysine (BocK); (S)-2-amino-6-((2-azidoethoxy)carbonylamino)hexanoic acid (LysN3); and 2-Amino-6-(prop-2-ynoxycarbonylamino)hexanoic acid (LysAlk), O-(2-Bromoethyl)-L-tyrosine, O-Sulfo-L-tyrosine (SY), 2-amino-3-[4-(carboxymethyl) phenyl]propanoic acid (CMF), L-p-hydroxy-phenyllactic acid (Ester), L-2-Amino-4-phosphonobutyric acid (PSA), O-phospho-L-serine (OPS), Acetyl-L-lysine (AcK), 4-benzoyl-1-phenylalanine (Bpa), and N.sup.6-((2-(3-methyl-3H-diazirin-3-yl)ethoxy)carbonyl)-L-lysine (Photo-Lysine, Phk).
9. A polynucleotide encoding the polypeptide of claim 1.
10. An expression vector comprising the polynucleotide of claim 9.
11. A cell comprising the expression vector of claim 10.
12. An in vitro method of producing a protein comprising a noncanonical amino acid, the method comprising: (a) contacting an in vitro translation system or cell with a Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof, having at least about 85% amino acid sequence identity to the following polypeptide sequence: MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLK RFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCG ENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYN LLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTK FGKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSG KAPRAQYVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVE MEKGADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLR RGKKNYCLICWK (SEQ ID NO: 1), and comprising an alteration at an amino acid position selected from the group consisting of Y37, L71, V72, Q179, D182, and Q195 and having tRNA synthetase activity, (b) contacting the in vitro translation system or cell of (a) with one or more noncanonical amino acids or a composition thereof and a polynucleotide encoding a protein comprising one or more noncanonical amino acids; and (c) expressing the protein comprising one or more noncanonical amino acids using the in vitro translation system or cell.
13. An in vitro method of producing a protein comprising a noncanonical amino acid, the method comprising: (a) contacting an in vitro translation system or cell with an expression vector encoding a Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, having at least about 85% amino acid sequence identity to the following polypeptide sequence: MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTI GDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKM LGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV IDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEG VEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRN TKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQ RDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADK LTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVV MDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEA ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFY YVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQV MVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVA ALNVDALTENQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQ DRALMQEALLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLV VVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVV G (SEQ ID NO: 2), and comprising an alteration at an amino acid position selected from the group consisting of M40, L41, 5496, Y499 and Y527 and having tRNA synthetase activity, and expressing the polypeptide(s) in the cell; (b) contacting the in vitro translation system or cell of (a) with one or more noncanonical amino acids or a composition thereof and producing a protein comprising one or more noncanonical amino acids in the cell; and (c) expressing said protein comprising one or more noncanonical amino acids using the in vitro translation system or cell.
14. The method of claim 13, wherein the cell is genetically engineered or mutated to utilize noncanonical amino acids.
15. A system for producing and selecting for a protein comprising a noncanonical amino acid, the system comprising: an in vitro translation system or cell comprising a Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof, having at least about 85% amino acid sequence identity to the following polypeptide sequence: MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLK RFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCG ENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYN LLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTK FGKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSG KAPRAQYVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVE MEKGADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLR RGKKNYCLICWK (SEQ ID NO: 1), and comprising an alteration at an amino acid position selected from the group consisting of Y37, L71, V72, Q179, D182, and Q195 and having tRNA synthetase activity, wherein the in vitro translation system or cell comprises one or more noncanonical amino acids or a composition thereof, and wherein a protein comprising one or more noncanonical amino acids is produced in the in vitro translation system or cell.
16. A system for producing and selecting for a protein comprising a noncanonical amino acid, the system comprising: an in vitro translation system or cell containing a Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, having at least about 85% amino acid sequence identity to the following polypeptide sequence: MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTI GDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKM LGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV IDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEG VEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRN TKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQ RDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADK LTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVV MDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEA ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFY YVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQV MVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVA ALNVDALTENQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQ DRALMQEALLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLV VVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVV G (SEQ ID NO: 2), and comprising an alteration at an amino acid position selected from the group consisting of M40, L41, S496, Y499 and Y527 and having tRNA synthetase activity, wherein the in vitro translation system or cell comprises one or more noncanonical amino acids or a composition thereof, and wherein a protein comprising one or more noncanonical amino acids is produced in the in vitro translation system or cell.
17. A protein comprising one or more noncanonical amino acids, the protein being produced, generated or selected by the method of claim 13.
18. A method of controlling the replication of a cell or virus, the method comprising: (a) (i) altering a gene encoding a polypeptide in the cell or a virus infecting the cell to encode the polypeptide altered to comprise a noncanonical amino acid and/or (ii) knocking out the gene in the cell or the virus infecting the cell, and contacting the cell with a polynucleotide sequence encoding the polypeptide altered to comprise the noncanonical amino acid, such that replication of the cell or virus is reduced or eliminated in the absence of expression of the polypeptide containing the noncanonical amino acid, (b) contacting the cell with an expression vector encoding a Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof wherein the polypeptide has at least about 85% amino acid sequence identity to the following polypeptide sequence: MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLK RFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCG ENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYN LLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTK FGKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSG KAPRAQYVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVE MEKGADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLR RGKKNYCLICWK (SEQ ID NO: 1), and comprising an alteration at an amino acid position selected from the group consisting of Y37, L71, V72, Q179, D182, and Q195 and having tRNA synthetase activity, and expressing the polypeptide(s) in the cell; (c) controlling replication of the cell and/or virus by contacting the cell of (a) with the noncanonical amino acid, wherein replication of the cell and/or virus is reduced or eliminated in the absence of the noncanonical amino acid.
19. A method of controlling the replication of a cell or virus, the method comprising: (a) (i) altering a gene encoding a polypeptide in the cell or a virus infecting the cell to encode the polypeptide altered to comprise a noncanonical amino acid and/or (ii) knocking out the gene in the cell or the virus infecting the cell, and contacting the cell with a polynucleotide sequence encoding the polypeptide altered to comprise the noncanonical amino acid, such that replication of the cell or virus is reduced or eliminated in the absence of expression of the polypeptide containing the noncanonical amino acid, (b) contacting the cell an expression vector encoding a Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, wherein the polypeptide has at least about 85% amino acid sequence identity to the following polypeptide sequence: MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTI GDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKM LGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV IDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEG VEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRN TKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQ RDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADK LTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVV MDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEA ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFY YVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQV MVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVA ALNVDALTENQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQ DRALMQEALLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLV VVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVV G (SEQ ID NO: 2), and comprising an alteration at an amino acid position selected from the group consisting of M40, L41, S496, Y499 and Y527 and having tRNA synthetase activity, and expressing the polypeptide(s) in the cell; (c) controlling replication of the cell and/or virus by contacting the cell of (a) with the noncanonical amino acid, wherein replication of the cell and/or virus is reduced or eliminated in the absence of the noncanonical amino acid.
20. The method of claim 19, wherein the cell is a mammalian cell, yeast cell, bacterial cell, plant cell, or insect cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
DETAILED DESCRIPTION OF THE INVENTION
[0109] The invention features compositions and methods that are useful for incorporation of noncanonical amino acids into polypeptide sequences. In particular, the invention of the disclosure provides aminoacyl-tRNA synthetases, compositions thereof, and methods for use thereof.
[0110] The invention of the present disclosure is based at least in part upon the development of a high-throughput screening platform in S. cerevisiae to evolve aminoacyl-tRNA synthetases (aaRSs) that were able to charge noncanonical amino acids (ncAAs) that had not previously been encoded in proteins (e.g., in yeast).
Synthetic Biology
[0111] The ability to produce chemically versatile proteins with encoded noncanonical amino acids (ncAAs) at specific sites supports a growing number of applications in chemical and synthetic biology. Unique noncanonical amino acid (ncAA) functional groups allow for exploration of post-translational modifications, examination of protein-protein interactions, and discovery of biological therapeutics and protein medicinal chemistry, among many other applications. Aminoacyl-tRNA synthetases (aaRSs) evolved to maintain the fidelity of genetic code translationthat is, to precisely charge canonical amino acids (cAAs) to their cognate tRNAs while discriminating against other potential substrates. However, it is possible to engineer and express these precise aminoacyl-tRNA synthetases (aaRSs) in organisms from different domains of life to charge noncanonical amino acids (ncAAs) without interacting with the host cell's natural translation machinery. These orthogonal aaRS/tRNA pairs can be engineered to improve the efficiency of noncanonical amino acid (ncAA) incorporation in proteins in both prokaryotic and eukaryotic hosts. Diversification is generally limited to residues in the active site with selections most commonly used to isolate aminoacyl-tRNA synthetases (aaRSs) with desirable properties. Selection criteria are generally limited to incorporation of a target noncanonical amino acid (ncAA) and absence of incorporation of cAAs, without attempts to isolate aminoacyl-tRNA synthetases (aaRSs) with particular specificity or polyspecificity profiles. For example, when expressing proteins with dual- or triple-noncanonical amino acid (ncAA) incorporation, additional selection for aminoacyl-tRNA synthetase (aaRS) mutants that do not non-specifically charge non-target noncanonical amino acids (ncAAs) is sometimes necessary. The extent of specificity or polyspecificity of aminoacyl-tRNA synthetases (aaRSs) that can be engineered remains unknown, particularly as it is not well understood how mutations in or outside of the active sites of aminoacyl-tRNA synthetases (aaRSs) contribute to these two properties.
[0112] One property of aminoacyl-tRNA synthetases (aaRSs) beyond their ability to maintain the fidelity of the genetic code is their potential to demonstrate specificity or polyspecificity when engineered to charge noncanonical amino acids (ncAAs) to their cognate tRNAs. Many methods for evolving orthogonal translation machinery utilize life-or-death assays. Selection strategies in Escherichia coli involve the use of a toxic Barnase gene containing the codon at which a noncanonical amino acid (ncAA) could be encoded (the undesired readthrough of which leads to cell death, for negative selection) and a beta-lactamase or chloramphenicol acetyltransferase gene with the same codon (the desired readthrough of which would lead to cell survival in the presence of ampicillin, for positive selection). In yeast, a similar but unique selection strategy is used, where the yeast selection strain Saccharomyces cerevisiae MaV203 and the transcriptional activator GAL4 gene containing two TAG codons are used to measure responses in three reporter genes (HIS3, URA3, and lacZ) when both TAG codons have been successfully suppressed. These selection strategies offer several advantages, but are more difficult to employ in higher eukaryotes, such as mammalian cells. However, some archaeal aminoacyl-tRNA synthetases (aaRSs) such as the M. mazei or M. barkeri pyrrolysyl-tRNA synthetases (PylRSs) have been reported to be orthogonal in E. coli, S. cerevisiae, and mammalian cells. These selection and screening methods have changed the landscape of noncanonical amino acid (ncAA) incorporation as a field. During the course of attempts to improve aminoacyl-tRNA synthetase (aaRS) activity for hundreds of noncanonical amino acids (ncAAs), researchers have discovered and begun to probe characteristics beyond simply the ability to encode a novel noncanonical amino acid (ncAA). Despite the success of engineering various aminoacyl-tRNA synthetases (aaRSs) for improved noncanonical amino acid (ncAA) recognition and activity in E. coli, relatively little work has been done to develop E. coli or archaeal aminoacyl-tRNA synthetases (aaRSs) in yeast. Evolving aminoacyl-tRNA synthetases (aaRSs) for improved activity or selectivity in yeast has been restricted to selections and low-throughput screens, despite highly advantageous tools such as yeast display that make possible high throughput aminoacyl-tRNA synthetase (aaRS) engineering. Aminoacyl-tRNA synthetase (aaRS) characteristics such as solubility and specificity are known to play key roles for individual applications, but it is not yet clear how best to evolve aminoacyl-tRNA synthetases (aaRSs) to address those needs.
Library Screening
[0113] Libraries of aminoacyl-tRNA synthetases (aaRSs) were constructed in yeast and screened for incorporation of unique noncanonical amino acids (ncAAs). From these screens, several aminoacyl-tRNA synthetase variants were isolated that support translation with noncanonical amino acids (ncAAs) not previously encoded in proteins in yeast. As described in the Examples provided herein below, an aminoacyl-tRNA synthetase with only moderate activity toward its cognate noncanonical amino acid (ncAA) was randomly mutated using error-prone PCR (epPCR) to provide for the selection of aminoacyl-tRNA synthetases having improved efficiency of noncanonical amino acid (ncAA) charging. Using a combination of epPCR with stringent screening conditions supported by the yeast display reporter platform, aminoacyl-tRNA synthetase variants were identified with double the efficiency of stop codon readthrough compared to the parent polypeptide.
[0114] To date, very little work in engineering aminoacyl-tRNA synthetases (aaRSs) has included evolution for incorporation of multiple distinct noncanonical amino acids (ncAAs). Further, there are many advantages of controlling the specificity of aminoacyl-tRNA synthetases (aaRSs). By including structurally similar noncanonical amino acids (ncAAs) during negative screening rounds, aminoacyl-tRNA synthetases (aaRSs) were identified that supported incorporation of a single noncanonical amino acid (ncAA) out of a group of six structurally similar aromatic noncanonical amino acids (ncAAs). At the same time, screening criteria was also altered to identify aminoacyl-tRNA synthetases (aaRSs) with polyspecific behavior for multiple similar noncanonical amino acids (ncAAs) and isolated aminoacyl-tRNA synthetases (aaRSs) that encoded all 6 noncanonical amino acid (ncAA) analogs at varying levels.
[0115] Polyspecific aminoacyl-tRNA synthetases (aaRSs) from these screens were also able to charge several aliphatic noncanonical amino acids (ncAAs), suggesting that the mutations in these aminoacyl-tRNA synthetases (aaRSs) imbued polyspecific characteristics beyond specificity to a select group of similar noncanonical amino acids (ncAAs). The unique ability to express several distinct proteins using a single polyspecific aminoacyl-tRNA synthetase or to produce a single protein at high efficiency using an aminoacyl-tRNA synthetase with engineered specificity supports protein engineering efforts in critical fields such as protein medicinal chemistry for discovery of biological therapeutics. Additionally, aminoacyl-tRNA synthetases (aaRSs) engineered with these unique polyspecific characteristics could expand the chemical versatility of libraries of proteins containing noncanonical amino acids (ncAAs), adding a potentially highly valuable technology to the protein engineering toolkit.
[0116] Expression of proteins with genetically encoded amino acids beyond the canonical 20 benefits a broad range of applications, from the development of biological therapeutics to fundamental biological studies to better understand how eukaryotic cells function. A major factor limiting the use of these noncanonical amino acids (ncAAs) is the lack of engineered cellular machinery, also known as orthogonal translation systems (OTSs), that supports efficient genetic code expansion at repurposed stop codons. The Examples provided herein demonstrate the use of a yeast display-based noncanonical amino acid (ncAA) incorporation reporter platform to screen libraries of Escherichia coli tyrosyl- and leucyl-tRNA synthetases in high throughput for 1) incorporation of new noncanonical amino acids (ncAAs), 2) a specificity profile in which an aminoacyl-tRNA synthetase encode only one out of a group of six noncanonical amino acid (ncAA) analogs, and 3) a polyspecific aminoacyl-tRNA synthetase capable of encoding all six noncanonical amino acid (ncAA) analogs. Using flow cytometry-based screens aminoacyl-tRNA synthetases (aaRSs) were isolated that can encode two noncanonical amino acids (ncAAs) that had not previously been genetically encoded in proteins in yeast: 3,4-dihydroxy-L-phenylalanine (DOPA) and 4-borono-L-phenylalanine (BPhe). To enhance specificity, libraries of orthogonal translation systems (OTSs) were induced in the presence of several off-target noncanonical amino acids (ncAAs) during negative screens to enrich for clones capable of discriminating between similar noncanonical amino acids (ncAAs).
[0117] The results presented in the Examples indicate the feasibility of identifying orthogonal translation systems (OTSs) that support expansion of the genetic code to include structurally related noncanonical amino acids (ncAAs) without causing loss of fidelity of the expanded code. To enhance polyspecificity, two strategies were pursued: (1) induction with several noncanonical amino acids (ncAAs) simultaneously, followed by positive screens; and (2) induction with individual different noncanonical amino acids (ncAAs) in successive rounds of positive screening. While each of these approaches yielded orthogonal translation systems (OTSs) exhibiting high polyspecificity while still limiting canonical amino acid misincorporation, greater control over the specific set of noncanonical amino acids (ncAAs) incorporated by variants was achieved using methodology (2). Unexpectedly, populations enriched via strategy (1) with aromatic noncanonical amino acids (ncAAs) included variants that supported high levels of translation for several aliphatic derivatives of lysine, suggesting that even relatively conservative attempts to enhance polyspecificity may result in clones with broad noncanonical amino acid (ncAA) incorporation capabilities. The use of quantitative yeast display reporters to engineer orthogonal translation systems (OTSs) has allowed for properties to be selected that would be difficult to identify using other methodologies. These results have important implications related to the fundamental properties and evolvability of orthogonal translation systems (OTSs), while access to orthogonal translation systems (OTSs) with diverse activities and specific or polyspecific properties may prove invaluable for a range of applications within chemical and synthetic biology.
Aminoacyl-tRNA Synthetases
[0118] The present invention provides new aminoacyl-tRNA synthetases with improved characteristics. The aminoacyl-tRNA synthetases can be used for the specific incorporation of one or more noncanonical amino acids at a predetermined location(s) in a polypeptide. The noncanonical amino acid useful in the invention include, but are not limited to, the following: O-methyl-L-tyrosine (OmeY); p-acetyl-L-phenylalanine (AcF); p-azido-L-phenylalanine (AzF); p-propargyloxy-L-phenylalanine (OPG); 4-azidomethyl-L-phenylalanine (AzMF); 4-borono-L-phenylalanine (BPhe); 3,4-dihydroxy-L-phenylalanine (DOPA); O-(2-Bromoethyl)-tyrosine (Obey); 4-iodo-L-phenylalanine (IPhe); L-?-aminocaprylic acid (AC); NE-azido-L-lysine (AzK); 3-Amino-L-tyrosine (ATyr); 4-Amino-L-phenylalanine (APhe); dimethyl-L-lysine (DMK); Boc-L-lysine (BocK); (S)-2-amino-6-((2-azidoethoxy)carbonylamino)hexanoic acid (LysN3); and 2-Amino-6-(prop-2-ynoxycarbonylamino)hexanoic acid (LysAlk), O-Sulfo-L-tyrosine (SY), 2-amino-3-[4-(carboxymethyl) phenyl]propanoic acid (CMF), L-p-hydroxy-phenyllactic acid (Ester), L-2-Amino-4-phosphonobutyric acid (PSA), O-phospho-L-serine (OPS), Acetyl-L-lysine (AcK), 4-benzoyl-1-phenylalanine (Bpa), N.sup.6-((2-(3-methyl-3H-diazirin-3-yl)ethoxy)carbonyl)-L-lysine (Photo-Lysine, Phk), other noncanonical amino acids known in the art, and various combinations thereof. In some embodiments, the noncanonical amino acid is selected from one or more of OmeY, AcF, AzF, OPG, AzMF, and IPhe. In some embodiments, the noncanonical amino acid is selected from at least one of DOPA and BPhe. In some embodiments, the aminoacyl-tRNA synthetases can be used to incorporate noncanonical amino acids into polypeptides expressed in yeast.
[0119] The aminoacyl-tRNA synthetase in various embodiments can be derived from a WT Escherichia coli tyrosyl-tRNA synthetase or from a WT Escherichia co/i leucyl-tRNA synthetase. In some embodiments, the aminoacyl-tRNA synthetase polypeptide is a tyrosyl-tRNA synthetase. In some embodiments, the aminoacyl-tRNA synthetase is a leucyl-tRNA synthetase. The aminoacyl-tRNA synthetase can include about or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 altered amino acids relative to a corresponding reference or WT sequence. In some embodiments, the aminoacyl-tRNA synthetase is an aminoacyl-tRNA synthetase listed in any one or more of Tables 6, 11, 8-10, and 19-24 or comprising one or more alterations or combinations of alterations listed in the tables.
[0120] An aminoacyl-tRNA synthetase polypeptide is characterized by measuring a relative readthrough efficiency (RRE) and/or a maximum misincorporation frequency (MMF) of the aminoacyl-tRNA synthetase. In some embodiments, an aminoacyl-tRNA synthetase encodes a noncanonical amino acid with a relative readthrough efficiency of about or at least about 0.001, 0.002, 0.003, 0.004, 0.005, 0.006, 0.007, 0.008, 0.009, 0.01, 0.02, 0.03, 0.04 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.11, 0.12, 0.13, 0.14, 0.15, 0.16, 0.17, 0.18, 0.19, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, or 0.5. In some embodiments, an aminoacyl-tRNA synthetase encodes a noncanonical amino acid with a maximum misincorporation frequency of about or less than about 2.5, 2.4, 2.3, 2.2, 2.1, 2, 1.9, 1.8, 1.7, 1.6, 1.5, 1.4, 1.3, 1.2, 1.1, 1.0, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.19, 0.18, 0.17, 0.16, 0.15, 0.14, 0.13, 0.12, 0.11, 0.1, 0.09, 0.08, 0.07, 0.06, 0.05, 0.04, 0.03, 0.02, or 0.01. In some embodiments, the relative readthrough efficiency (RRE) and/or the maximum misincorporation frequency (MMF) is measured with respect to encoding one or more particular noncanonical amino acids listed herein.
[0121] In some embodiments, the relative readthrough efficiency (RRE) and/or the maximum misincorporation frequency (MMF) is measured at a particular concentration of the noncanonical amino acid(s), where the concentration of the noncanonical amino acid in various embodiments is about or at least about 0.05 mM, 0.1 mM, 0.15 mM, 0.20 mM, 0.25 mM, 0.30 mM, 0.35 mM, 0.40 mM, 0.45 mM, 0.5 mM, 0.55 mM, 0.65 mM, 0.7 mM, 0.75 mM, 0.8 mM, 0.85 mM, 0.9 mM, 0.95 mM, 1 mM, 1.1 mM, 1.2 mM, 1.3 mM, 1.4 mM, 1.5 mM, 1.6 mM, 1.7 mM, 1.8 mM, 1.9 mM, 2 mM, 2.5 mM, 3 mM, 3.5 mM, 4 mM, 4.5 mM, 5 mM, 5.5 mM, 6 mM, 6.5 mM, 7 mM, 7.5 mM, 8 mM, 8.5 mM, 9 mM, 9.5 mM, 10 mM, 11 mM, 12 mM, 13 mM, 14 mM, 15 mM, or 20 mM.
[0122] Methods for calculating relative readthrough efficiency (RRE) and maximum misincorporation frequency (MMF) are known and are disclosed, for example, in Potts, K. A., Stieglitz, J. T., Lei, M., Van Deventer, J. A. (2020) Reporter system architecture affects measurements of noncanonical amino acid incorporation efficiency and fidelity, Mol. Syst. Des. Eng. 5, 573-588 and Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269.
[0123] Maximum misincorporation frequency quantifies the maximum frequency with which a stop codon is read through aberrantly with a canonical amino acid instead of a noncanonical amino acid of interest (typical range of 0 to 1, with highest fidelity at a value of 0). Relative readthrough efficiency quantified the readthrough of a stop codon in comparison to the readthrough of a cognate codon (typical range of 0 to 1, with readthrough efficiency equaling the readthrough of a cognate codon at a value of 1).
[0124] In some embodiments, the aminoacyl-tRNA synthetase has specificity or polyspecificity for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, or 100 noncanonical amino acids. In some embodiments, the aminoacyl-tRNA synthetase has specificity or polyspecificity for one or more noncanonical amino acids selected from OmeY, AcF, AzF, OPG, AzMF, and IPhe.
[0125] By orthogonal is meant a molecule that functions with endogenous components of a cell with reduced efficiency as compared to a corresponding molecule that is endogenous to the cell or translation system, or that fails to function with endogenous components of the cell. In the context of tRNAs and aminoacyl-tRNA synthetases, orthogonal refers to an inability or reduced efficiency, e.g., less than 20% efficiency, less than 10% efficiency, less than 5% efficiency, or less than 1% efficiency, of an orthogonal tRNA to function with an endogenous tRNA synthetase compared to the ability of an endogenous tRNA to function with the endogenous tRNA synthetase; or of an orthogonal aminoacyl-tRNA synthetase to function with an endogenous tRNA compared to the ability of an endogenous tRNA synthetase to function with the endogenous tRNA. The orthogonal molecule in various embodiments lacks a functionally normal endogenous complementary molecule in the cell. For example, an orthogonal tRNA in a cell is aminoacylated by any endogenous tRNA synthetase (RS) of the cell with reduced or even undetectable or zero efficiency, when compared to aminoacylation of an endogenous tRNA by the endogenous RS. In another example, an orthogonal RS aminoacylates any endogenous tRNA in a cell of interest with reduced or even undetectable or zero efficiency, as compared to aminoacylation of the endogenous tRNA by an endogenous RS. A second orthogonal molecule can be introduced into the cell that functions with the first orthogonal molecule. For example, an orthogonal tRNA/RS pair includes introduced complementary components that function together in the cell with an efficiency (e.g., 0.01% efficiency, 0.02% efficiency, 0.03% efficiency, 0.04% efficiency, 0.05% efficiency, 0.06% efficiency, 0.07% efficiency, 0.08% efficiency, 0.09% efficiency, 0.1% efficiency, 0.2% efficiency, 0.3% efficiency, 0.4% efficiency, 0.5% efficiency, 0.6% efficiency, 0.7% efficiency, 0.8% efficiency, 0.9% efficiency, 1% efficiency, 2% efficiency, 3% efficiency, 4% efficiency, 5% efficiency, 6% efficiency, 7% efficiency, 8% efficiency, 9% efficiency, 10% efficiency, 15% efficiency, 20% efficiency, 25% efficiency, 30% efficiency, 35% efficiency, 40% efficiency, 45% efficiency, 50% efficiency, 60% efficiency, 70% efficiency, 75% efficiency, 80% efficiency, 90% efficiency, 95% efficiency, or 99% or more efficiency) as compared to that of a control, e.g., a corresponding tRNA/RS endogenous pair.
Polypeptide Expression
[0126] In general, polypeptides (e.g., an aminoacyl-tRNA synthetase) of the invention may be produced by transformation of a suitable host cell (e.g., mammalian cell, bacterial cell, yeast cell, insect cell) with all or part of a polypeptide-encoding nucleic acid molecule or fragment thereof in a suitable expression vehicle.
[0127] Those skilled in the field of molecular biology will understand that any of a wide variety of expression systems may be used to provide the recombinant protein. The precise host cell used is not critical to the invention. A polypeptide of the invention may be produced in a prokaryotic host (e.g., E. coli) or in a eukaryotic host (e.g., Saccharomyces cerevisiae, cells from other species of yeast, insect cells, or mammalian cells). Such cells are available from a wide range of sources (e.g., the American Type Culture Collection, Rockland, Md.; also, see, e.g., Ausubel et al., supra). The method of transformation or transfection and the choice of expression vehicle will depend on the host system selected. Transformation and transfection methods are described, e.g., in Ausubel et al. (supra); expression vehicles may be chosen from those provided, e.g., in Cloning Vectors: A Laboratory Manual (P. H. Pouwels et al., 1985, Supp. 1987).
[0128] A variety of expression systems exist for the production of the polypeptides of the invention. Expression vectors useful for producing such polypeptides include, without limitation, chromosomal, episomal, and virus-derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof. Once the recombinant polypeptide of the invention, or a polypeptide produced according to the methods of the present invention and containing a noncanonical amino acid, is expressed, it can be isolated, e.g., using affinity chromatography. In embodiments, the polypeptide of the invention is not isolated from a cell. In one example, an antibody (e.g., produced as described herein) raised against a polypeptide of the invention may be attached to a column and used to isolate the recombinant polypeptide. Lysis and fractionation of polypeptide-harboring cells prior to affinity chromatography may be performed by standard methods familiar to one of skill in the art.
[0129] Once isolated, the recombinant protein can, if desired, be further purified, e.g., by high performance liquid chromatography (see, e.g., Fisher, Laboratory Techniques In Biochemistry and Molecular Biology, eds., Work and Burdon, Elsevier, 1980). These general techniques of polypeptide expression and purification can also be used to produce and isolate useful peptide fragments or analogs.
[0130] A cell can be engineered or mutated to utilize noncanonical amino acids. For example, a cell (e.g., E. coli, yeast, other prokaryotic cells, or mammalian cells) can be genomically recoded to facilitate incorporation of noncanonical amino acids (see, e.g., Liu C C, Schultz P G. Adding new chemistries to the genetic code. Annu Rev Biochem 2010, 79:413-444; Chin J W. Expanding and reprogramming the genetic code. Nature 2017, 550:53-60; and Lajoie M J et al. Genomically recoded organisms expand biological functions. Science 2013, 342:357-360). In some instances, it can be advantageous to introduce mutations to a release factor polynucleotide or polypeptide in a cell to help facilitate utilization of noncanonical amino acids (see, e.g., Chin, Reprogramming the genetic code, EMBO J., 30:2312-2324 (2011)).
[0131] Synthetic Yeast 2.0 is an example of engineering a cell to better utilize noncanonical amino acids. For example, in the Sc2.0 project, TAG stop codons are recoded to TAA to allow insertion of noncanonical amino acids (Jones, S. SCRaMbLE does the yeast genome shuffle. Nat Biotechnol 36, 503 (2018). doi.org/10.1038/nbt.4164).
Screening and Expression of Polypeptides Containing Noncanonical Amino Acids
[0132] The aminoacyl-tRNA synthetases of the present disclosure may be used for the incorporation of noncanonical amino acids into a polypeptide sequence in vivo or ex vivo. The noncanonical amino acids may be incorporated anywhere in the polypeptide sequence. The noncanonical amino acids may be incorporated into the polypeptide to confer desired characteristics to the polypeptide (e.g., increased stability at high or low temperature or pH, increased activity, etc.).
[0133] Incorporation of a noncanonical amino acid into the polypeptide sequence can be achieved by inserting a codon specific for the noncanonical amino acid (e.g., an amber codon) in the polynucleotide encoding the polypeptide. In some embodiments, a single noncanonical amino acid is incorporated into the polypeptide. The noncanonical amino acid in various embodiments can be any one of the noncanonical amino acids discussed herein.
[0134] In some embodiments, noncanonical amino acids may be incorporated into the polypeptide by using either a nonsense suppressor or a frame-shift suppressor tRNA in response to amber or four-base codons, respectively (See Bain et al., J Am. Chem. Soc. 111: 8013, 1989; Noren et al., Science 244: 182, 1989; Furter, Protein Sci. 7: 419, 1998; Wang et al., Proc. Natl. Acad. Sci. U.S.A., 100: 56, 2003; Hohsaka et al., FEBS Lett. 344: 171: 1994; Kowal and Oliver, Nucleic Acids Res. 25: 4685, 1997. All incorporated herein by reference). Such methods insert noncanonical amino acids at codon positions that will normally terminate wild-type peptide synthesis (e.g. a stop codon or a frame-shift mutation).
[0135] An exemplary method for producing a polypeptide comprising a noncanonical amino acid involves: a) transforming a host cell (e.g., mammalian cell, bacterial cell, yeast cell, insect cell) with i) a vector containing a polynucleotide sequence encoding an aminoacyl-tRNA synthetase described herein capable of charging a tRNA with a noncanonical amino acid(s) of interest, ii) a vector containing a polynucleotide sequence encoding the polypeptide of interest, iii) a vector encoding a suppressor tRNA (e.g., tRNA.sub.CUA) that can be charged by the aminoacyl-tRNA synthetase with a noncanonical amino acid; b) growing the host-vector system in a medium comprising the noncanonical amino acid(s) to be incorporated into the polypeptide sequence under conditions where the host vector system overexpresses the aminoacyl-tRNA synthetase and the suppressor tRNA, c) inducing expression of the polypeptide of interest, thereby incorporating the noncanonical amino acid(s) into the polypeptide. The method can further comprise isolating the polypeptide of interest using methods known in the art, optionally those described herein. In various embodiments, the polypeptide of interest can be fused to tags to assist in downstream isolation (e.g., a His-tag or a FLAG tag). In some embodiments, the polypeptide of interest is fused to a secretion signal and/or is encoded by a secretion plasmid. In various embodiments, the suppressor tRNA is an orthogonal tRNA (i.e., a tRNA not aminoacylated by an aminoacyl-tRNA synthetase naturally expressed by the host cell).
[0136] For in vitro use, one or more aminoacyl-tRNA synthetases of the present disclosure can be recombinantly produced and supplied to an in vitro translation systems (e.g., the commercially available Wheat Germ Lysate-based PROTEINscript-PRO?, Ambion's E. coli system for coupled in vitro transcription/translation; or the rabbit reticulocyte lysate-based Retic Lysate IVT? Kit from Ambion). Optionally, the in vitro translation system can be selectively depleted of one or more natural canonical aminoacyl-tRNA synthetases (by, for example, immunodepletion using immobilized antibodies against natural aminoacyl-tRNA synthetases) and/or natural amino acids so that enhanced incorporation of the analog can be achieved.
[0137] In some embodiments, the methods of the present disclosure involving preparing a library of polynucleotide sequences encoding the polypeptide sequence of interest with codons for incorporation of the noncanonical amino acid sequence at various, optionally random, sites. The methods can further include expressing each of the polynucleotide sequences under conditions, such as those described above, allowing for incorporation of the noncanonical amino acid(s) into the encoded polypeptide sequences and subsequently screening the expressed polypeptides for characteristics of interest. Non-limiting examples of methods for screening polypeptides expressed in yeast and for expression of polypeptides in yeast are described in Boder and Wittrup, Yeast surface display for screening combinatorial polypeptide libraries, Nature Biotechnology, 15:553-557 (1997). Further non-limiting examples of methods for rapid screening and characterization of polypeptides expressed in yeast are provided in Van Deventer, J. A.; Kelly, R. L. et al. Protein Eng Des Sel 2015, 28, 317; Van Deventer, J. A. et al, Protein Eng Des Sel 2016, 29, 485-94; Stieglitz, J. T., Kehoe, H. P., Lei, M. and Van Deventer, J. A., ACS Synth Biol 2018, 7 (9), 2256-2269; and Potts, K. A., Stieglitz, J. T., Lei, M., and Van Deventer, J. A., Mol. Syst. Des. Eng. 2020. 5, 573-588.
[0138] Various host cells may be used for this method, including those of prokaryotic, yeast, mammalian, insect, or plant cells. In various embodiments, the polypeptide comprising the noncanonical amino acid(s) of interest can be expressed in vitro. Non-limiting examples of prokaryotic host cells include Escherichia coli, Thermus thermophilus, Bacillus stearothermophilus. Examples of Archaea include, e.g., Methanococcus jannaschii, Methanosarcina mazei, Methanobacterium thermoautotrophicum, Methanococcus maripaludis, Methanopyrus kandleri, Halobacterium such as Haloferax volcanii and Halobacterium species NRC-1, Archaeoglobus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Pyrobaculum aerophilum, Pyrococcus abyssi, Sulfolobus solfataricus, Sulfolobus tokodaii, Aeuropyrum pernix, Thermoplasma acidophilum, and Thermoplasma volcanium. The precise host cell used is not critical to the invention. A polypeptide of the invention may be produced in a prokaryotic host (e.g., E. coli) or in a eukaryotic host (e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, or COS cells). Such cells are available from a wide range of sources (e.g., the American Type Culture Collection, Rockland, Md.; also, see, e.g., Ausubel et al., supra). The method of transformation or transfection and the choice of expression vehicle will depend on the host system selected. Transformation and transfection methods are described, e.g., in Ausubel et al. (supra); expression vehicles may be chosen from those provided, e.g., in Cloning Vectors: A Laboratory Manual (P. H. Pouwels et al., 1985, Supp. 1987). The host cell can be in in culture.
[0139] The polypeptide of interest can be a therapeutic protein, a diagnostic protein, an industrial enzyme, or portion thereof, and the like. In some cases, the polypeptide of interest is a growth factor, an antibody or a fragment thereof, a cytokine, a chemokine, an extracellular matrix protein, a polypeptide having an immune-modulatory function, an interleukin, an interferon, an immune-checkpoint blockade polypeptide, an antigen recognition polypeptide, a binding agent (e.g., fibronectin), or an alpha-helical peptide or ligand thereof. Examples of therapeutic, diagnostic, and other proteins that can be modified to comprise one or more noncanonical amino acids according to the methods of the present disclosure include, but are not limited to, e.g., Alpha-1 antitrypsin, Angiostatin, Antihemolytic factor, antibodies, Apolipoprotein, Apoprotein, Atrial natriuretic factor, Atrial natriuretic polypeptide, Atrial peptides, C-X-C chemokines (e.g., T39765, NAP-2, ENA-78, Gro-a, Gro-b, Gro-c, IP-10, GCP-2, NAP-4, SDF-1, PF4, MIG), Calcitonin, CC chemokines (e.g., Monocyte chemoattractant protein-1, Monocyte chemoattractant protein-2, Monocyte chemoattractant protein-3, Monocyte inflammatory protein-1 alpha, Monocyte inflammatory protein-1 beta, RANTES, 1309, R83915, R91733, HCC1, T58847, D31065, T64262), CD40 ligand, C-kit Ligand, Collagen, Colony stimulating factor (CSF), Complement factor 5a, Complement inhibitor, Complement receptor 1, cytokines, (e.g., epithelial Neutrophil Activating Peptide-78, GROa/MGSA, GRO?, GRO?, MIP-1?, MIP-1?, MCP-1), Epidermal Growth Factor (EGF), Erythropoietin (EPO), Exfoliating toxins A and B, Factor IX, Factor VII, Factor VIII, Factor X, Fibroblast Growth Factor (FGF), Fibrinogen, Fibronectin, G-CSF, GM-CSF, Glucocerebrosidase, Gonadotropin, growth factors, Hedgehog proteins (e.g., Sonic, Indian, Desert), Hemoglobin, Hepatocyte Growth Factor (HGF), Hirudin, Human serum albumin, Insulin, Insulin-like Growth Factor (IGF), interferons (e.g., IFN-?, IFN-?, IFN-?), interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, etc.), cytokines, Keratinocyte Growth Factor (KGF), Lactoferrin, leukemia inhibitory factor, Luciferase, Neurturin, Neutrophil inhibitory factor (NIF), oncostatin M, Osteogenic protein, Parathyroid hormone, PD-ECSF, PDGF, peptide hormones (e.g., Human Growth Hormone), Pleiotropin, Protein A, Protein G, Pyrogenic exotoxins A, B, and C, Relaxin, Renin, SCF, Soluble complement receptor I, Soluble I-CAM 1, Soluble interleukin receptors (IL-1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15), Soluble TNF receptor, Somatomedin, Somatostatin, Somatotropin, Streptokinase, Superantigens, i.e., Staphylococcal enterotoxins (SEA, SEB, SEC1, SEC2, SEC3, SED, SEE), Superoxide dismutase (SOD), Toxic shock syndrome toxin (TSST-1), Thymosin alpha 1, Tissue plasminogen activator, Tumor necrosis factor beta (TNF beta), Tumor necrosis factor receptor (TNFR), Tumor necrosis factor-alpha (TNF alpha), Vascular Endothelial Growth Factor (VEGF), Urokinase and many others.
[0140] In some embodiments, the polypeptide of interest is a transcriptional modulator or a portion thereof. Example transcriptional modulators include genes and transcriptional modulator proteins that modulate cell growth, differentiation, regulation, or the like. Transcriptional modulators are found in prokaryotes, viruses, and eukaryotes, including fungi, plants, yeasts, insects, and animals, including mammals, providing a wide range of therapeutic targets. It will be appreciated that expression and transcriptional activators regulate transcription by many mechanisms, e.g., by binding to receptors, stimulating a signal transduction cascade, regulating expression of transcription factors, binding to promoters and enhancers, binding to proteins that bind to promoters and enhancers, unwinding DNA, splicing pre-mRNA, polyadenylating RNA, and degrading RNA.
[0141] In some embodiments, the polypeptide of interest is an expression activator such as cytokines, inflammatory molecules, growth factors, their receptors, and oncogene products, e.g., interleukins (e.g., IL-1, IL-2, IL-8, etc.), interferons, FGF, IGF-I, IGF-II, FGF, PDGF, TNF, TGF-?, TGF-?, EGF, KGF, SCF/c-Kit, CD40L/CD40, VLA-4/VCAM-1, ICAM-1/LFA-1, and hyalurin/CD44; signal transduction molecules and corresponding oncogene products, e.g., Mos, Ras, Raf, and Met; and transcriptional activators and suppressors, e.g., p53, Tat, Fos, Myc, Jun, Myb, Rel, and steroid hormone receptors such as those for estrogen, progesterone, testosterone, aldosterone, the LDL receptor ligand and corticosterone.
[0142] The protein of interest can be an enzyme. Examples of enzymes include, but are not limited to, e.g., amidases, amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerases, kinases, glucose isomerases, glycosidases, glycosyl transferases, haloperoxidases, monooxygenases (e.g., p450s), lipases, lignin peroxidases, nitrile hydratases, nitrilases, proteases, phosphatases, subtilisins, transaminase, and nucleases.
[0143] The polypeptide of interest can be a protein from infectious fungi, e.g., Aspergillus, Candida species; bacteria, particularly E. coli, which serves a model for pathogenic bacteria, as well as medically important bacteria such as Staphylococcus spp. (e.g., S. aureus), or Streptococcus spp. (e.g., S. pneumoniae); protozoa such as sporozoa (e.g., Plasmodium spp.), rhizopods (e.g., Entamoeba spp.) and flagellates (Trypanosoma spp., Leishmania spp., Trichomonas spp., Giardia spp., etc.); viruses such as (+) RNA viruses (examples include Poxviruses e.g., vaccinia; Picornaviruses, e.g. polio; Togaviruses, e.g., rubella; Flaviviruses, e.g., HCV; and Coronaviruses), (?) RNA viruses (e.g., Rhabdoviruses, e.g., VSV; Paramyxoviruses, e.g., RSV; Orthomyxoviruses, e.g., influenza; Bunyaviruses; and Arenaviruses), dsDNA viruses (Reoviruses, for example), RNA to DNA viruses, i.e., Retroviruses, e.g., HIV and HTLV, and certain DNA to RNA viruses such as Hepatitis B.
[0144] The polypeptide of interest can be an agriculturally related protein. Non-limiting examples of agriculturally related proteins include insect resistance proteins (e.g., the Cry proteins), starch and lipid production enzymes, plant and insect toxins, toxin-resistance proteins, Mycotoxin detoxification proteins, plant growth enzymes (e.g., Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase, RUBISCO), lipoxygenase (LOX), and Phosphoenolpyruvate (PEP) carboxylase.
Pharmaceutical Compositions
[0145] The present invention contemplates pharmaceutical preparations comprising polypeptides produced by the methods of the present disclosure, together with pharmaceutically acceptable carriers. Polypeptides of the invention may be administered as part of a pharmaceutical composition. The compositions should be sterile and contain a therapeutically effective amount of the polypeptides in a unit of weight or volume suitable for administration to a subject.
[0146] Pharmaceutical compositions of the invention to be used for therapeutic administration should be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 mm membranes), by gamma irradiation, or any other suitable means known to those skilled in the art. Therapeutic polypeptide compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle. These compositions ordinarily will be stored in unit or multi-dose containers, for example, sealed ampoules or vials, as an aqueous solution or as a lyophilized formulation for reconstitution. A composition for infusion can be prepared by reconstituting the lyophilized material using sterile Water-for-Injection (WFI).
[0147] The polypeptides may be combined, optionally, with a pharmaceutically acceptable excipient. The term pharmaceutically-acceptable excipient as used herein means one or more compatible solid or liquid filler, diluents or encapsulating substances that are suitable for administration into a human. The term carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate administration. The components of the pharmaceutical compositions also are capable of being co-mingled with the molecules of the present invention, and with each other, in a manner such that there is no interaction that would substantially impair the desired pharmaceutical efficacy.
[0148] Polypeptides of the present invention can be contained in a pharmaceutically acceptable excipient. The excipient preferably contains minor amounts of additives such as substances that enhance isotonicity and chemical stability. Such materials are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, succinate, acetate, lactate, tartrate, and other organic acids or their salts; tris-hydroxymethylaminomethane (TRIS), bicarbonate, carbonate, and other organic bases and their salts; antioxidants, such as ascorbic acid; low molecular weight (for example, less than about ten residues) polypeptides, e.g., polyarginine, polylysine, polyglutamate and polyaspartate; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers, such as polyvinylpyrrolidone (PVP), polypropylene glycols (PPGs), and polyethylene glycols (PEGs); amino acids, such as glycine, glutamic acid, aspartic acid, histidine, lysine, or arginine; monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, mannose, sucrose, dextrins or sulfated carbohydrate derivatives, such as heparin, chondroitin sulfate or dextran sulfate; polyvalent metal ions, such as divalent metal ions including calcium ions, magnesium ions and manganese ions; chelating agents, such as ethylenediamine tetraacetic acid (EDTA); sugar alcohols, such as mannitol or sorbitol; counterions, such as sodium or ammonium; and/or nonionic surfactants, such as polysorbates or poloxamers. Other additives may be included, such as stabilizers, anti-microbials, inert gases, fluid and nutrient replenishers (i.e., Ringer's dextrose), electrolyte replenishers, and the like, which can be present in conventional amounts.
[0149] The compositions can be administered in effective amounts. The effective amount will depend upon the mode of administration, the particular condition being treated and the desired outcome. It may also depend upon the stage of the condition, the age and physical condition of the subject, the nature of concurrent therapy, if any, and like factors well known to the medical practitioner. For therapeutic applications, it is that amount sufficient to achieve a medically desirable result.
[0150] A variety of administration routes are available. The methods of the invention, generally speaking, may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces effective levels of the active compounds without causing clinically unacceptable adverse effects. In one embodiment, a composition of the invention comprising a polypeptide comprising a noncanonical amino acid is administered by any of various modes including inhalation, oral, rectal, topical, intraocular, buccal, intravaginal, intracisternal, intracerebroventricular, intratracheal, nasal, transdermal, within/on implants, e.g., fibers such as collagen, osmotic pumps, or grafts comprising appropriately transformed cells, etc., or parenteral routes. A particular method of administration involves coating, embedding or derivatizing fibers, such as collagen fibers, protein polymers, etc. with therapeutic proteins. Other useful approaches are described in Otto, D. et al., J. Neurosci. Res. 22: 83-91 and in Otto, D. and Unsicker, K. J. Neurosci. 10: 1912-1921.
[0151] The term parenteral includes subcutaneous, intrathecal, intravenous, intramuscular, intraperitoneal, or infusion. Intravenous or intramuscular routes are not particularly suitable for long-term therapy and prophylaxis. They could, however, be preferred in emergency situations. Compositions comprising polypeptides produced by the methods of the present disclosure can be added to a physiological fluid such as blood or synovial fluid. For CNS administration, a variety of techniques are available for promoting transfer of the therapeutic across the blood brain barrier including disruption by surgery or injection, drugs which transiently open adhesion contact between the CNS vasculature endothelial cells, and compounds that facilitate translocation through such cells. Oral administration can be preferred for prophylactic treatment because of the convenience to the patient as well as the dosing schedule.
[0152] Pharmaceutical compositions of the invention can optionally further contain one or more additional proteins as desired, including plasma proteins, proteases, and other biological material, so long as it does not cause adverse effects upon administration to a subject. Suitable proteins or biological material may be obtained from human or mammalian plasma by any of the purification methods known and available to those skilled in the art; from supernatants, extracts, or lysates of recombinant tissue culture, viruses, yeast, bacteria, or the like that contain a gene that expresses a human or mammalian plasma protein which has been introduced according to standard recombinant DNA techniques; or from the fluids (e.g., blood, milk, lymph, urine or the like) or transgenic animals that contain a gene that expresses a human plasma protein which has been introduced according to standard transgenic techniques.
[0153] Pharmaceutical compositions of the invention can comprise one or more pH buffering compounds to maintain the pH of the formulation at a predetermined level that reflects physiological pH, such as in the range of about 5.0 to about 8.0. The pH buffering compound used in the aqueous liquid formulation can be an amino acid or mixture of amino acids, such as histidine or a mixture of amino acids such as histidine and glycine. Alternatively, the pH buffering compound is preferably an agent which maintains the pH of the formulation at a predetermined level, such as in the range of about 5.0 to about 8.0, and which does not chelate calcium ions. Illustrative examples of such pH buffering compounds include, but are not limited to, imidazole and acetate ions. The pH buffering compound may be present in any amount suitable to maintain the pH of the formulation at a predetermined level.
[0154] Pharmaceutical compositions of the invention can also contain one or more osmotic modulating agents, i.e., a compound that modulates the osmotic properties (e.g., tonicity, osmolality and/or osmotic pressure) of the formulation to a level that is acceptable to the blood stream and blood cells of recipient individuals. The osmotic modulating agent can be an agent that does not chelate calcium ions. The osmotic modulating agent can be any compound known or available to those skilled in the art that modulates the osmotic properties of the formulation. One skilled in the art may empirically determine the suitability of a given osmotic modulating agent for use in the inventive formulation. Illustrative examples of suitable types of osmotic modulating agents include, but are not limited to: salts, such as sodium chloride and sodium acetate; sugars, such as sucrose, dextrose, and mannitol; amino acids, such as glycine; and mixtures of one or more of these agents and/or types of agents. The osmotic modulating agent(s) may be present in any concentration sufficient to modulate the osmotic properties of the formulation.
[0155] Compositions comprising polypeptides comprising noncanonical amino acids and produced by methods of the present disclosure can contain multivalent metal ions, such as calcium ions, magnesium ions and/or manganese ions. Any multivalent metal ion that helps stabilize the polypeptide composition and that will not adversely affect recipient individuals may be used. The skilled artisan, based on these two criteria, can determine suitable metal ions empirically and suitable sources of such metal ions are known, and include inorganic and organic salts.
[0156] Pharmaceutical compositions of the invention can also be a non-aqueous liquid formulation. Any suitable non-aqueous liquid may be employed, provided that it provides stability to the active agents (s) contained therein. Preferably, the non-aqueous liquid is a hydrophilic liquid. Illustrative examples of suitable non-aqueous liquids include: glycerol; dimethyl sulfoxide (DMSO); polydimethylsiloxane (PMS); ethylene glycols, such as ethylene glycol, diethylene glycol, triethylene glycol, polyethylene glycol (PEG) 200, PEG 300, and PEG 400; and propylene glycols, such as dipropylene glycol, tripropylene glycol, polypropylene glycol (PPG) 425, PPG 725, PPG 1000, PPG 2000, PPG 3000 and PPG 4000. Pharmaceutical compositions of the invention can also be a mixed aqueous/non-aqueous liquid formulation. Any suitable non-aqueous liquid formulation, such as those described above, can be employed along with any aqueous liquid formulation, such as those described above, provided that the mixed aqueous/non-aqueous liquid formulation provides stability to the polypeptide contained therein. Preferably, the non-aqueous liquid in such a formulation is a hydrophilic liquid. Illustrative examples of suitable non-aqueous liquids include: glycerol; DMSO; PMS; ethylene glycols, such as PEG 200, PEG 300, and PEG 400; and propylene glycols, such as PPG 425, PPG 725, PPG 1000, PPG 2000, PPG 3000 and PPG 4000. Suitable stable formulations can permit storage of the active agents in a frozen or an unfrozen liquid state. Stable liquid formulations can be stored at a temperature of at least ?70? C., but can also be stored at higher temperatures of at least 0? C., or between about 0.1? C. and about 42? C., depending on the properties of the composition. It is generally known to the skilled artisan that proteins and polypeptides are sensitive to changes in pH, temperature, and a multiplicity of other factors that may affect therapeutic efficacy.
[0157] In certain embodiments a desirable route of administration can be by pulmonary aerosol. Techniques for preparing aerosol delivery systems containing polypeptides are well known to those of skill in the art. Generally, such systems should utilize components that will not significantly impair the biological properties of the antibodies, such as the paratope binding capacity (see, for example, Sciarra and Cutie, Aerosols, in Remington's Pharmaceutical Sciences, 18th edition, 1990, pp 1694-1712; incorporated by reference). Those of skill in the art can readily modify the various parameters and conditions for producing polypeptide aerosols without resorting to undue experimentation.
[0158] Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of polypeptides, increasing convenience to the subject and the physician. Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as polylactides (U.S. Pat. No. 3,773,919; European Patent No. 58,481), poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acids, such as poly-D-(?)-3-hydroxybutyric acid (European Patent No. 133, 988), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman, K. R. et al., Biopolymers 22: 547-556), poly (2-hydroxyethyl methacrylate) or ethylene vinyl acetate (Langer, R. et al., J. Biomed. Mater. Res. 15:267-277; Langer, R. Chem. Tech. 12:98-105), and polyanhydrides.
[0159] Other examples of sustained-release compositions include semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules. Delivery systems also include non-polymer systems that are: lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-di- and tri-glycerides; hydrogel release systems such as biologically-derived bioresorbable hydrogel (i.e., chitin hydrogels or chitosan hydrogels); sylastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
[0160] Another type of delivery system that can be used with the methods and compositions of the invention is a colloidal dispersion system. Colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. Liposomes are artificial membrane vessels, which are useful as a delivery vector in vivo or in vitro. Large unilamellar vessels (LUV), which range in size from 0.2-4.0 ?m, can encapsulate large macromolecules within the aqueous interior and be delivered to cells in a biologically active form (Fraley, R., and Papahadjopoulos, D., Trends Biochem. Sci. 6: 77-80).
[0161] Liposomes can be targeted to a particular tissue by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein. Liposomes are commercially available from Gibco BRL, for example, as LIPOFECTIN? and LIPOFECTACE?, which are formed of cationic lipids such as N-[1-(2, 3 dioleyloxy)-propyl]-N, N, N-trimethylammonium chloride (DOTMA) and dimethyl dioctadecylammonium bromide (DDAB). Methods for making liposomes are well known in the art and have been described in many publications, for example, in DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. (USA) 82:3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci. (USA) 77:4030-4034 (1980); EP 52,322; EP 36,676; EP 88, 046; EP 143,949; EP 142,641; Japanese Pat. Appl. 83-118008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324. Liposomes also have been reviewed by Gregoriadis, G., Trends Biotechnol., 3: 235-241).
[0162] Another type of vehicle is a biocompatible microparticle or implant that is suitable for implantation into the mammalian recipient. Exemplary bioerodible implants that are useful in accordance with this method are described in PCT International application no. PCT/US/03307 (Publication No. WO 95/24929, entitled Polymeric Gene Delivery System). PCT/US/03307 describes biocompatible, preferably biodegradable polymeric matrices for containing an exogenous gene under the control of an appropriate promoter. The polymeric matrices can be used to achieve sustained release of the exogenous gene or gene product in the subject.
[0163] The polymeric matrix preferably is in the form of a microparticle such as a microsphere (wherein an agent is dispersed throughout a solid polymeric matrix) or a microcapsule (wherein an agent is stored in the core of a polymeric shell). Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075,109. Other forms of the polymeric matrix for containing an agent include films, coatings, gels, implants, and stents. The size and composition of the polymeric matrix device is selected to result in favorable release kinetics in the tissue into which the matrix is introduced. The size of the polymeric matrix further is selected according to the method of delivery that is to be used. Preferably, when an aerosol route is used the polymeric matrix and polypeptides are encompassed in a surfactant vehicle. The polymeric matrix composition can be selected to have both favorable degradation rates and also to be formed of a material, which is a bioadhesive, to further increase the effectiveness of transfer. The matrix composition also can be selected not to degrade, but rather to release by diffusion over an extended period of time. The delivery system can also be a biocompatible microsphere that is suitable for local, site-specific delivery. Such microspheres are disclosed in Chickering, D. E., et al., Biotechnol. Bioeng., 52: 96-101; Mathiowitz, E., et al., Nature 386: 410-414.
[0164] Both non-biodegradable and biodegradable polymeric matrices can be used to deliver the polypeptide compositions of the invention to the subject. Such polymers may be natural or synthetic polymers. The polymer is selected based on the period of time over which release is desired, generally in the order of a few hours to a year or longer. Typically, release over a period ranging from between a few hours and three to twelve months is most desirable. The polymer optionally is in the form of a hydrogel that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multivalent ions or other polymers.
[0165] Exemplary synthetic polymers which can be used to form the biodegradable delivery system include: polyamides, polycarbonates, polyalkylenes, polyalkylene glycols, polyalkylene oxides, polyalkylene terepthalates, polyvinyl alcohols, polyvinyl ethers, polyvinyl esters, poly-vinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes and co-polymers thereof, alkyl cellulose, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, polymers of acrylic and methacrylic esters, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxy-propyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate, cellulose acetate butyrate, cellulose acetate phthalate, carboxylethyl cellulose, cellulose triacetate, cellulose sulphate sodium salt, poly(methyl methacrylate), poly(ethyl methacrylate), poly(butylmethacrylate), poly(isobutyl methacrylate), poly(hexylmethacrylate), poly(isodecyl methacrylate), poly(lauryl methacrylate), poly(phenyl methacrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate), polyethylene, polypropylene, poly(ethylene glycol), poly(ethylene oxide), poly(ethylene terephthalate), poly(vinyl alcohols), polyvinyl acetate, poly vinyl chloride, polystyrene, polyvinylpyrrolidone, and polymers of lactic acid and glycolic acid, polyanhydrides, poly(ortho)esters, poly(butic acid), poly(valeric acid), and poly(lactide-cocaprolactone), and natural polymers such as alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof. In general, these materials degrade either by enzymatic hydrolysis or exposure to water in vivo, by surface or bulk erosion.
Kits
[0166] The invention provides kits for the incorporation of noncanonical amino acids into a polypeptide of interest. The invention also provides for kits comprising a pharmaceutical composition comprising a polypeptide comprising a noncanonical amino acid produced by the methods of the present invention for administration to a subject. The agents described herein may, in some embodiments, be assembled into pharmaceutical or diagnostic or research kits to facilitate their use in therapeutic, diagnostic or research applications. In certain embodiments agents in a kit may be suitable for use in the production of polypeptides comprising noncanonical amino acids and/or for use in screens for polypeptides comprising noncanonical amino acids and having improved characteristics. Kits for research purposes may contain the components in appropriate concentrations or quantities for running various experiments.
[0167] Kits may include ampules or aliquots of compositions of the present invention. Kits may also contain devices necessary for use of components of the kit in various methods of the present disclosure. In some embodiments, the kit comprises a sterile container which contains a composition (e.g., a therapeutic or prophylactic composition); such containers can be boxes, ampoules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
[0168] The kit may be designed to facilitate the methods described herein. Each of the compositions of the kit, where applicable, may be provided in liquid form (e.g., in solution), or in solid form, (e.g., a dry powder). In certain cases, some of the compositions may be constitutable or otherwise processable (e.g., to an active form), for example, by the addition of a suitable solvent or other species (for example, water or another suitable solvent), which may or may not be provided with the kit. In some embodiments, the kit contains one or more of the cells described herein. The kit can contain a yeast cell.
[0169] The kit may contain any one or more of the components described herein in one or more containers. As an example, in one embodiment, the kit may include instructions for mixing one or more components of the kit and/or isolating and mixing a sample. The kit may contain instructions for administering a composition of the kit to a subject. The kit may include a container housing agents described herein. The agents may be in the form of a liquid, gel or solid (powder). The agents may be prepared sterilely, packaged in syringe and shipped refrigerated. A second container may comprise other agents prepared sterilely. Alternatively the kit may include agents premixed and shipped in a syringe, vial, tube, or other container. The kit may have one or more or all of the components useful to administer the agents to a subject, such as a syringe, topical application devices, or intravenous needle tubing and bag.
[0170] The instructions contained in the kit will generally include information about the use of the compositions of the kit in the methods of the present disclosure. In other embodiments, the instructions include at least one of the following: safety information; information describing how to use components of the kit in the methods of the present disclosure; and/or references. The instructions may be printed directly on the container (when present), provided on a transportable storage medium, stored on a remote server, or provided as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container. Instructions also can include any oral or electronic instructions provided in any manner such that a user will clearly recognize that the instructions are to be associated with the kit, for example, audiovisual (e.g., videotape, DVD, etc.), internet, and/or web-based communications, etc. The written instructions may be in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which instructions can also reflect approval by the agency of manufacture, use or sale for animal administration.
[0171] The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, 1989); Oligonucleotide Synthesis (Gait, 1984); Animal Cell Culture (Freshney, 1987); Methods in Enzymology Handbook of Experimental Immunology (Weir, 1996); Gene Transfer Vectors for Mammalian Cells (Miller and Calos, 1987); Current Protocols in Molecular Biology (Ausubel, 1987); PCR: The Polymerase Chain Reaction, (Mullis, 1994); Current Protocols in Immunology (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
[0172] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.
EXAMPLES
Example 1. E. coli Aminoacyl-tRNA Synthetase (aaRS) Saturation Mutagenesis Library Design
[0173] To identify aminoacyl-tRNA synthetases (aaRSs) capable of coupling versatile noncanonical amino acids (ncAAs) to tRNA.sub.CUA (transfer RNA with a CUA anticodon), two saturation mutagenesis libraries were constructed of the E. coli Tyrosyl-tRNA synthetase (EcTyrRS) and the E. coli Leucyl-tRNA synthetase (EcLeuRS) (
Example 2. E. coli Aminoacyl-tRNA Synthetase (aaRS) Saturation Mutagenesis Library Construction
[0174] A yeast display system was used to report on noncanonical amino acid (ncAA) incorporation during screens with fluorescence-activated cell sorting (FACS). The reporter supported highly stringent screening conditions and both positive and negative screens in the same library populations. Additionally, with a series of controls and set conditions, a quantitative measurement of noncanonical amino acid (ncAA) incorporation for individual aminoacyl-tRNA synthetase (aaRS) variants identified from screening were reported for comparison of aminoacyl-tRNA synthetase (aaRS) activity against wildtype protein translation. Both libraries were constructed in S. cerevisiae RJY100 using homologous recombination and then evaluated for aminoacyl-tRNA synthetase (aaRS) activity and sequence diversity (Tables 1-5). The theoretical diversity of the EcTyrRS (E. coli Tyrosyl-tRNA synthetase) library was 1.3?10.sup.8, and the actual number of transformants was calculated to be 1?10.sup.7 and all 10 random clones that were sequenced were unique (Table 12). The theoretical diversity of the E. coli Leucyl-tRNA synthetase (EcLeuRS) library was 1.9?10.sup.7, and the calculated number of transformants was 3?10.sup.6. Sequence characterization of the E. coli Leucyl-tRNA synthetase (EcLeuRS) library revealed that out of ten clones, the last two positions chosen for mutation (Y527 and H537) were disproportionately wild type residues (Table 13). To correct the lack of mutations in those active site residues, a second library was constructed with modified primers and was determined to contain 1?10.sup.7 transformants (Table 5). Sequence characterization of nine clones from the reconstructed E. coli Leucyl-tRNA synthetase (EcLeuRS) library revealed that all active site positions contained expected mutations (Table 14). In order to facilitate screening, both the E. coli Tyrosyl-tRNA synthetase (EcTyrRS) and E. coli Leucyl-tRNA synthetase (EcLeuRS) libraries were pooled prior to sorting (
TABLE-US-00005 TABLE 1 Tyrosyl-tRNA synthetase (TyrRS) library theoretical diversity. Position Codon # Codons Y37 VNK + TAT 25 L71 VNK 24 Q179 VNK 24 D182 RRT 4 F183 VNK 24 L186 KYA 4 Q195 VNK 24 Theoretical Diversity 1.3E8
TABLE-US-00006 TABLE2 Tyrosyl-tRNAsynthetase(TyrRS)library primerdesign. SEQ SEQ Posi- ID ID tion Forward NO: Reverse NO: Y37 GAGCGACTGGCGCA 6 GCTGTCAGCGGTAG 11 AGGCCCGATCGCGC GATCGAAGCCGCAM TCVNKTGCGGCTTC NBGAGCGCGATCGG GATCCTACCGCTGA GCCTTGCGCCAGTC CAGC GCTC Y37 GAGCGACTGGCGCA 7 GCTGTCAGCGGTAG 12 AGGCCCGATCGCGC GATCGAAGCCGCAA TCTATTGCGGCTTC TAGAGCGCGATCGG GATCCTACCGCTGA GCCTTGCGCCAGTC CAGC GCTC L41 CAGCAGGCGGGCCA 8 GTCGCCAATCAGAC 13 CAAGCCGGTTGCGV CCGTCGCGCCGCCM NKGTAGGCGGCGCG NBTACCGCAACCGG ACGGGTCTGATTGG CTGTGGCCCGCCTG CGAC CTG Q179, CGTTCACTGAGTTT 9 CAATTTGCAGCACC 14 D182, TCCTACAACCTGTT ACACCGTACTGTTT F183, GVNKGGTTATRRTV GTTTRMACAGGCMN L186 NKGCCTGTKYAAAC BAYYATAACCMNBC AAACAGTACGGTGT AACAGGTTGTAGGA GGTGCTGCAAATTG AAACTCAGTGAACG Q195 GTGCTAACAAACAG 10 GTTACCCCACTGGT 15 TACGGTGTGGRGCT CAGAACCAACCAAT GVNKATTGGTGGTT MNBCAGCACCACAC CTGACCAGTGGGG CGTACTGTTTGTTA TAAC GCAC
TABLE-US-00007 TABLE 3 LeuRS library theoretical diversity. Position Codon # Codons M40 VNK 24 L41 VNK 24 T252 GCT 1 S496 RST 4 Y499 NNY 32 Y527 NNT 16 H537 NNT 16 Theoretical Diversity 1.9E7
TABLE-US-00008 TABLE4 LeuRSLibraryPrimersA. SEQ SEQ Posi- ID ID tion Forward NO: Reverse NO: M40, GCAAAGAGAAGTAT 16 CATGTGTAGTCGAC 21 L41 TACTGCCTGTCTVN CAGAAGGATAGGGM KVNKCCCTATCCTT NBMNBAGACAGGCA CTGGTCGACTACAC GTAATACTTCTCTT ATG TGC T252 CTGACCGTTTACAC 17 GCTACCGCCAGGTA 22 TACCCGCCCGGACG GGTACAACCCATAA CTTTTATGGGTTGT AAGCGTCCGGGCGG ACCTACCTGGCGGT GTAGTGTAAACGGT AGC CAG S496, GAAACCGACACTTT 18 CTTTGTACTGCGGG 23 Y499 CGACACCTTTATGG CAAGTGTAGCGCGC AGRSTTCCTGGNNY ATARNNCCAGGAAS TATGCGCGCTACAC YCTCCATAAAGGTG TTGCCCGCAGTACA TCGAAAGTGTCGGT AAG TTC Y527 GCGGCTAACTACTG 19 CATAATGGCGTGTT 24 GCTGCCGGTGGATA CAATACCACCAATA TCNNTATTGGTGGT NNGATATCCACCGG ATTGAACACGCCAT CAGCCAGTAGTTAG TATG CCGC H537 TATTGGTGGTATTG 20 GTTTGTGGAAGAAG 25 AACACGCCATTATG CGGAAGTAGAGCAG NNTCTGCTCTACTT ANNCATAATGGCGT CCGCTTCTTCCACA GTTCAATACCACCA AAC ATA
TABLE-US-00009 TABLE5 LeuRSLibraryPrimersB. SEQ SEQ Posi- ID ID tion Forward NO: Reverse NO: M40, GCAAAGAGAAGTAT 16 CATGTGTAGTCGAC 21 L41 TACTGCCTGTCTVN CAGAAGGATAGGGM KVNKCCCTATCCTT NBMNBAGACAGGCA CTGGTCGACTACAC GTAATACTTCTCTT ATG TGC T252 CTGACCGTTTACAC 17 GCTACCGCCAGGTA 28 TACCCGCCCGGACG GGTACAACCCATAA CTTTTATGGGTTGT AAGCGTCCGGGCGG ACCTACCTGGCGGT GTAGTAGTAAACGG AGC TCAG S496, CAAACCGACACTTT 26 CTTTGTACTGCGGG 23 Y499 CGACACCTTTATGG CAAGTGTAGCGCGC AGRSTTCCTGGNNY ATARNNCCAGGAAS TATGCGCGCTACAC YCTCCATAAAGGTG TTGCCCGCAGTACA TCGAAAGTGTCGGT AAG TTC Y527, GCGGCTAACTACTG 27 CAGTTTGTGGAAGA 29 H537 GCTGCCGGTTGGAT AGCGGAAGTAGAGC ATCNNTATTGGTGG AGANNCATAATGGC TATTGAACACGCCA GTGTTCAATACCAC TTATGNNTCTGCTC CAATANNGATATCC TACTTCCGCTTCTT ACCGGCAGCCAGTA CCACAAACTG GTTAGCCGC
Example 3. Screening Aminoacyl-tRNA Synthetase (aaRS) Libraries
[0175] Combined EcTyrRS (E. coli Tyrosyl-tRNA synthetase) and EcLeuRS (E. coli Leucyl-tRNA synthetase) libraries were screened against several aromatic and aliphatic noncanonical amino acid (ncAA) targets to isolate aminoacyl-tRNA synthetases (aaRSs) capable of charging diverse and unique noncanonical amino acids (ncAAs) (
TABLE-US-00010 TABLE 6 Sequences of aaRSs from FIG. 3. Position I37 L71 Q179 G182 M183 A186 Q195 TyrRS A-OmeRS-7 L L Q G M A Q A-BPheRS-2 G T N S V E I A-DOPARS-4 Q M S D T V I B-OPGRS-L6 V I Q G M A Q Position M40 L41 T252 S496 Y499 Y527 H537 LenRS A-ATyrRS-1 L T T A H S G A-LysN4RS G P T T C Y G
TABLE-US-00011 TABLE 7 Experimental details relating to sorting. Sort 1 was performed on MoFlo for aaRSs marked with an asterisk (*). aaRS Sort 1 Sort 2 Sort 3 Sort 4 Sort 5 Sort 6 Sort 7 A-OmeRS-7* +1 mM OmeY Negative +1 mM OmeY N/A N/A N/A N/A A-BPheRS-2 +1 mM BPhe Negative +1 mM BPhe Negative +1 mM BPhe N/A N/A A-DOPARS-4* +1 mM DOPA Negative +1 mM DOPA +1 mM DOPA +1 mM DOPA N/A N/A A-ATyrRS-1* +1 mM ATyr Negative +1 mM ATyr +1 mM ATyr +1 mM ATyr Negative +1 mM ATyr A-LysN3RS-1 +1 mM LysN3 Negative +1 mM LysN3 +1 mM LysN3 N/A N/A N/A B-OPGRS-L6 +1 mM OPG Negative +1 mM OPG N/A N/A N/A N/A
TABLE-US-00012 TABLE 8 TyrRS clone mutations. TyrRS Position Y37 L71 V72 Q179 D182 F183 L186 Q195 Codon VNK + TAT VNK N/A VNK RRT VNK KYA VNK A-OmeRS-1 L V V Q G M A Q A-OmeRS-2 I L V Q G M A Q A-OmeRS-3 G R V P S P L S A-OmeRS-4 I L V Q G M A Q A-OmeRS-5 I L V Q G M A Q A-OmeRS-6 I L V Q G M A Q A-OmeRS-7 L L V Q G M A Q A-OmeRS-8 I L V Q G M A Q A-OmeRS-9 I L V Q G M A Q A-OmeRS-10 L L V Q G M A Q A-DOPARS-1 E L V Q G M A T A-DOPARS-2 L L V G D T V L A-DOPARS-3 T L V M D N L V A-DOPARS-4 Q M V S D T V I A-DOPARS-5 E V V Q G M A V A-DOPARS-6 E L V Q G M A T A-DOPARS-7 T I V M D M A K A-DOPARS-8 T I V M D M A K A-DOPARS-9 E V M Q G M A T A-LysN3RS- V V V A D T S I 1.1 A-LysN3RS- A M V Q D T V V 1.2 A-LysN3RS- L V V N D I L Q 1.3 A-LysN3RS- I L V Q D G L Q 1.5 A-LysN3RS- I L V Q D V A L 1.9 A-LysN3RS- A M V Q D T V G 1.10 A-LysN3RS- L D V L D T L V 1.11 A-BPheRS-1 E I V L S I S E A-BPheRS-2 G T V N S V E I A-BPheRS-3 A L V P D T L A A-BPheRS-4 G T V N S V E I A-BPheRS-5 M V R Q D L A S A-BPheRS-6 V V L V D T A L A-BPheRS-7 G T V N S V E I A-BPheRS-8 L V V N D L S Q A-BPheRS-9 G T V N S V E I A-BPheRS-10 E I V L S I S E A-BPheRS-11 G T V N S V E I A-BPheRS-12 G T V N S V E I A-ATyrRS-4 L L V M D Q A S A-ATyrRS-6 L V V D D T A E A-ATyrRS-7 L M V N D I S L A-ATyrRS-8 L L V M D Q A S A-ATyrRS-10 E V V H D V L I B-OPGRS-H1 V V T Q G M A Q B-OPGRS-H2 I L V Q G M A Q B-OPGRS-L1 I L V Q G M A Q B-OPGRS-L2 I L V Q G M A Q B-OPGRS-L3 I L V Q G M A Q B-OPGRS-L4 I L V Q G M A Q B-OPGRS-L5 I L V Q G M A Q B-OPGRS-L6 V I V Q G M A Q B-OPGRS-L7 I L V Q G M A Q B-OPGRS-L8 T L V Q G M A Q B-OPGRS-L9 I L V Q G M A Q B-OPGRS-L10 M L V Q S R L Q SpecOPGRS-1 A V V P S L A E SpecOPGRS-2 T V H Q G M A Q SpecOPGRS-3 G T V A S L A E SpecOPGRS-4 G V Q Q S T A E SpecOPGRS-5 G T V A S L A E SpecOPGRS-7 T L V E S T L L SpecOPGRS-9 T V A Q G M A Q SpecOPGRS-10 G T V A S L A E SpecOPGRS-12 T V T Q G M A Q PolyT1RS-2 L L V Q G M A Q PolyT1RS-3 I L V Q G M A Q PolyT1RS-4 I L V Q G M A Q PolyT1RS-5 I L V Q G M A Q PolyT1RS-6 I L V Q G M A Q PolyT1RS-7 V L V Q G M A Q PolyT1RS-9 I L V Q G M A Q PolyT1RS-10 I L V Q G M A Q PolyT1RS-11 I L V Q G M A Q PolyT1RS-12 T L V Q G M A Q Poly T2RS-2 L V V Q G M A Q Poly T2RS-3 I L V Q G M A Q PolyT2RS-4 V V V Q G M A Q PolyT2RS-5 V V I Q G M A Q Poly T2RS-6 I V V Q G M A Q PolyT2RS-8 I L V Q G M A Q PolyT2RS-9 V V I Q G M A Q PolyT2RS-10 V V V Q G M A Q PolyT2RS-11 L V V Q G M A Q
TABLE-US-00013 TABLE 9 LeuRS clone mutations. LeuRS Position M40 L41 T252 S496 Y499 Y527 H537 Codon VNK VNK GCT RST NNY NNT NNT Notes A-LysN3RS-1 G P T T C Y G A-LysN3RS-2 L P T T I G G A-LysN3RS-3 A G T S G N C A-LysN3RS-1.4 G P T T L G F A-LysN3RS-1.6 A N T S N G F A-LysN3RS-1.7 G T T G T T G A-LysN3RS-1.8 G E T T C Y G A-ATyrRS-1 L T T A H S G A-ATyrRS-2 L T T A H S G A-ATyrRS-3 L T T A H S G A-ATyrRS-5 L T T A H S G A-ATyrRS-9 L T T A G T G A-ATyrRS-12 Q G T S Y Y H SpecOPGRS-6 L T A A T T G SpecOPGRS-8 L T A A C C G SpecOPGRS-11 L T A A T T G PolyT1RS-8 L A A A S D S Poly T2RS-7 G E A T H F G Q2K mutation PolyT2RS-12 G A A A S F A B-BockRS-1 P A A G G I G B-BockRS-2 A G A S G T G B-BockRS-3 G A A A C I G B-BockRS-4 A G A S G T G B-BockRS-5 A G A S G T G B-BockRS-6 A G A S G T G B-BockRS-7 A G A S G T G B-BockRS-8 A G A S G T G B-BockRS-9 G G A T T F G B-BockRS-10 P G A G A V G B-BockRS-11 P G A S L T G B-BockRS-12 A A A G A C G B-LysAlkRS-1 A G A S V I G B-LysAlkRS-2 S P A G T V G B-LysAlkRS-3 M H A G A G G B-LysAlkRS-4 G V A G T V L B-LysAlkRS-5 P G A G C C G B-LysAlkRS-6 A G A S G T G B-LysAlkRS-7 A G A S G T G B-LysAlkRS-8 A G A S G T G B-LysAlkRS-9 A G A S G T G B-LysAlkRS-10 M L A G F S G B-LysAlkRS-11 A G A S G T G B-LysAlkRS-12 A G A S G T G B-LysN3RS-1 G P A G A C G B-LysN3RS-2 P G A G A V G B-LysN3RS-3 P G A G A C G B-LysN3RS-4 P G A G C C G B-LysN3RS-5 P G A G C C G B-LysN3RS-6 A P A G G H G B-LysN3RS-7 S P A G I H G B-LysN3RS-8 A P A G G H G B-LysN3RS-9 A G A S G T G B-LysN3RS-10 A G A S G T G B-LysN3RS-11 S P A G I H G B-LysN3RS-12 P G A G C C G
Example 4. Error-Prone Polymerase Chain Reaction (epPCR) Library Construction and Screening
[0176] While aminoacyl-tRNA synthetases (aaRSs) capable of charging new noncanonical amino acids (ncAAs) were obtained from the EcTyrRS (E. coli Tyrosyl-tRNA synthetase) and E. coli Leucyl-tRNA synthetase (EcLeuRS) libraries from the initial sorts, some clones exhibited low support of stop codon readthrough. Work was done to improve one of these aminoacyl-tRNA synthetases (aaRSs) for charging of its cognate noncanonical amino acid (ncAA). EcTyrRS (E. coli Tyrosyl-tRNA synthetase) mutants that charge DOPA (7), A-DOPARS-8, was amplified via PCR with two concentrations of mutagenic dNTPs to cause random point mutations across the aminoacyl-tRNA synthetase (aaRS) gene. The lower concentration (1?) of mutagenic reagents was expected to cause 1-3 point mutations and the higher concentration (5?) was expected to cause 5-15 point mutations per gene. The two error-prone polymerase chain reaction (epPCR) libraries, DOPARS-1? and DOPARS-5?, respectively, were constructed in S. cerevisiae RJY100 with 1.6?10.sup.7 transformants for DOPARS-1? and 2?10.sup.7 transformants for DOPARS-5?. Based on sequence characterization of 12 clones per library, the average number of point mutations in each library were four for DOPARS-1? and 17 for DOPARS-5?. Both libraries were screened via fluorescence-activated cell sorting (FACS) at both 1 mM and 0.1 mM DOPA. After one negative and four positive screens, with gradually reduced DOPA concentrations, aminoacyl-tRNA synthetases (aaRSs) with error-prone polymerase chain reaction (epPCR)-manufactured mutations outside of the active site were identified by their improved ability to charge DOPA as compared to the parent aminoacyl-tRNA synthetase (aaRS) at one or both noncanonical amino acid (ncAA) concentrations used in screening (
[0177] Sequence comparison between error-prone polymerase chain reaction (epPCR) DOPARS mutants (Table 10) revealed trends in the locations in the aminoacyl-tRNA synthetases (aaRSs) where mutations were more likely to occur. Many mutations occurred in or directly adjacent to the active site or in the tRNA binding domain.
TABLE-US-00014 TABLE 10 Error-prone PCR DOPARS sequences. Clone Q18 D21 T37 L49 K59 Q63 V108 A109 F111 N132 M179 C185 DOPARS-0.1-1 S DOPARS-0.1-2 G L N DOPARS-0.1-3 DOPARS-0.1-5 DOPARS-0.1-6 R DOPARS-0.1-7 R DOPARS-0.1-9 A Y DOPARS-0.1-10 R DOPARS-0.1-11 V DOPARS-0.1-12 R L DOPARS-1-2 R DOPARS-1-3 L DOPARS-1-4 L DOPARS-1-5 I DOPARS-1-7 S DOPARS-1-8 R DOPARS -1-9 DOPARS-1-10 DOPARS-1-11 DOPARS-1-12 R Clone A186 K195 I209 T231 G242 T263 A264 F277 M278 I280 S293 Q300 DOPARS-0.1-1 DOPARS-0.1-2 N R DOPARS-0.1-3 I DOPARS-0.1-5 T D DOPARS-0.1-6 DOPARS-0.1-7 DOPARS-0.1-9 Q T DOPARS-0.1-10 V DOPARS-0.1-11 DOPARS-0.1-12 G DOPARS-1-2 T DOPARS-1-3 V DOPARS-1-4 DOPARS-1-5 L DOPARS-1-7 V DOPARS-1-8 DOPARS -1-9 DOPARS-1-10 V V A DOPARS-1-11 T DOPARS-1- 12 A Clone K321 M353 M360 Q369 K377 T378 N372 E389 K390 S392 Y396 K415 DOPARS-0.1-1 DOPARS-0.1-2 DOPARS-0.1-3 DOPARS-0.1-5 P N DOPARS-0.1-6 DOPARS-0.1-7 DOPARS-0.1-9 E D DOPARS-0.1-10 V H DOPARS-0.1- 11 R DOPARS-0.1-12 DOPARS-1-2 DOPARS-1-3 V A S DOPARS-1-4 DOPARS-1-5 DOPARS-1-7 T R DOPARS-1-8 DOPARS -1-9 R DOPARS-1-10 DOPARS-1-11 DOPARS-1- 12 R
Example 5. Modified Screens for Isolation of Aminoacyl-tRNA Synthetases (aaRSs) with Desired Specificity Profiles
[0178] With a robust aminoacyl-tRNA synthetase (aaRS) screening platform in place, it was then determined how introducing different induction conditions during fluorescence-activated cell sorting (FACS) could be utilized to isolate highly specific aminoacyl-tRNA synthetases (aaRSs); i.e., aminoacyl-tRNA synthetases (aaRSs) that charge a single noncanonical amino acid (ncAA) to the cognate tRNA.sub.CUA (transfer RNA with a CUA anticodon) and do not mischarge other similar noncanonical amino acids (ncAAs). For these experiments, a group of six structurally similar aromatic noncanonical amino acids (ncAAs) was used: OmeY (1), AcF (2), AzF (3), OPG (4), AzMF (5), and IPhe (6). It was expected that the similarity of these noncanonical amino acids (ncAAs) would make it difficult for some aminoacyl-tRNA synthetases (aaRSs) to selectively charge one over the others. First, isolation of aminoacyl-tRNA synthetases (aaRSs) capable of charging OPG (4) and not the other five non-target noncanonical amino acids (ncAAs) was pursued. The negative screens were modified to add 1 mM of all five non-target noncanonical amino acids (ncAAs) during induction prior to negative screens, while the positive screens (the terms sorts and screens used interchangeably herein) remain unchanged (1 mM OPG was added during induction for positive sorts). Subsequent evaluation of individual aminoacyl-tRNA synthetase (aaRS) clones isolated from these specificity sorts demonstrated that the addition of non-target noncanonical amino acid (ncAA) analogs during negative sort rounds yielded aminoacyl-tRNA synthetases (aaRSs) specific to a single noncanonical amino acid (ncAA) out of a group of 6 noncanonical amino acid (ncAA) analogs.
Example 6. Modified Screens for Isolation of Aminoacyl-tRNA Synthetases (aaRSs) with Desired Polyspecificity Profiles
[0179] In parallel to tuning the specificity of aminoacyl-tRNA synthetases (aaRSs), as described above, during screening, it was also sought to investigate whether the polyspecificity of the aminoacyl-tRNA synthetases (aaRSs) could be enhanced using a different screening strategy. Adaptations to each screen by inducing the library populations with different combinations of noncanonical amino acids (ncAAs) allowed for the determination of whether polyspecific aminoacyl-tRNA synthetases (aaRSs) could be isolated from the Tyrosyl-tRNA synthetase (TyrRS) and Leucyl tRNA synthetase (LeuRS) libraries. For the first track (Track 1, T1), all six of the same group of aromatic noncanonical amino acids (ncAAs) (OmeY (1), AcF (2), AzF (3), OPG (4), AzMF (5), and IPhe (6)) were added in the induced cultures for all positive sort rounds. For the second track (Track 2, T2), only one of the six aromatic noncanonical amino acids (ncAAs) was added per positive sort round, with a different noncanonical amino acid (ncAA) for each subsequent positive sort round. With 3 consecutive positive sorts followed by a single negative sort, characterization of 11 clones from the Track 1 screens yielded four unique Tyrosyl-tRNA synthetase (TyrRS) mutants and one Leucyl tRNA synthetase (LeuRS) mutant. All four of the unique Tyrosyl-tRNA synthetase (TyrRS) variants differed only by the first mutated position (Y37 to L, I, V, or T). For Track 2 sorts, the pooled libraries were screened first using AzF (3), followed by a positive screen for incorporation of AcF (2), a negative screen, and two consecutive positive screens for AzMF (5) due to lower incorporation of AzMF (5) as compared to the other five noncanonical amino acids (ncAAs) during flow cytometry characterization of intermediate populations. Sequence characterization of 12 aminoacyl-tRNA synthetases (aaRSs) from the T2 sorted library population yielded six unique clones: four Tyrosyl-tRNA synthetase (TyrRS) variants and two Leucyl tRNA synthetase (LeuRS) variants. An identical sequence to TyrAcFRS (Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269; Van Deventer, J. A., Le, D. N., Zhao, J., Kehoe, H. P., and Kelly, R. L. (2016) A platform for constructing, evaluating, and screening bioconjugates on the yeast surface, Protein Eng Des Sel 29, 485-494) was found seven times in the Track 1 population out of the 11 clones and two times in the Track 2 population out of the 12 clones evaluated, further indicating its polyspecific ability to charge five of the six noncanonical amino acids (ncAAs) tested. No other sequence consensus occurred from Track 1 sorts, but clone PolyT2RS-5 appeared five times out of 12 clones that were characterized from Track 2.
[0180] Evaluation of the efficiency and fidelity of the unique polyspecific aminoacyl-tRNA synthetases (aaRSs) demonstrated that the aminoacyl-tRNA synthetases (aaRSs) were able to encode several of the group of six noncanonical amino acids (ncAAs), and also revealed a difference in outcome between the two sort tracks (
TABLE-US-00015 TABLE 11 Sequences of aminoacyl-tRNA synthetases (aaRSs) from FIG. 5. Position I37 L71 Q179 G182 M183 A186 Q195 TyrRs B-SOPGRS-3 G T A S L A E B-SOPGRS-7 T L E S T L L B-SOPGRS-9 T V Q G M A Q B-PolyT1RS-7 V L Q G M A Q B-PolyT2RS-5 V V Q G M A Q B-PolyT2RS-6 I V Q G M A Q Position M40 L41 T252 S496 Y499 Y527 H537 LeurRS A-LysN3RS-1 G P T T C Y G B-PolyT2RS-7 G E A T H F G B-LysAlkRS-3 M H A G A G G B-LysN3RS-1 G P A G A C G B-LysN3RS-7 S P A G I H G B-LysN3RS-8 A P A G G H G B-BockRS-1 P A A G G I G B-BockRS-2 A G A S G T G
Example 7. Characterizing Polyspecific Aminoacyl-tRNA Synthetases (aaRSs) for Activity with Aliphatic Noncanonical Amino Acids (ncAAs)
[0181] To further evaluate the extent of polyspecificity of the final screened Track 1 library population, the population was tested for incorporation of 21 noncanonical amino acids (ncAAs) (
Example 8. Trends in Aminoacyl-tRNA Synthetase (aaRS) Active Site Residues
[0182] For both the Tyrosyl-tRNA synthetase (TyrRS) and Leucyl tRNA synthetase (LeuRS) mutants isolated during screening, several trends appeared in which residues in the active site resulted in more efficient aminoacylation of particular groups of noncanonical amino acids (ncAAs). For example, 11 out of the 12 Tyrosyl-tRNA synthetase (TyrRS) variants isolated from non-specificity sorts for OPG contained mutations D182G, F183M, and L186A, and maintained WT residues at positions Q179 and Q195herein referred to as the QGMAQ motif This was interesting when compared to the OPGRSs isolated from specificity screens, for which the active site residues varied significantly more, though the L186A mutations still appeared for 8 out of 9 aminoacyl-tRNA synthetases (aaRSs). QGMAQ motif may have been removed from the library population during specificity screens because the motif may improve the efficiency of charging OPG to tRNA.sub.CUA (transfer RNA with a CUA anticodon) but also allow OPG analogs to be aminoacylated. The QGMAQ motif appears in all of the unique clones from both Track 1 and Track 2 polyspecificity sorts. The only positions that differed between the polyspecific aminoacyl-tRNA synthetases (aaRSs) were positions 37, 71, and 72. Position V72 was not included in the original set of active site residues chosen for mutation and did not appear in the initial Tyrosyl-tRNA synthetase (TyrRS) library characterization. However, position V72 showed up in several of the Tyrosyl-tRNA synthetase (TyrRS) clones isolated from different sort tracks and can be attributed to an error in primer binding during the PCR step of library construction. For the polyspecific aminoacyl-tRNA synthetases (aaRSs), the 37, 71, and 72 positions only contained mutations to leucine, isoleucine, and valine as well as one instance of a Y37T mutation. Not wishing to be bound by theory, these trends in active site residues support the theory that the QGMAQ motif contributes to polyspecific aminoacylation of some noncanonical amino acids (ncAAs), and that small, hydrophobic residues may further alter the active site conformation in a way that reduces selectivity of one noncanonical amino acid (ncAA) over another.
[0183] Tyrosyl-tRNA synthetase (TyrRS) variants supporting incorporation of LysN3 showed a similar trend at positions 37 and 71, where a majority of residues were alanine, valine, leucine, and methionine (all hydrophobic). However, the QGMAQ motif did not appear and all seven unique clones retained the wild type (WT) aspartic acid at position 182. LysN3RSs isolated from Leucyl tRNA synthetase (LeuRS) Library A revealed two notable trends: 1) all of the Leucyl tRNA synthetase (LeuRS) clones did not contain the T252A editing domain mutation and 2) a disproportionately high rate of glycine and threonine. The other group of LysN3RSs were variants of Leucyl tRNA synthetase (LeuRS) Library B and were originally screened as polyspecificity Track 1. All 12 of the aminoacyl-tRNA synthetases (aaRSs) isolated from this population were Leucyl tRNA synthetase (LeuRS) variants and contained the T252A mutation. For the six active site positions diversified in the original library construction, some trends were discovered. Positions M40, L41, S496, Y499, and H537 were primarily mutated to glycine, proline, or alanine with a few instances of serine and isoleucine residues. In particular, virtually all of the clones were mutated to glycine at both positions S496 and H537. S496 had not previously been included in a Leucyl tRNA synthetase (LeuRS) saturation mutagenesis library Not wishing to be bound by theory, position Y527 showed the most variability with residues such as cysteine, histidine, and threonine appearing most often. The frequency of glycine and alanine mutations, particularly in clones B-LysN3RS-1, 7, and 8 (all of which demonstrated high levels of efficiency for charging LysN3) supports the possibility that these mutations alter the active site specificity to aminoacylate aliphatic noncanonical amino acids (ncAAs). This theory is further reinforced by comparison of aminoacyl-tRNA synthetase (aaRS) sequences capable of charging aliphatic noncanonical amino acids (ncAAs) LysAlk and BocK.
[0184] With one exception, all 24 clones isolated from sorts for BocK and LysAlk encoded glycine at the 537 position in the active site. All clones had the expected T252A mutation, and similarly to the LysN3 mutants, primarily glycine, proline, or alanine at positions M40, L41, and Y499. Residue 496 was virtually always a glycine or serine and residue 527 mainly converged to threonine. In the best performing aminoacyl-tRNA synthetase (aaRS), B-LysAlkRS-3, residue M40 was unmutated and residue L41 was mutated to histidine; the only Leucyl tRNA synthetase (LeuRS) variant isolated from any screen in this work that contained an L41H mutation.
[0185] Additionally, trends were investigated between the noncanonical amino acid (ncAA) screening targets and whether more Tyrosyl-tRNA synthetase (TyrRS) or Leucyl tRNA synthetase (LeuRS) variants were isolated from the final library populations after screening. For sorts where a single noncanonical amino acid (ncAA) of interest was the target, aminoacyl-tRNA synthetases (aaRSs) isolated tended to predominantly originate in the Tyrosyl-tRNA synthetase (TyrRS) if the noncanonical amino acid (ncAA) contained a benzyl ring, or Leucyl tRNA synthetase (LeuRS) if the noncanonical amino acid (ncAA) was aliphatic (Tables 8 and 9). Populations of aminoacyl-tRNA synthetases (aaRSs) sorted for the ability to charge OmeY (1), DOPA (7), BPhe (8), OPG (4), and the polyspecificity sorts for groups of aromatic noncanonical amino acids (ncAAs) all had 80-100% Tyrosyl-tRNA synthetase (TyrRS) clones. Similarly, for sorts for charging of aliphatic noncanonical amino acids (ncAAs), aminoacyl-tRNA synthetases (aaRSs) for all three sorts (BocK, LysAlk, and LysN3) that started as polyspecificity sorts against aromatic noncanonical amino acids (ncAAs) but were continued for aliphatic noncanonical amino acids (ncAAs), 100% of clones were Leucyl tRNA synthetase (LeuRS) variants. There were two notable exceptions: LysN3 from sorts with Leucyl tRNA synthetase (LeuRS) Library A and ATyr. For both of these tracks, Tyrosyl-tRNA synthetase (TyrRS) and Leucyl tRNA synthetase (LeuRS) clones appeared an approximately equal number of times from sequence characterization of final populations. For LysN3 this may have been due to the misconstruction of Leucyl tRNA synthetase (LeuRS) Library A, where the last two positions in the active site chosen for mutations were discovered to be mostly wild type (WT) larger residues tyrosine and histidine. For Leucyl tRNA synthetase (LeuRS) variants isolated from Library A screens, none of the aminoacyl-tRNA synthetases (aaRSs) had the wild type (WT) residue histidine at the position 537, which may indicate the importance of mutating that residue for improved interaction of LysN3 with the active site. For ATyr, half of the isolated aminoacyl-tRNA synthetases (aaRSs) were Leucyl tRNA synthetase (LeuRS) variants. Despite the aromatic structure of ATyr compared to tyrosine and leucine, the best aminoacyl-tRNA synthetase (aaRS) for charging ATyr to tRNA.sub.CUA (transfer RNA with a CUA anticodon) was a Leucyl tRNA synthetase (LeuRS) variant.
TABLE-US-00016 TABLE 12 E. coli TyRS library characterization. WT Codon Y37 L71 Q179 D182 F183 L186 Q195 Degenerate codon VNK + TAT VNK GCT RRT VNK KYA VNK 1 G G R N K L V 2 R S R D G A R 3 S V A D A A P 4 L L S D P A Q 5 D M E D R A L 6 M V L N I L V 7 H D T G M A P 8 S M R S H L P 9 G V N S D A V 10 N V R D N A I
TABLE-US-00017 TABLE 13 E. coli LeuRS library characterization. WT Codon M40 L41 T252 S496 Y499 Y527 H537 Degenerate codon VNK VNK GCT RST NNY NNT NNT 1 N T A T T Y H 2 A S A T A Y H 3 V E A T A Y H 4 A R A G D Y F 5 G A A T P S A 6 N R A A A Y T 7 I R A A I Y L 8 G H A A H V S 9 N R A T S V Y 10 R D A G Y Y H
TABLE-US-00018 TABLE 14 E. coli LeuRS library characterization from second library construction to correct prodominantily wildtype residues at the Y527 and H537 positions. WT Codon M40 L41 T252 S496 Y499 Y527 H537 Degenerate codon VNK VNK GCT RST NNY NNT NNT 1 I D A A H Y S 2 G S A G I H F 3 G H A S D S C 4 A T A T Y D I 5 A T A T Y D I 6 L N A A P T N 7 R V A S A V S 8 D H A A S A H 9 M L A G N S S
Example 9. Comparison Between Aminoacyl-tRNA Synthetases (aaRSs) Sorted Using Different Methods
[0186] In order to cross-evaluate some of the unique aminoacyl-tRNA synthetases (aaRSs) isolated from the screens with a larger set of noncanonical amino acids (ncAAs), the efficiency and fidelity of nine aminoacyl-tRNA synthetases (aaRSs) was measured with ten aromatic noncanonical amino acids (ncAAs) and eight aminoacyl-tRNA synthetases (aaRSs) with six aliphatic noncanonical amino acids (ncAAs) (
TABLE-US-00019 TABLE 15 Calculated error of RRE measurements of aaRSs with aromatic ncAAs. No ncAA AcF AzF OmeY OPG AzMF IPhe DOPA BPhe ATyr APhe A-OmeRS-7 0.00014 0.080 0.27 0.12 0.056 0.00044 0.026 0.0012 0.0057 0.00099 0.00113 epDOPAR 0.00058 0.0024 0.0016 0.0017 0.0013 0.00041 0.00034 0.050 0.0023 0.00103 0.00097 S-0.1-10 A-BPheR 0.00034 0.00064 0.00056 0.00068 0.00057 0.00029 0.00016 0.00076 0.048 0.00045 0.00072 S-2 B-OPGR 0.00032 0.039 0.040 0.079 0.052 0.016 0.096 0.0018 0.00223 0.00184 0.00435 S-L6 SpecOPGR 0.0010 0.0015 0.0017 0.0012 0.052 0.0060 0.0059 0.0015 0.00146 0.00093 0.00085 S-3 PolyT2R S-5 0.00015 0.048 0.063 0.052 0.054 0.011 0.094 0.00043 0.00034 0.0003 0.00321 PolyT2R S-7 0.0026 0.028 0.017 0.18 0.041 0.0080 0.051 0.0041 0.00364 0.00459 0.00317 B-LysAlKR 0.0041 0.0080 0.013 0.011 0.011 0.016 0.068 0.0072 0.01127 0.00736 0.00407 S-3 B-BocKR 0.00041 0.054 0.090 0.13 0.062 0.024 0.15 0.0036 0.00036 0.00041 0.00043 S-2
TABLE-US-00020 TABLE 16 Calculated error of MMF measurements of aaRSs with aromatic ncAAs. AcF AzF OmeY OPG AzMF IPhe DOPA BPhe ATyr APhe OmeR S-7 0.00064 0.0022 0.0013 0.0040 0.095 0.0081 0.087 0.060 0.17 0.14 epDOPAR S-0.1- 0.089 0.16 0.14 0.21 0.30 0.51 0.0049 0.22 0.13 0.25 10 BPheR S-2 0.15 0.11 0.16 0.29 0.35 0.33 0.24 0.0040 0.21 0.27 OPGR S-L6 0.0026 0.0027 0.0043 0.0029 0.030 0.0023 0.21 0.32 0.43 0.11 SOPGR S-3 0.34 0.33 0.46 0.016 0.79 0.65 0.30 0.42 0.45 0.55 T2R S-5 0.0027 0.0031 0.0027 0.0015 0.011 0.0022 0.10 0.13 0.15 0.062 T2R S-7 0.014 0.048 0.021 0.020 0.071 0.0071 0.15 0.27 0.24 0.36 LysAlkR S-3 0.15 0.096 0.067 0.075 0.050 0.038 0.10 0.13 0.14 0.13 BocKR S-2 0.0015 0.0020 0.0028 0.0016 0.015 0.0026 0.092 0.36 0.29 0.35
TABLE-US-00021 TABLE 17 Calculated error of RRE measurements of aaRSs with aliphatic ncAAs. No ncAA LysN3 LysAlk BocK AzK DMK AC Poly T2R 0.00026 0.00027 0.00021 0.00030 0.00035 0.00029 0.00027 S-5 PolyT2R 0.0032 0.0075 0.0021 0.0024 0.0049 0.0042 0.025 S-7 B-LysAlkR 0.0041 0.020 0.024 0.011 0.0021 0.0035 0.0083 S-3 B-BocKR 0.00042 0.0057 0.0011 0.033 0.00038 0.0013 0.0043 S-2 B-LysN3R 0.0035 0.051 0.0022 0.0020 0.0013 0.0021 0.0033 S-7 LeuOmeR 0.00027 0.00022 0.00018 0.00016 0.00026 0.00023 0.00036 S A-OmeR 0.00016 0.00034 0.00034 0.0003 0.00031 0.00031 0.00025 S-7 B-OPGR 0.00018 0.00060 0.00046 0.00047 0.00014 0.00039 0.00022 S-L6
TABLE-US-00022 TABLE 18 Calculated error of MMF measuremetns of aaRSs with aliphatic ncAAs. LysN3 LysAlk BocK AzK DMK AC Poly T2R 0.24 0.29 0.51 0.23 0.27 0.37 S-5 PolyT2R 0.12 0.35 0.49 0.24 0.36 0.039 S-7 B-LysAlkR 0.011 0.018 0.068 0.11 0.10 0.053 S-3 B-BocKR 0.0091 0.018 0.0030 0.078 0.046 0.012 S-2 B-LysN3R 0.013 0.35 0.35 0.31 0.33 0.28 S-7 LeuOmeR 0.16 0.34 0.46 0.23 0.28 0.22 S A-OmeR 0.074 0.086 0.10 0.12 0.16 0.13 S-7 B-OPGR 0.092 0.087 0.13 0.11 0.17 0.15 S-L6
[0187] Several aminoacyl-tRNA synthetases (aaRSs) were also evaluated against a panel of aliphatic noncanonical amino acids (ncAAs) (
[0188] A difference in polyspecificity between Tyrosyl-tRNA synthetase (TyrRS) and Leucyl tRNA synthetase (LeuRS) variants resulting from the screening methods and targets was observed. Select Tyrosyl-tRNA synthetase (TyrRS) variants isolated from screens for aminoacylation of OmeY and OPG demonstrated polyspecific interaction with aromatic noncanonical amino acids (ncAAs) AcF, AzF, OmeY, OPG, and IPhe (as well as AzMF in the case of OPGRS-L6), but were not able to charge any of the aliphatic noncanonical amino acids (ncAAs) tested (
Example 10. Confirmation of Noncanonical Amino Acid Incorporation Using Mass Spectrometry
[0189] To further characterize the properties of the aminoacyl-tRNA synthetases (aaRSs), soluble ncAA-containing proteins were prepared using the aaRSs and the resulting ncAA incorporation was evaluated via MALDI mass spectrometry. Plasmids encoding each of several aminoacyl-tRNA synthetases (aaRSs) mutants were co-transformed into yeast with a secreted scFv-Fc reporter protein. Transformants were induced for secretion in rich media containing 1 mM ncAA, and resulting proteins were isolated via Protein A affinity chromatography, trypsinized, and subjected to MALDI. In most cases, detected masses for each ncAA-containing peptide were consistent with the expected masses (
[0190] As noted above, incorporation of ncAAs was investigated via MALDI mass spectrometry of an scFv-Fc, Donkey 1.1 (H54TAG) (Islam, M.; Kehoe, H. P.; Lissoos, J. B.; Huang, M.; Ghadban, C. E.; Berumen Sanchez, G.; Lane, H. Z.; Van Deventer, J. A., Chemical Diversification of Simple Synthetic Antibodies. ACS Chem Biol 2021, 16 (2), 344-359), following expression, purification, and trypsinization (
[0191] Expected peptide sizes and peptide sizes that could appear due to cAA misincorporation are provided in Table 19. Expected and observed masses are reported directly on the MS spectra. Peptide masses at 2210.1, 2282.2, and 2298.2 Da were due to trypsin autolysis. The expected peptide masses of interest appeared in most samples. Both A-DOPARS-4 and DOPARS-0.1-10 had a low peak at approximately 2310 Da, which was attributed to a dehydration event that resulted in removal of one of the hydroxyl groups (
[0192] MALDI detected BPhe-containing proteins produced with BPheRS-2 (
TABLE-US-00023 TABLE 19 Expected peptide sizes for the tryptic digest fragment containing the H54TAG codon from the scFv-Fc form of Donkey 1.1. Both cAA misincorporation and ncAA incorporation are included. Serine is the WT residue in the Donkey1.1 reporter, which does not contain a TAG codon at H54. Expected peptide fragment (H54 peptide only) Diff. from Peptide Residue MW (Da) WT (Da) Mass (Da) CAAs Serine 105.1 0 2234.1 Alanine 89.1 ?16 2218.1 Arginine 174.2 69.1 2303.2 Asparagine 132.1 27 2261.1 Aspartic acid 133.1 28 2262.1 Cysteine 121.2 16.1 2250.2 Glutamic acid 147.1 42 2276.1 Glutamine 146.2 41.1 2275.2 Glycine 75.1 ?30 2204.1 Histidine 155.2 50.1 2284.2 Isoleucine 131.2 26.1 2260.2 Leucine 131.2 26.1 2260.2 Lysine 146.2 41.1 2275.2 Methionine 149.2 44.1 2278.2 Phenylalanine 165.2 60.1 2294.2 Proline 115.1 10 2244.1 Threonine 119.1 14 2248.1 Tryptophan 204.2 99.1 2333.2 Tyrosine 181.2 76.1 2310.2 Valise 117.2 12.1 2246.2 ncAAs OmeY 195.2 90.1 2324.2 OPG 219.2 114.1 2348.2 AcF 207.2 102.1 2336.2 AzF 206.2 101.1 2335.2 AzMF 220.2 115.1 2349.2 IPhe 291.1 186 2420.1 BPhe 209 103.9 2338 DOPA 197.2 92.1 2326.2 ATyr 196.2 91.1 2325.2 LysN3 259.3 154.2 2388.3 LysAlk 228.2 123.1 2357.2 BocK 246.3 141.2 2375.3 APhe 180.2 75.1 2309.2
Example 11. Incorporation of Crosslinkable Noncanonical Amino Acids in Proteins Produced in Yeast
[0193] Experiments were undertaken to expand the tools available for genetically encoding crosslinkable ncAAs in proteins produced in yeast. As described in the above examples, a large number of aminoacyl-tRNA synthetase (aaRS) variants were discovered that support translation with a broad set of ncAAs. Here, several of these aaRSs were evaluated alongside previously described variants to evaluate their support of protein translation with the ncAAs O-(2-bromoethyl)tyrosine (Obey), 4-benzoyl-1-phenylalanine (Bpa), or N.sup.6-((2-(3-methyl-3H-diazirin-3-yl)ethoxy)carbonyl)-L-lysine (Photo-Lysine, Phk) (
[0194] It was first sought to identify aaRSs that would support efficient incorporation of Obey, Phk, and Bpa into proteins in yeast. This was done by surveying a broad set of orthogonal translation machineries (OTSs). Here, experiments were undertaken to evaluate a diverse set aaRSs either evolved or otherwise characterized. The fourteen total synthetases (see
[0195]
[0196] The level of incorporation was quantitated using the relative readthrough efficiency (RRE) and maximum misincorporation frequency (MMF) metrics described in Monk, J. W., et al., Rapid and Inexpensive Evaluation of Nonstandard Amino Acid Incorporation in Escherichia coli, ACS Synthetic Biology 2017, 6 (1), 45-54 (
[0197] The above examples demonstrate the utility of an original yeast display method for screening libraries of E. coli Tyrosyl-tRNA synthetase (TyrRS) and Leucyl tRNA synthetase (LeuRS) active site mutants using fluorescence-activated cell sorting (FACS). Using this screening platform in yeast, aminoacyl-tRNA synthetases (aaRSs) that supported incorporation of noncanonical amino acids (ncAAs) were isolated that had not previously been genetically encoded in proteins in yeast: DOPA and BPhe. For a less active DOPARS clone, a single round of error-prone polymerase chain reaction (epPCR) and further screening was used to isolate aminoacyl-tRNA synthetases (aaRSs) that were better able to aminoacylate DOPA at both 0.1 and 1 mM concentrations. By introducing slight variations in the positive and negative screening methods, aminoacyl-tRNA synthetases (aaRSs) with defined specificity and polyspecificity profiles for a group of 6 aromatic noncanonical amino acid (ncAA) analogs were isolated. Further screens of a polyspecific library population for aminoacylation of several aliphatic noncanonical amino acids (ncAAs) led to isolation of highly efficient aminoacyl-tRNA synthetases (aaRSs) that could encode one or more aliphatic and aromatic noncanonical amino acids (ncAAs).
[0198] In the above examples, flow cytometry-based screens were employed to discover aaRSs exhibiting a wide range of properties for genetic code expansion in yeast. This is the first report utilizing such approaches in yeast to engineer orthogonal translation machineries (OTSs). Isolation of clones from saturation mutagenesis EcTyrRS and EcLeuRS libraries led to numerous variants supporting protein translation with a broad set of ncAAs, including DOPA, BPhe, and other ncAAs that had not previously been genetically encoded in yeast. Error-prone PCR mutagenesis of a DOPARS variant followed by increasingly stringent screening led to identification of clones that supported improved protein translation with DOPA even at reduced ncAA concentrations. The facile discovery of improved variants in a single round of mutagenesis suggests the possibility that this platform will facilitate more extensive, multi-round aaRS discovery and mutagenesis campaigns in the futurea generally underexplored route to modifying aaRS activity. Moreover, these findings highlight the strong potential to enhance OTS performance by broadly exploring aaRS diversification strategies beyond aaRS aminoacylation active sites; this observation is consistent with the findings of other recent work in this area. Further studies using random mutagenesis, deep mutational scanning, or other approaches to facilitate more comprehensive exploration of the sequence spaces surrounding known aaRSs represents a major opportunity for understanding and engineering aaRSs.
[0199] The breadth of aaRS properties accessed the above examples underscores the excellent plasticity and evolvability of these enzymes. Not intending to be bound by theory, the functional diversity of the mutants reported here is likely attributed primarily to the carefully controlled screening conditions, with both flow cytometry gating strategies and well-defined induction conditions playing key roles in biasing screening outcomes. There are several ways in which the findings described here could be extended further in future work. First, detailed sequence-activity relationships for the aaRSs investigated here may be attainable, especially if deep sequencing methodologies can be applied. Second, understanding the relationship between the observed translation properties reported here and underlying orthogonal translation machinery (OTS) properties (e.g., kinetic constants of aaRSs, expression levels of OTS components, and expression conditions) could lead to better understanding of how best to efficiently prepare ncAA-containing proteins in high yields and purities. Third, the availability of highly specific OTSs has the potential to facilitate genetic code expansion to include multiple ncAAs in the same protein, even when the two ncAAs of interest are similar in structure. Finally, polyspecific aaRSs have potential utility in applications in protein medicinal chemistry, where systematically exploring the effects of different ncAA side chains on protein properties is desirable. The findings provided in the above Examples begin to investigate the most efficient way to select sets of ncAAs that lead to tightly controlled aaRS activity using modified specificity profile screens. Overall, the availability of a high-throughput screening platform for aaRSs in yeast broadens opportunities for generating versatile aaRSs suitable for use in genetic code manipulation in yeast, mammalian cells, and other eukaryotes. Such tools are expected to facilitate dissection of basic biological and biochemical phenomena as well as myriad applications at the interface of chemical biology, synthetic biology, and protein engineering.
[0200] Tables 20-25 provide a listing of polypeptide sequences and their associated mutations identified in the above examples.
TABLE-US-00024 TABLE 20 LeuRS clone family descriptions. Family Descriptions Family 1: M40G & S496T A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; M40G; T252A; S496T; a proline, glutamate, or glycine at position L41; a cysteine, leucine, histidine, or threonine at position Y499; a glycine or phenylalanine at position Y527, and a glycine or phenylalanine at position H537, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence. Family 2: S496T & H537G A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; T252A; S496T; H537G; a glycine or leucine at position M40; a proline, glutamate, or glycine at position L41; a cysteine, isoleucine, histidine, or threonine at position Y499; and a glycine or phenylalanine at position Y527, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence. Family 3: S496G & H537G A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; T252A; S496G; H537G; a glycine, serine, proline, or alanine at position M40; a threonine, proline, alanine, histidine, or glycine at position L41; a glycine, alanine, phenylalanine, cysteine, isoleucine, or threonine at position Y499; and a threonine, cysteine, glycine, histidine, isoleucine, valine, or serine at position Y527, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence. Family 4: L41P, S496G, & A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a H537G functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; L41P; T252A; S496G; H537G; a serine, glycine, or alanine at position M40; an isoleucine, alanine, glycine, or threonine at position Y499; and a histidine, valine, or cysteine at position Y527, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence. Family 5: M40P, S496G, & A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a H537G functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; M40P; T252A; S496G; H537G; an alanine or glycine at position L41; a cysteine, glycine, or alanine at position Y499; and an isoleucine, cysteine, or valine at position Y527, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence. Family 6: L41G & H537G A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; L41G; T252A; H537G; a glycine, alanine, or proline at position M40; a threonine or glycine at position S496; a glycine, threonine, leucine, valine, cysteine, or alanine at position Y499; and a threonine, isoleucine, cysteine, valine, or phenylalanine at position Y527, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence. Family 7: M40A & H537G A Leucyl-tRNA Synthetase (LeuRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Q2E; M40A; T252A; S496G; H537G; a proline, alanine, or glycine at position L41; a glycine, alanine, or valine at position Y499; and a threonine, cysteine, isoleucine, or histidine at position Y527, or any of those amino acid substitutions relative to a wild type or reference LeuRS polypeptide sequence.
TABLE-US-00025 TABLE 21 LeuRS families clone sequences. Family Amino Acid Positions Number WT LeuRS M40 L41 S496 Y499 Y527 H537 Target(s) 1: M40G A-LysN3RS-ori1 G P T C Y G LysN3 & 5496T A-LysN3RS-4 G P T L G F LysN3 A-LysN3RS-12 G E T C Y G LysN3 B-PolyT2RS-7 G E T H F G AcF, AzF, OmeY, AzMF, OPG, IPhe B-BocKRS-9 G G T T F G BocK 2: S496T A-LysN3RS-ori1 G P T C Y G LysN3 & A-LysN3RS-ori2 L P T I G G LysN3 H537G A-LysN3RS-12 G E T C Y G LysN3 B-PolyT2RS-7 G E T H F G AcF, AzF, OmeY, AzMF, OPG, IPhe B-BocKRS-9 G G T T F G BocK 3: S56G A-LysN3RS-8 G T G T T G LysN3 & B-APheRS-12 S P G I H G APhe H537G B-BocKRS-1 P A G G I G BocK B-BocKRS-12 A A G A C G BocK B-LysAlkRS-2 S P G T V G LysAlk B-LysAlkRS-3 M H G A G G LysAlk B-LysAlkRS-5 P G G C C G LysAlk B-LysAlkRS-10 M L G F S G LysAlk B-LysN3RS-1 G P G A C G LysN3 B-LysN3RS-2 P G G A V G LysN3 B-LysN3RS-3 P G G A C G LysN3 B-LysN3RS-4 P G G C C G LysN3 B-LysN3RS-6 A P G G H G LysN3 B-LysN3RS-7 S P G I H G LysN3 B-APheRS-12 S P G I H G APhe 4: L419, B-LysAlkRS-2 S P G T V G LysAlk S496G, B-LysN3RS-1 G P G A C G LysN3 & B-LysN3RS-6 A P G G H G LysN3 H537G B-LysN3RS-7 S P G I H G LysN3 5: B-BocKRS-1 P A G G I G BocK M40P, B-LysAlkRS-5 P G G C C G LysAlk S498G, B-LysN3RS-2 P G G A V G LysN3 & B-LysN3RS-3 P G G A C G LysN3 H537G B-LysN3RS-4 P G G C C G LysN3 6: L41G B-BocKRS-2 A G S G T G BocK & B-BocKRS-9 G G T T F G BocK H537G B-BocKRS-11 P G S L T G BocK B-LysAlkRS-1 A G S V I G LysAlk B-LysAlkRS-5 P G G C C G LysAlk B-LysAlkRS-6 A G S G T G LysAlk B-LysN3RS-2 P G G A V G LysN3 B-LysN3RS-3 P G G A C G LysN3 B-LysN3RS-4 P G G C C G LysN3 B-LysN3RS-9 A G S G T G LysN3 7: M40A B-BocKRS-2 A G S G T G BocK & B-BocKRS-12 A A G A C G BocK H537G B-LysAlkRS-1 A G S V I G LysAlk B-LysAlkRS-6 A G S G T G LysAlk B-LysN3RS-6 A P G G H G LysN3 B-LysN3RS-9 A G S G T G LysN3
TABLE-US-00026 TABLE 22 LeuRS sequences. Amino Acid Positions WT LeuRS M40 L41 S496 Y499 Y527 H537 Target(s) A-LysN3RS-ori1 G P T C Y G LysN3 A-LysN3RS-ori2 L P T I G G LysN3 A-LysN3RS-ori3 A G S G N C LysN3 A-LysN3RS-4 G P T L G F LysN3 A-LysN3RS-6 A N S N G F LysN3 A-LysN3RS-8 G T G T T G LysN3 A-LysN3RS-12 G E T C Y G LysN3 A-ATyrRS-1 L T A H S G ATyr A-ATyrRS-12 Q G S Y Y H ATyr A-ATyrRS-2 M E A I R G ATyr B-PolyT1RS-8 L A A S D S AcF, AzF, OmeY, AzMF, OPG, IPhe B-SpecOPGRS-6 L T A T T G OPG B-PolyT2RS-7 G E T H F G AcF, AzF, OmeY, AzMF, OPG, IPhe B-PolyT2RS-12 G A A S F A AcF, AzF, OmeY, AzMF, OPG, IPhe B-APheRSRS-5 G V G T V L APhe B-APheRSRS-12 S P G I H G APhe B-BocKRS-1 P A G G I G BocK B-BocKRS-2 A G S G T G BocK B-BocKRS-3 G A A C I G BocK B-BocKRS-9 G G T T F G BocK B-BocKRS-11 P G S L T G BocK B-BocKRS-12 A A G A C G BocK B-LysAIKRS-1 A G S V I G LysAlk B-LysAIKRS-2 S P G T V G LysAlk B-LysAIKRS-3 M H G A G G LysAlk B-LysAIKRS-4 G V G T V L LysAlk B-LysAIKRS-5 P G G C C G LysAlk B-LysAIKRS-6 A G S G T G LysAlk B-LysAIKRS-10 M L G F S G LysAlk B-LysN3RSRS-1 G P G A C G LysN3 B-LysN3RSRS-2 P G G A V G LysN3 B-LysN3RSRS-3 P G G A C G LysN3 B-LysN3RSRS-4 P G G C C G LysN3 B-LysN3RSRS-6 A P G G H G LysN3 B-LysN3RSRS-7 S P G I H G LysN3 B-LysN3RSRS-9 A G S G T G LysN3
TABLE-US-00027 TABLE 23 TyRS clone family descriptions. Family Descriptions Family 1: Y37L & L71V A Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Y37L; L71V; D182G; a methionine, aspartate, or asparagine at position Q179; a methionine, isoleucine, leucine, threonine, or histidine at position F183; an alanine or serine at position L186; and a threonine or gluatamate at position Q195, or any of those amino acid substitutions relative to a wild type or reference TyrRS polypeptide sequence. Family 2: Y37G, L71T, & A Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a D182S functional fragment thereof, comprising one or more amino acid substitutions selected from Y37G; L71T; D182S; an alanine or asparagine at position Q179; a valine or leucine at position F183; an alanine or glutamate at position L186; and an isoleucine or gluatamate at position Q195, or any of those amino acid substitutions relative to a wild type or reference TyrRS polypeptide sequence. Family 3: L71V & L186A A Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from L71V; L186A; a glycine, alanine, threonine, leucine, glutamate, valine, methionine, or isoleucine at position Y37; a methionine, arginine, leucine, isoleucine, glutamine, histidine, alanine, or threonine at position V72; a methionine, aspartate, proline, or valine at position Q179; a glycine or serine at position D182; a methionine, leucine, threonine, or histidine at position F183; and a threonine, valine, serine, leucine, or gluatamate at position Q195, or any of those amino acid substitutions relative to a wild type or reference TyrRS polypeptide sequence. Family 4: Y37V & L71V A Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a functional fragment thereof, comprising one or more amino acid substitutions selected from Y37V; L71V; D182G; a threonine, leucine, or isoleucine at position V72; a valine or alanine at position Q179; a methionine or threonine at position F183; a serine or alanine at position L186; and an isoleucine or leucine at position Q195, or any of those amino acid substitutions relative to a wild type or reference TyrRS polypeptide sequence. Family 5: Y37L, L71V, A Tyrosyl-tRNA Synthetase (TyrRS) polypeptide, or a L186A functional fragment thereof, comprising one or more amino acid substitutions selected from Y37L; L71V; D182G; L186A; an aspartate or methionine at position Q179; a methionine, histidine, or threonine at position F183; and a glutamate or threonine at position Q195, or any of those amino acid substitutions relative to a wild type or reference TyrRS polypeptide sequence.
TABLE-US-00028 TABLE 24 TyRS families clone sequences. Family Amino Acid Positions Number WT TyrRS Y37 L71 V72 Q179 D182 F183 L186 Q195 Target(s) 1: Y37L A-OmeRS-1 L V V Q G M A Q OmeY & L71V A-LysN3RS- L V V N D I L Q LysN3 3 A-BPheRS-8 L V V N D L S Q BPhe A-ATyrRS-6 L V V D D T A E ATyr B-DOPARS- L V V M D H A T DOPA 2 B-PolyT2RS- L V V Q G M A Q AcF, AzF, 2 OmeY, AzMF, OPG, IPhe 2: A-BPheRS-2 G T V N S V E I BPhe Y37G, B- G T V A S L A E OPG L71T, SpecOPGRS- & 3 D182S 3: L71V A-OmeRS-1 L V V Q G M A Q OmeY & A-DOPARS- E V V Q G M A V DOPA L186A 5 A-DOPARS- E V M Q G M A T DOPA 9 A-APheRS-4 V V V Q G M A Q APhe A-BPheRS-5 M V R Q D L A S BPhe A-BPheRS-6 V V L V D T A L BPhe A-ATyrRS-6 L V V D D T A E ATyr B-OmeRS-4 I V V Q G M A Q OmeY B-DOPARS- L V V M D H A T DOPA 2 B-APheRS-4 E V M Q G M A Q APhe B- A V V P S L A E OPG SpecOPGRS- 1 B- T V H Q G M A Q OPG SpecOPGRS- 2 B- G V Q Q S T A E OPG SpecOPGRS- 4 B- T V A Q G M A Q OPG SpecOPGRS- 9 B- T V T Q G M A Q OPG SpecOPGRS- 12 B-Poly T2RS- L V V Q G M A Q AcF, AzF, 2 OmeY, AzMF, OPG, IPhe B-PolyT2RS- V V V Q G M A Q AcF, AzF, 4 OmeY, AzMF, OPG, IPhe B-Poly T2RS- V V I Q G M A Q AcF, AzF, 5 OmeY, AzMF, OPG, IPhe B-Poly T2RS- I V V Q G M A Q AcF, AzF, 6 OmeY, AzMF, OPG, IPhe B-OPGRS- V V T Q G M A Q OPG 1H 4: Y37V A-LysN3RS- V V V A D T S I LysN3 & L71V 1 A-APheRS-4 V V V Q G M A Q APhe A-BPheRS-6 V V L V D T A L BPhe B-PolyT2RS- V V V Q G M A Q AcF, AzF, 4 OmeY, AzMF, OPG, IPhe B-PolyT2RS- V V I Q G M A Q AcF, AzF, 5 OmeY, AzMF, OPG, IPhe B-OPGRS- V V T Q G M A Q OPG 1H 5: A-OmeRS-1 L V V Q G M A Q OmeY Y37L, A-ATyrRS-6 L V V D D T A E ATyr L71V, B-DOPARS- L V V M D H A T DOPA L186A 2 B-Poly T2RS- L V V Q G M A Q AcF, AzF, 2 OmeY, AzMF, OPG, IPhe
TABLE-US-00029 TABLE 25 TyRS sequences. Wild type amino acids are italicized. Amino Acid Positions WT TyrRS Y37 L71 V72 Q179 D182 F183 L186 Q195 Target(s) A-OmeRS-1 L V V Q G M A Q OmeY A-OmeRS-3 G R V P S P L S OmeY A-OmeRS-7 L L V Q G M A Q OmeY A-DOPARS-1 E L V Q G M A T DOPA A-DOPARS-2 L L V G D T V L DOPA A-DOPARS-3 T L V M D N L V DOPA A-DOPARS-4 Q M V S D T V I DOPA A-DOPARS-5 E V V Q G M A V DOPA A-DOPARS-7 T I V M D M A K DOPA A-DOPARS-9 E V M Q G M A T DOPA A-LysN3RS-1 V V V A D T S I LysN3 A-LysN3RS-2 A M V Q D T V V LysN3 A-LysN3RS-3 L V V N D I L Q LysN3 A-LysN3RS-5 I L V Q D G L Q LysN3 A-LysN3RS-9 I L V Q D V A L LysN3 A-LysN3RS- L D V L D T L V LysN3 11 A-APheRS-1 I L V Q G M A Q APhe A-APheRS-4 V V V Q G M A Q APhe A-APheRS-6 G L V T D T S M APhe A-APheRS-8 E L V Q G M A S APhe A-APheRS-10 T V S N D I L G APhe A-BPheRS-1 E I V L S I S E BPhe A-BPheRS-2 G T V N S V E I BPhe A-BPheRS-3 A L V P D T L A BPhe A-BPheRS-5 M V R Q D L A S BPhe A-BPheRS-6 V V L V D T A L BPhe A-BPheRS-8 L V V N D L S Q BPhe A-ATyrRS-4 L L V M D Q A S ATyr A-ATyrRS-6 L V V D D T A E ATyr A-ATyrRS-7 L M V N D I S L ATyr A-ATyrRS-10 E V V H D V L I ATyr B-OmeRS-3 I L V Q G M A Q OmeY B-OmeRS-4 I V V Q G M A Q OmeY B-OmeRS-6 I L V M G M A Q OmeY B-DOPARS-2 L V V M D H A T DOPA B-DOPARS-4 T I V M D M A K DOPA B-DOPARS-5 H L V M D L A G DOPA B-DOPARS-9 Q L V H S D A V DOPA B-DOPARS- Q V V Q D H L V DOPA 11 B-DOPARS- T L V T D N V T DOPA 14 B-APheRS-1 I L V Q G M A Q APhe B-APheRS-4 E V M Q G M A Q APhe B-APheRS-11 D L V Q D A A H APhe B-ATyrRS-5 I L V E D T L S ATyr B-PolyT1RS-2 L L V Q G M A Q AcF, AzF, OmeY, AzMF, OPG, IPhe B-PolyT1RS-7 V L V Q G M A Q AcF, AzF, OmeY, AzMF, OPG, IPhe B-PolyT1RS- T L V Q G M A Q AcF, AzF, OmeY, 12 AzMF, OPG, IPhe B- A V V P S L A E OPG SpecOPGRS-1 B- T V H Q G M A Q OPG SpecOPGRS-2 B- G T V A S L A E OPG SpecOPGRS-3 B- G V Q Q S T A E OPG SpecOPGRS-4 B- T L V E S T L L OPG SpecOPGRS-7 B- T V A Q G M A Q OPG SpecOPGRS-9 B- T V T Q G M A Q OPG SpecOPGRS- 12 B-PolyT2RS-2 L V V Q G M A Q AcF, AzF, OmeY, AzMF, OPG, IPhe B-PolyT2RS-4 V V V Q G M A Q AcF, AzF, OmeY, AzMF, OPG, IPhe B-PolyT2RS-5 V V I Q G M A Q AcF, AzF, OmeY, AzMF, OPG, IPhe B-PolyT2RS-6 I V V Q G M A Q AcF, AzF, OmeY, AzMF, OPG, IPhe B-OPGRS-1H V V T Q G M A Q OPG B-OPGRS-6L V I V Q G M A Q OPG B-OPGRS-8L T L V Q G M A Q OPG B-OPGRS- M L V Q S R L Q OPG 10L
Methods of the Examples
[0201] The following materials and methods were employed in the above examples.
[0202] All restriction enzymes used for molecular biology were from New England Biolabs (NEB). Synthetic oligonucleotides for cloning and sequencing were purchased from Eurofins Genomics or GENEWIZ. All sequencing was performed by Eurofins Genomics (Louisville, KY) or Quintara Biosciences (Cambridge, MA). Epoch Life Science GenCatch? Plasmid DNA Mini-Prep Kits were used for plasmid DNA purification from E. coli. Yeast chemical competent cells and subsequent transformations were prepared using Zymo Research Frozen-EZ Yeast Transformation II kits. Noncanonical amino acids were purchased from the indicated companies: p-acetyl-L-phenylalanine (SynChem), p-azido-L-phenylalanine (Chem-Impex International), O-methyl-L-tyrosine (Chem-Impex International), p-propargyloxy-L-phenylalanine (Iris Biotech), 4-azidomethyl-L-phenylalanine (SynChem), 4-iodo-L-phenylalanine (AstaTech), 3,4-dihydroxy-L-phenylalanine (Alfa Aesar), 4-borono-L-phenylalanine (Acros Organics), 3-Amino-L-tyrosine (Bachem), 4-Amino-L-phenylalanine (Bachem), (S)-2-amino-6-((2-azidoethoxy)carbonylamino)hexanoic acid (Iris Biotech), (S)-2-amino-6-(((prop-2-yn-1-yloxy)carbonyl)amino)hexanoic acid (AstaTech), N.sup.?-Boc-L-lysine (Chem-Impex International), N.sup.?-azido-L-lysine (Chem-Impex International), N.sup.?-dimethyl-L-lysine (Chem-Impex International), and L-?-aminocaprylic acid (Acros Organics). Table 26 provides a list of noncanonical amino acids (NcAAs) used in the Examples.
TABLE-US-00030 TABLE 26 NcAA names, abbreviations, suppliers, and CAS numbers. # Name Abbreviation Supplier CAS 1 O-methyl-L-tyrosine OmeY Chem-Impex International 6230-11-1 2 p-acetyl-L-phenylalanine AcF SynChem 22888-49-9 3 p-azido-L-phenylalanine AzF Chem-Impex International 33173-53-4 4 p-propargyloxy-L-phenylalanine OPG Iris Biotech 610794-20-2 5 4-azidomethyl-L-phenylalanine AzMF SynChem 1446772-80-0 6 4-borono-L-phenylalanine BPhe Acros Organics 76410-58-7 7 3,4-dihydroxy-L-phenylalanine DOPA Alfa Aesar 59-92-7 8 4-iodo-L-phenylalanine IPhe AstaTech 24250-85-9 9 L-a-aminocaprylic acid AC Acros Organics 644-90-6* 10 N.sup.?-azido-L-lysine AzK Chem-Impex International 1454334-76-9 11 3-Amino-L-tyrosine ATyr Bachem 23279-22-3 12 4-Amino-L-phenylalanine APhe Bachem 62040-55-5 13 N.sup.?,N.sup.?-dimethyl-L-lysine DMK Chem-Impex International 2259-86-1 14 N.sup.?-Boc-L-lysine BocK Chem-Impex International 2418-95-3 15 (S)-2-amino-6-((2-azidoethoxy)carbonylamino)hexanoic acid LysN3 Iris Biotech 1994331-17-7 16 (2S)-2-amino-6-(((prop-2-yn-1-yloxy)carbonyl)amino)hexanoic acid LysAlk AstaTech 1428330-91-9 *The CAS number supplied is for the DL racemic mixture. Indicated ncAA concentrations were for L isomer only.
Media Preparation and Yeast Strain Construction
[0203] The preparation of liquid and solid media was performed as described in Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269. Unless otherwise noted, all SD-SCAA and SG-SCAA media used here were prepared without tryptophan (TRP), leucine (LEU) or uracil (URA). The strain RJY100 was constructed using standard homologous recombination approaches as described in Van Deventer, J. A., Kelly, R. L., Rajan, S., Wittrup, K. D., and Sidhu, S. S. (2015) A switchable yeast display/secretion system, Protein Eng Des Sel 28, 317-325.
Preparing Noncanonical Amino Acid Liquid Stocks
[0204] All noncanonical amino acid (ncAA) stocks were prepared at a final concentration of 50 mM concentration of the L-isomer. DI water was added to the solid noncanonical amino acid (ncAA) to approximately 90% of the final volume needed to make the stock, and 6.0 N NaOH was used as needed to fully dissolve the noncanonical amino acid (ncAA) powder in the water. Water was added to the final volume and the solution was sterile filtered through a 0.2 micron filter. OmeY was pH adjusted to 7 prior to sterile filtering. No pH adjustment was performed unless otherwise noted. Filtered solutions were stored at 4? C. for up to four weeks for less labile noncanonical amino acids (ncAAs); for more labile noncanonical amino acids (ncAAs) (AzF, BPHe, DOPA), 50 mM stocks were made immediately prior to induction.
Reporter Plasmid Construction
[0205] The pCTCON2-FAPB2.3.6 and pCTCON2-FAPB2.3.6L1TAG reporter constructs are described in Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269. pCTCON2-FAPB2.3.6 was used as a wildtype (WT) control to compare TAG-containing samples against and was not used for library construction or sorting.
Tyrosyl-tRNA Synthetase (TyrRS) and Leucyl tRNA Synthetase (LeuRS) Library Construction and Characterization
[0206] The previously reported pRS315-AcFRS plasmid with additional NcoI and NdeI restriction enzyme recognition sites flanking the aminoacyl-tRNA synthetase (aaRS) gene (Potts, K. A., Stieglitz, J. T., Lei, M., Van Deventer, J. A. (2020) Reporter system architecture affects measurements of noncanonical amino acid incorporation efficiency and fidelity, Mol. Syst. Des. Eng. 5, 573-588) was further modified by replacing the ampicillin resistance marker with a kanamycin/neomycin resistance marker. Restriction enzyme sites XmaI and AvrII were introduced on either side of the ampicillin resistance marker via Quick Change, then the kanamycin/neomycin marker was amplified from pREP4 with primers containing 30 bases of overlap with pRS315-AcFRS (containing the NcoI and NdeI sites) that had been double digested with XmaI and AvrII. The PCR amplified kanamycin/neomycin gene was then cloned into the digest pRS315-AcFRS vector via Gibson assembly. Gibson assembly reactions were transformed into chemically competent E. coli and plated on LB plates with kanamycin at a final concentration of 34 ?g/mL. Colonies were inoculated in selective liquid media, grown to saturation, miniprepped, and sequenced. The resulting plasmid was named pRS315-KanR-AcFRS. Additional PCRs of the kanamycin/neomycin resistance gene were done to remove a NcoI restriction enzyme site from the gene and were cloned into the pRS315-KanR-AcFRS plasmid that was double digested with XmaI and AvrII. The resulting plasmid was sequence verified and named pRS315-KanRmod-AcFRS. The plasmid pRS315-EcLeuRS containing the E. coli leucyl-tRNA synthetase (LeuRS) with a T252A mutation in the editing domain is described in Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269. The entire Leucyl tRNA synthetase (LeuRS) gene and cognate tRNA as well as the constitutive promoters for each gene were PCR amplified from pRS315-EcLeuRS and cloned into pRS315-KanRmod-AcFRS that was double digested with SacI and PstI via Gibson assembly. The resulting plasmid was sequence verified and named pRS315-KanRmod-EcLeuRS.
[0207] Primers containing degenerate codons were used to amplify the aminoacyl-tRNA synthetase (aaRS) genes from parent plasmids pRS315-KanRmod-EcLeuRS (LeuRS library) or pRS315-KanRmod-AcFRS (TyrRS library). Seven positions in the Tyrosyl-tRNA synthetase (TyrRS) active site were chosen for mutation: Y37, L71, Q179, N182, F183, L186, and Q195 (Tables 1 and 2). A separate primer with only the WT tyrosine codon at position Y37 was also used. The AcFRS gene contained a preexisting D165G mutation. An additional mutation, I7M, was inadvertently introduced when a primer containing that mutation was received and used for PCR amplification of the gene. However, a side-by-side comparison of AcFRS with and without the I7M mutations showed that the activity of AcFRS was not significantly affected by the presence of the mutation (
Error-Prone PCR (epPCR) Library Construction and Characterization
[0208] E. coli Tyrosyl-tRNA synthetase (TyrRS) mutant A-DOPARS-8 was used as a template for error-prone polymerase chain reaction (epPCR). Error-prone polymerase chain reaction (epPCR) was performed by combining 5 ?L 10? ThermoPol Buffer, 1 ?L 10 mM dNTP, 5 ?L 20 ?M or 100 ?M dPTP, 5 ?L 20 ?M or 100 ?M 8-oxo-dGTP, 1 ?L Taq polymerase, 1 ?L DNA template (1 ng total), and 2.5 ?L of each forward and reverse primer at 10 ?M to amplify across the entire aminoacyl-tRNA synthetase (aaRS) gene, as well as 27 ?L sterile water to bring the total volume to 50 ?L. Two concentrations (20 ?M or 100 ?M) of mutagenic dNTPs were used to vary the number of mutations made across the aminoacyl-tRNA synthetase (aaRS). Reactions were run on the thermal cycler at 95? C. for 500 s followed by 16 cycles of 95? C. for 45 s, 60? C. for 30 s, 72? C. for 135 s. Once cycles were complete, samples underwent a 10 min 72? C. final extension and hold at 4? C. until they were removed from the thermal cycler.
[0209] Following PCR with mutagenic dNTPs, each gene was amplified again via PCR at a higher volume to prepare enough DNA for electroporation into yeast. PCR was performed by combining 20 ?L 10? ThermoPol Buffer, 4 ?L 10 mM dNTP, 4 ?L Taq polymerase, 10 ?L error-prone polymerase chain reaction (epPCR)-mutated DNA template, and 2 ?L of each forward and reverse primer at 100 ?M to amplify across the entire aminoacyl-tRNA synthetase (aaRS) gene, as well as 158 ?L sterile water to bring the total volume to 50 ?L. Reactions were run on the thermal cycler at 95? C. for 180 s followed by 30 cycles of 95? C. for 45 s, 55? C. for 30 s, 72? C. for 135 s. Once cycles were completed, samples underwent a 10 min 72? C. final extension and hold at 4? C. until they were removed from the thermal cycler.
[0210] Digested pRS315-KanRmod vectors with tRNA.sub.CUA.sup.Tyr (tyrosyl transfer RNA with a CUA anticodon) were prepared in the same manner as for the E. coli Tyrosyl-tRNA synthetase (TyrRS) saturation mutagenesis library (see above). For each of the DOPARS error-prone polymerase chain reaction (epPCR) libraries at both concentrations of mutagenic dNTPs, the following masses of DNA were Pellet Painted to concentrate: 4 ?g error-prone polymerase chain reaction (epPCR)-amplified aminoacyl-tRNA synthetase (aaRS), 1 ?g double digested pRS315-KanRmod vector, and 1 ?g pCTCON2-FAPB2.3.6L1TAG. Preparation of electrocompetent cells, electroporations, and subsequent characterization proceeded in same manner as construction of E. coli Tyrosyl-tRNA synthetase (TyrRS) and Leucyl tRNA synthetase (LeuRS) libraries.
Yeast Transformations, Propagation, and Induction
[0211] Reporter plasmids pCTCON2-FAPB2.3.6L1TAG or pCTCON2-FAPB2.3.6 (TRP marker) and suppression machinery plasmids (LEU marker) were co-transformed into Zymo competent RJY100 cells, plated on solid SD-SCAA media (-TRP-LEU-URA), and grown at 30? C. until colonies appeared (3 days). WT controls containing only pCTCON2-FAPB2.3.6 were transformed similarly into Zymo competent RJY100 cells, plated on solid SD-SCAA media (-TRP-URA), and grown at 30? C. until colonies appeared (3 days). Inoculation and propagation in liquid SD media and induction in SG media are described in Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269. Briefly: Three separate transformant colonies (biological triplicates) were inoculated from each plate except the wild type (WT) control, where only one colony was inoculated, in 5 mL SD media of the same composition as the plates from transformations. All liquid cultures were supplemented with penicillin-streptomycin to prevent bacterial contamination. Liquid cultures were grown to saturation and then diluted to OD.sub.600 1 in 5 mL of the same media. The diluted cultures were grown to OD.sub.600 2-5 (usually 4-6 h at 30? C. with shaking) and then induced in 2 mL SG media at OD.sub.600 1. Induction cultures with no noncanonical amino acid (ncAA) and 1 mM of each respective noncanonical amino acid (ncAA) were prepared for each replicate. The WT control was only induced with no noncanonical amino acid (ncAA). In the case of the error-prone polymerase chain reaction (epPCR) aminoacyl-tRNA synthetases (aaRSs), induction cultures with 0.1 mM of the respective noncanonical amino acid (ncAA) were also prepared. Induced cultures were incubated at 20? C. with shaking at 300 rpm for 16 h.
[0212] For library propagation and induction, the steps were identical but in 100 mL media inoculated from a 2 mL glycerol stock of the library with propagation and inductions in 100 mL in order to preserve the full diversity of the library.
Flow Cytometry Data Collection and Analysis
[0213] Freshly induced samples were labeled in 1.7 mL microcentrifuge tubes or 96-well V-bottom plates. Flow cytometry was performed on an Attune NxT flow cytometer (Life Technologies) at the Tufts University Science and Technology Center. Detailed protocols describing the antibody labeling process are described in Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269. Briefly: 2 million cells were removed to either microcentrifuge tubes (controls) or 96-well V-bottom plates and centrifuged to pellet. Supernatant was aspirated or decanted and cells were resuspended in room temperature phosphate-buffered saline (PBSA) to wash. Centrifugation, aspiration/decanting, and wash steps were repeated twice more. Samples were resuspended in 50 ?L room temperature phosphate-buffered saline (PBSA) with 1:500 dilutions of each primary antibody label (Table 27) and incubated at room temperature on a rotary wheel or orbital shaker for 30 min. Following primary labeling, samples were kept on ice or in a refrigerated centrifuge at 4? C. for remainder of steps, until resuspension for evaluation on the flow cytometer. After 30 min primary labeling, cells were resuspended in ice-cold phosphate-buffered saline (PBSA), pelleted, and aspirated/decanted. Wash steps were repeated twice more to remove extraneous primary label. Samples were resuspended in 50 ?L ice-cold phosphate-buffered saline (PBSA) with 1:500 dilutions of each secondary label (Table 27) and incubated on ice in the dark for 15 min. Samples were diluted in ice-cold phosphate-buffered saline (PBSA), pelleted, and aspirated/decanted. Wash steps were repeated once more, and cells were either immediately resuspended for evaluation on the flow cytometer or kept as wet pellets on ice or at 4? C. in the dark until resuspension (up to 6 h).
TABLE-US-00031 TABLE 27 Antibody labels and dilutions used in preparation for detection of yeast-displayed constructs via flow cytometry. Detection Primary label (dilution) Secondary label (dilution) HA Mouse anti-HA (1:500) Goat anti-mouse Alexa tag (displaying) Fluor 488 (1:500) c-Myc tag (full Chicken anti- Goat anti-chicken Alexa length) CMYC (1:500) Fluor 647 (1:500)
Calculating Relative Readthrough Efficiency (RRE) and Maximum Misincorporation Frequency (MMF)
[0214] Flow cytometry data analysis was performed using FlowJo and Microsoft Excel. Detailed descriptions of the calculations for relative readthrough efficiency (RRE) and maximum misincorporation frequency (MMF) with corresponding error propagation are provided in Potts, K. A., Stieglitz, J. T., Lei, M., Van Deventer, J. A. (2020) Reporter system architecture affects measurements of noncanonical amino acid incorporation efficiency and fidelity, Mol. Syst. Des. Eng. 5, 573-588 and in Stieglitz, J. T., Kehoe, H. P., Lei, M., and Van Deventer, J. A. (2018) A Robust and Quantitative Reporter System To Evaluate Noncanonical Amino Acid Incorporation in Yeast, ACS Synth Biol 7, 2256-2269.
Fluorescence-Activated Cell Sorting (FACS)
[0215] Aminoacyl-tRNA synthetase library populations were induced and labeled using the methods described above. For na?ve (unsorted) library screens, a larger number of cells were used for antibody labeling and antibody/PBSA volumes for primary and secondary labeling were adjusted accordingly. A number of cells was used that was at minimum ten times larger than the library population being sorted for all subsequent screens. Cell pellets were resuspended in ice-cold phosphate-buffered saline (PBSA) immediately prior to sorting. Samples were sorted using a FACSAria? III (Becton, Dickinson and Company) flow cytometer or a combination of a MoFlow Legacy (Beckman Coulter) and a FACSAria? III at the Tufts University Flow Cytometry Core. Sorted samples were collected in 14 mL culture tubes containing 1 mL SD-SCAA (-TRP-LEU-URA) supplemented with penicillin-streptomycin. Following sorting, the sides of the culture tubes were washed with an additional 1 mL SD-SCAA (-TRP-LEU-URA), then transported back to the main laboratory facilities. An additional 3 mL SD-SCAA (-TRP-LEU-URA) was added to each sample and cultures were then grown at 30? C. with shaking at 300 rpm until saturated (2-3 days). Subsequent flow cytometry characterization was performed on each sorted population before the following round of screening (see above for details).
Aminoacyl-tRNA Synthetase (aaRS) Characterization Post-FACS
[0216] Once library populations with low cAA and high noncanonical amino acid (ncAA) were isolated, aminoacyl-tRNA synthetase (aaRS) plasmid DNA was purified using a Zymoprep Yeast Plasmid Miniprep II kit with slightly modified manufacturer's protocols. 500 ?L of 5 mL cultures library populations that had been previously propagated for flow cytometry characterization were diluted into 4.5 mL of the same media, supplemented with penicillin-streptomycin. Cultures were grown for 4 h at 30? C. with shaking at 300 rpm. 1 mL of each culture was removed to a microcentrifuge tube and pelleted at 13,000 rpm for 30 s. Supernatant was aspirated and each pellet was resuspended in 200 ?L Solution I with 6 ?L reconstituted zymolase from the Zymo kit. Each sample was vortexed briefly and then incubated at 37? C. with shaking at 300 rpm overnight or up to 24 h. 200 ?L of Solution II from the Zymo kit was added and tubes were inverted to mix. 400 ?L of Solution III was added and tubes were inverted to mix. Samples were pelleted at 15,000 rpm (max speed) for 30 min to separate out cell debris. The supernatant was transferred to Epoch Life Science E. coli DNA purification columns and purified using Epoch protocols. DNA was eluted in 40 ?L sterile water and then transformed into chemically competent E. coli DH5alphaZ1 cells and plated on LB media with 34 ?g/mL kanamycin. 10-12 individual colonies were inoculated into separate 5 mL LB cultures with 50 ?g/mL kanamycin and grown overnight at 37? C. with shaking at 300 rpm. Cultures were miniprepped using an Epoch E. coli GenCatch? Plasmid DNA Mini-Prep Kit and submitted for sequencing.
OTHER EMBODIMENTS
[0217] From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adapt it to various usages and conditions. Such embodiments are also within the scope of the following claims.
[0218] The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or subcombination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
[0219] All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.