SYNTHETIC ACTIVATION OF MULTIMERIC TRANSMEMBRANE RECEPTORS
20240200085 ยท 2024-06-20
Assignee
Inventors
- Kasper R?jkj?r ANDERSEN (Aarhus, DK)
- Elena Simona RADUTOIU (Aarhus, DK)
- Henriette R?BSAM (Aarhus, DK)
- Christina KR?NAUER (Aarhus, DK)
- Jens Stougaard JENSEN (Aarhus, DK)
Cpc classification
C07K2319/40
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C12N15/8241
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
Abstract
The present disclosure relates to synthetic approaches based on affinity peptides to drive assembly and activation of transmembrane receptor complexes. The present disclosure further relates to the core NFR1-NFR5 receptor complex initiating the cortical root nodule organogenesis program and the epidermal program, as well as the identification of barley receptor complexes that function in root nodule symbiosis.
Claims
1. A genetically modified cell comprising: a transmembrane (TM) receptor complex comprising a first subunit polypeptide and a second subunit polypeptide, wherein the first subunit polypeptide comprises an affinity polypeptide that binds to the second subunit polypeptide intracellularly inducing oligomerization; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates TM receptor signaling, wherein the affinity polypeptide is heterologous to the first subunit polypeptide.
2. The genetically modified cell of claim 1, wherein the affinity polypeptide binds directly to the second subunit polypeptide, and/or wherein the second subunit polypeptide comprises a tag polypeptide, and wherein the affinity polypeptide binds to the tag polypeptide.
3. The genetically modified cell of claim 2, wherein the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, and a ubiquitin tag polypeptide.
4. The genetically modified cell of claim 1, wherein the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, and an anticalin, and a synthetic version of any of the foregoing.
5. The genetically modified cell of claim 1, wherein the cell is a eubacterial cell, an archaeal cell, or a eukaryotic cell, optionally wherein the eukaryotic cell is a plant cell, an animal cell, or a fungal cell.
6. The genetically modified cell of claim 1, wherein the cell is a plant cell and the first subunit polypeptide and/or the second subunit polypeptide are selected from a LysM receptor, a Leucine rich repeat (LRR) receptor, a Malectin like receptor, a plant TM receptor, a plant SPTM (pSPTM) receptor, and a plant SPTM receptor comprising an intracellular kinase domain (pSPTM-kinase), optionally wherein the first subunit polypeptide and/or the second subunit polypeptide lacks an ectodomain and/or a transmembrane domain.
7. The genetically modified cell of claim 6, wherein the first subunit polypeptide is a NFR1 polypeptide and the second subunit polypeptide is a NFR5 polypeptide, wherein the first subunit polypeptide is a NFR5 polypeptide and the second subunit is a NFR1 polypeptide, wherein the first subunit polypeptide is a LYK3 polypeptide and the second subunit polypeptide is a NFP polypeptide, wherein the first subunit polypeptide is a NFP polypeptide and the second subunit polypeptide is a LYK3 polypeptide, wherein the first subunit polypeptide is a RLK4 receptor polypeptide and the second subunit polypeptide is a RLK10 receptor polypeptide, or wherein the first subunit polypeptide is a RLK10 polypeptide and the second subunit polypeptide is a RLK4 polypeptide.
8. The genetically modified cell of claim 7, wherein the NFR1, LYK3, or RLK4 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 56, and wherein the NFR5, NFP, or RLK10 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, and SEQ ID NO: 57.
9. A bispecific affinity polypeptide comprising: a first affinity polypeptide that binds to an intracellular portion of a first subunit polypeptide of a TM receptor; and a second affinity polypeptide that binds to an intracellular portion of a second subunit polypeptide of the TM receptor; wherein binding of the first affinity polypeptide to the first subunit polypeptide and of the second affinity polypeptide to the second subunit polypeptide induces oligomerization; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates TM receptor signaling.
10. The bispecific affinity polypeptide of claim 9, wherein the first affinity polypeptide binds directly to the first subunit polypeptide and/or wherein the second affinity polypeptide binds directly to the second subunit polypeptide; or wherein the first subunit polypeptide comprises a tag polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide, and/or wherein the second subunit polypeptide comprises a tag polypeptide, and wherein the second affinity polypeptide binds to the tag polypeptide.
11. The bispecific affinity polypeptide of claim 10, wherein the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, and a ubiquitin tag polypeptide.
12. The bispecific affinity polypeptide of claim 9, wherein the first affinity polypeptide and the second affinity polypeptide are selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, and an anticalin, and a synthetic version of any of the foregoing.
13. A method of screening transmembrane (TM) receptor complexes comprising: (a) providing a cell expressing a first subunit polypeptide of a TM receptor; (b) expressing a second subunit polypeptide of a TM receptor in the cell; and (c) assaying the cell for a TM receptor phenotype; and wherein (i) the presence of the TM receptor phenotype indicates the first subunit polypeptide and the second subunit polypeptide oligomerize to form the TM receptor; or (ii) the absence of the TM receptor phenotype indicates the first subunit polypeptide and the second subunit polypeptide do not oligomerize to form a TM receptor, and wherein (1) the second subunit polypeptide comprises a tag polypeptide, the first subunit polypeptide comprises an affinity polypeptide that binds to the tag polypeptide, and the affinity polypeptide is heterologous to the first subunit polypeptide, or (2) the first subunit polypeptide comprises the tag polypeptide, the second subunit polypeptide comprises the affinity polypeptide that binds to the tag polypeptide, and the affinity polypeptide is heterologous to the second subunit polypeptide.
14. The method of claim 13, wherein the binding partner for the first subunit polypeptide is unknown and step (b) is repeated using two or more candidate second subunit polypeptides to identify the second subunit polypeptide that is the binding partner for the first subunit polypeptide.
15. The method of claim 13, wherein the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, and a ubiquitin tag polypeptide.
16. The method of claim 13, wherein the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, and an anticalin, and a synthetic version of any of the foregoing.
17. The method of claim 13, wherein the cell is a eubacterial cell, an archaeal cell, or a eukaryotic cell, optionally wherein the eukaryotic cell is a plant cell, an animal cell, or a fungal cell.
18. A genetically modified plant or part thereof comprising the genetically modified plant cell of claim 1 and/or the bispecific affinity polypeptide of claim 9.
19. The genetically modified plant or part thereof of claim 18, wherein the plant is selected from the group consisting of cassava, corn, cowpea, rice, barley, wheat, Trema spp., apple, pear, plum, apricot, peach, almond, walnut, strawberry, raspberry, blackberry, red currant, black currant, melon, cucumber, pumpkin, squash, grape, bean, soybean, pea, chickpea, cowpea, pigeon pea, lentil, Bambara groundnut, lupin, pulses, Medicago spp., Lotus spp., forage legumes, indigo, legume trees, and hemp.
20. A method of making the genetically modified plant cell of claim 1, comprising introducing a genetic alteration to the plant cell comprising a first nucleic acid sequence encoding a heterologous first subunit polypeptide comprising an affinity polypeptide; and/or introducing a genetic alteration to the plant cell comprising a second nucleic acid sequence encoding a heterologous second subunit polypeptide optionally comprising a tag polypeptide; or comprising genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a first endogenous nuclear genome sequence encoding the first subunit polypeptide, wherein the first subunit polypeptide is genetically modified to comprise the affinity polypeptide; and/or genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a second endogenous nuclear genome sequence encoding the second subunit polypeptide, wherein the endogenous second subunit polypeptide is genetically modified to comprise a tag polypeptide.
21. An expression vector or isolated DNA molecule comprising one or more nucleotide sequences encoding a first subunit polypeptide of a TM receptor comprising an affinity polypeptide, wherein the affinity polypeptide is heterologous to the first subunit polypeptide, and wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence; one or more nucleotide sequences encoding a second subunit polypeptide of a TM receptor optionally comprising a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence; one or more nucleotide sequences encoding: (a) a first subunit polypeptide of a transmembrane (TM) receptor complex comprising an affinity polypeptide, wherein the affinity polypeptide is heterologous to the first subunit polypeptide; and/or (b) a second subunit polypeptide of a TM receptor optionally comprising a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence; and/or one or more nucleotide sequences encoding a bispecific affinity polypeptide comprising a first affinity polypeptide that binds to an intracellular portion of a first subunit polypeptide of a TM receptor and a second affinity polypeptide that binds to an intracellular portion of a second subunit polypeptide of a TM receptor, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
22. A bacterial cell or an Agrobacterium cell comprising the expression vector or isolated DNA molecule of claim 21.
23. A genetically modified plant, plant part, plant cell, or seed comprising the expression vector or isolated DNA molecule of claim 21.
24. A kit comprising the expression vector or isolated DNA molecule of claim 21 or the bacterial cell or the Agrobacterium cell of claim 22.
25. A method of activating a target transmembrane (TM) receptor complex or inducing organogenesis comprising: introducing a genetic alteration via an expression vector or isolated DNA molecule of claim 21 to a cell.
26. A genetically modified plant cell comprising: an NFR1-NFR5 receptor complex comprising a first subunit polypeptide and a second subunit polypeptide, wherein the first subunit polypeptide comprises an affinity polypeptide that binds to the second subunit polypeptide inducing oligomerization, and wherein the affinity polypeptide is heterologous to the first subunit polypeptide; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates NFR1-NFR5 receptor complex signaling and wherein (i) the first subunit polypeptide is an NFR1 polypeptide and the second subunit polypeptide is an NFR5 polypeptide, or (ii) the first subunit polypeptide is the NFR5 polypeptide and the second subunit polypeptide is the NFR1 polypeptide.
27. A bispecific affinity polypeptide for activation of an NFR1-NFR5 receptor complex comprising: a first affinity polypeptide that binds to an intracellular portion of an NFR1 polypeptide; and a second affinity polypeptide that binds to an intracellular portion of an NFR5 polypeptide; wherein binding of the first affinity polypeptide to the NFR1 polypeptide and of the second affinity to the NFR5 polypeptide induces dimerization; and wherein dimerization of the NFR1 polypeptide and the NFR5 polypeptide activates NFR1-NFR5 receptor complex signaling.
28. An expression vector or isolated DNA molecule comprising one or more nucleotide sequences encoding a NFR1 polypeptide comprising an affinity polypeptide, wherein the affinity polypeptide is heterologous to the NFR1 polypeptide, and wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence; one or more nucleotide sequences encoding a NFR5 polypeptide optionally comprising a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence; one or more nucleotide sequences encoding: (a) a NFR1 polypeptide comprising an affinity polypeptide, wherein the affinity polypeptide is heterologous to the first subunit polypeptide; and/or (b) a NFR5 polypeptide optionally comprising a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence; and/or one or more nucleotide sequences encoding a bispecific affinity polypeptide comprising a first affinity polypeptide that binds to an intracellular portion of a NFR1 polypeptide and a second affinity polypeptide that binds to an intracellular portion of a NFR5 polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0258] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0259]
[0260]
[0261]
[0262]
[0263]
[0264]
[0265]
DETAILED DESCRIPTION
[0266] The following description sets forth exemplary methods, parameters, and the like. It should be recognized, however, that such description is not intended as a limitation on the scope of the present disclosure but is instead provided as a description of exemplary embodiments.
Genetically Modified Cells
[0267] An aspect of the disclosure includes a genetically modified cell including: a transmembrane (TM) receptor complex including a first subunit polypeptide and a second subunit polypeptide, wherein the first subunit polypeptide includes an affinity polypeptide that binds to the second subunit polypeptide intracellularly inducing oligomerization; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates TM receptor signaling, wherein the affinity polypeptide is heterologous to the first subunit polypeptide. In an additional embodiment of this aspect, the TM receptor is a single-pass TM (SPTM) receptor, or the TM receptor is a SPTM receptor including an intracellular kinase domain (SPTM-kinase). In a further embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide binds directly to the second subunit polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the second subunit polypeptide includes a tag polypeptide, and the affinity polypeptide binds to the tag polypeptide. In still another embodiment of this aspect, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In an additional embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In a further embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In some embodiments, the VHH can be synthetic (e.g., a synthetic Nanobody?).
[0268] In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the cell is a eubacterial cell, an archaeal cell, or a eukaryotic cell. Single-pass transmembrane proteins in different cells are disclosed in, for example, Pogozheva and Lomize (2018), Evolution and adaptation of single-pass transmembrane proteins, BBA-Biomembranes, 1860(2):364-377. In another embodiment of this aspect, the eukaryotic cell is a plant cell, an animal cell, or a fungal cell. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the cell is a plant cell and the first subunit polypeptide and/or the second subunit polypeptide are selected from a LysM receptor, a Leucine rich repeat (LRR) receptor, a Malectin like receptor, a plant TM receptor, a plant SPTM (pSPTM) receptor, and a plant SPTM receptor including an intracellular kinase domain (pSPTM-kinase). In a further embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor. In an additional embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide lacks an ectodomain and/or a transmembrane domain. In another embodiment of this aspect, which may be combined with any of the preceding embodiments where the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor, the first subunit polypeptide is a NFR1 polypeptide and the second subunit polypeptide is a NFR5 polypeptide, wherein the first subunit polypeptide is a NFR5 polypeptide and the second subunit is a NFR1 polypeptide, wherein the first subunit polypeptide is a LYK3 polypeptide and the second subunit polypeptide is a NFP polypeptide, wherein the first subunit polypeptide is a NFP polypeptide and the second subunit polypeptide is a LYK3 polypeptide, wherein the first subunit polypeptide is a RLK4 receptor polypeptide and the second subunit polypeptide is a RLK10 receptor polypeptide, or wherein the first subunit polypeptide is a RLK10 polypeptide and the second subunit polypeptide is a RLK4 polypeptide. In a further embodiment of this aspect, the NFR1, LYK3, or RLK4 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 56, and wherein the NFR5, NFP, or RLK10 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, and SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide binding to the second subunit polypeptide is regulated by a small molecule.
[0269] Another aspect of the disclosure includes a genetically modified plant cell including: an NFR1-NFR5 receptor complex including a first subunit polypeptide and a second subunit polypeptide, wherein the first subunit polypeptide includes an affinity polypeptide that binds to the second subunit polypeptide inducing oligomerization, and wherein the affinity polypeptide is heterologous to the first subunit polypeptide; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates NFR1-NFR5 receptor complex signaling and wherein (i) the first subunit polypeptide is an NFR1 polypeptide and the second subunit polypeptide is an NFR5 polypeptide, or (ii) the first subunit polypeptide is the NFR5 polypeptide and the second subunit polypeptide is the NFR1 polypeptide. In an additional embodiment of this aspect, the NFR1 polypeptide and/or the NFR5 polypeptide lacks an ectodomain and/or a transmembrane domain. In a further embodiment of this aspect, which may be combined with any of the preceding embodiments, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide binds directly to an intracellular portion of the second subunit polypeptide. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the second subunit polypeptide includes a tag polypeptide fused to an intracellular portion of the second subunit polypeptide, and wherein the affinity polypeptide binds to the tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In an additional embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In still another embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In a further embodiment of this aspect, the affinity polypeptide is VHH.sub.LaG16. In another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide binding to the second subunit polypeptide is regulated by a small molecule.
[0270] A further aspect of the disclosure includes a bispecific affinity polypeptide for activation of an NFR1-NFR5 receptor including: a first affinity polypeptide that binds to an intracellular portion of an NFR1 polypeptide, wherein the first affinity polypeptide is heterologous to the NFR1 polypeptide; a second affinity polypeptide that binds to an intracellular portion of an NFR5 polypeptide, wherein the affinity polypeptide is heterologous to the NFR5 receptor subunit polypeptide; and wherein binding of the first affinity polypeptide to the NFR1 polypeptide and of the second affinity to the NFR5 polypeptide induces dimerization; and wherein dimerization of the NFR1 polypeptide and the NFR5 polypeptide activates the NFR1-NFR5 receptor. In an additional aspect of this aspect. the NFR1 polypeptide and/or the NFR5 polypeptide lacks an ectodomain and/or a transmembrane domain. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide binds directly to the NFR1 polypeptide and/or wherein the second affinity polypeptide binds directly to the NFR5 polypeptide. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the NFR1 polypeptide includes a tag polypeptide fused to an intracellular portion of the NFR1 polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide; and/or wherein the NFR5 polypeptide includes a tag polypeptide fused to an intracellular portion of the NFR5 polypeptide, and wherein the second affinity polypeptide binds to the tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a luciferase tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In another embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide and the second affinity polypeptide are selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In a further embodiment of this aspect, the first affinity polypeptide and/or the second affinity polypeptide is a heavy-chain variable domain (VHH). In an additional embodiment of this aspect, the affinity polypeptide is VHH.sub.LaG16. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide binding to the NFR1 polypeptide is regulated by a small molecule and/or the second affinity polypeptide binding to the NFR5 polypeptide is regulated by a small molecule.
Bispecific Affinity Polypeptides
[0271] An additional aspect of the disclosure includes a bispecific affinity polypeptide including: a first affinity polypeptide that binds to an intracellular portion of a first subunit polypeptide of a TM receptor; and a second affinity polypeptide that binds to an intracellular portion of a second subunit polypeptide of the TM receptor; wherein binding of the first affinity polypeptide to the first subunit polypeptide and of the second affinity polypeptide to the second subunit polypeptide induces oligomerization; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates TM receptor signaling. In a further embodiment of this aspect, the TM receptor is a single-pass TM (SPTM) receptor, or the TM receptor is a SPTM including an intracellular kinase domain (SPTM-kinase). In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide binds directly to the first subunit polypeptide and/or the second affinity polypeptide binds directly to the second subunit polypeptide. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the first subunit polypeptide includes a tag polypeptide, and the first affinity polypeptide binds to the tag polypeptide, and/or the second subunit polypeptide includes a tag polypeptide, and the second affinity polypeptide binds to the tag polypeptide. In still another embodiment of this aspect, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In an additional embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In a further embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the first subunit polypeptide and/or the second subunit polypeptide are selected from a LysM receptor, a Leucine rich repeat (LRR) receptor, a Malectin like receptor, a plant TM receptor, a plant SPTM (pSPTM) receptor, and a plant SPTM receptor including an intracellular kinase domain (pSPTM-kinase). In yet another embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor. In an additional embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide lacks an ectodomain and/or a transmembrane domain. In another embodiment of this aspect, which may be combined with any of the preceding embodiments where the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor, the first subunit polypeptide is a NFR1 polypeptide and the second subunit polypeptide is a NFR5 polypeptide, wherein the first subunit polypeptide is a NFR5 polypeptide and the second subunit is a NFR1 polypeptide, wherein the first subunit polypeptide is a LYK3 polypeptide and the second subunit polypeptide is a NFP polypeptide, wherein the first subunit polypeptide is a NFP polypeptide and the second subunit polypeptide is a LYK3 polypeptide, wherein the first subunit polypeptide is a RLK4 receptor polypeptide and the second subunit polypeptide is a RLK10 receptor polypeptide, or wherein the first subunit polypeptide is a RLK10 polypeptide and the second subunit polypeptide is a RLK4 polypeptide. In a further embodiment of this aspect, the NFR1, LYK3, or RLK4 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5, NFP, or RLK10 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide binding to the second subunit polypeptide is regulated by a small molecule.
[0272] A further aspect of the disclosure includes a bispecific affinity polypeptide for activation of an NFR1-NFR5 receptor including: a first affinity polypeptide that binds to an intracellular portion of an NFR1 polypeptide, wherein the first affinity polypeptide is heterologous to the NFR1 polypeptide; a second affinity polypeptide that binds to an intracellular portion of an NFR5 polypeptide, wherein the affinity polypeptide is heterologous to the NFR5 receptor subunit polypeptide; and wherein binding of the first affinity polypeptide to the NFR1 polypeptide and of the second affinity to the NFR5 polypeptide induces dimerization; and wherein dimerization of the NFR1 polypeptide and the NFR5 polypeptide activates the NFR1-NFR5 receptor. In an additional aspect of this aspect. the NFR1 polypeptide and/or the NFR5 polypeptide lacks an ectodomain and/or a transmembrane domain. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide binds directly to the NFR1 polypeptide and/or wherein the second affinity polypeptide binds directly to the NFR5 polypeptide. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the NFR1 polypeptide includes a tag polypeptide fused to an intracellular portion of the NFR1 polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide; and/or wherein the NFR5 polypeptide includes a tag polypeptide fused to an intracellular portion of the NFR5 polypeptide, and wherein the second affinity polypeptide binds to the tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a luciferase tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In another embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide and the second affinity polypeptide are selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In a further embodiment of this aspect, the first affinity polypeptide and/or the second affinity polypeptide is a heavy-chain variable domain (VHH). In an additional embodiment of this aspect, the affinity polypeptide is VHH.sub.LaG16. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the first affinity polypeptide binding to the NFR1 polypeptide is regulated by a small molecule and/or the second affinity polypeptide binding to the NFR5 polypeptide is regulated by a small molecule.
Methods of Screening
[0273] A further aspect of the disclosure includes methods of screening transmembrane (TM) receptor including: (a) providing a cell expressing a first subunit polypeptide of a TM receptor; (b) expressing a second subunit polypeptide of a TM receptor in the cell; and (c) assaying the cell for a TM receptor phenotype; and wherein (i) the presence of the TM receptor phenotype indicates the first subunit polypeptide and the second subunit polypeptide oligomerize to form the TM receptor; or (ii) the absence of the TM receptor phenotype indicates the first subunit polypeptide and the second subunit polypeptide do not oligomerize to form a TM receptor, and wherein (1) the second subunit polypeptide includes a tag polypeptide, the first subunit polypeptide includes an affinity polypeptide that binds to the tag polypeptide, and the affinity polypeptide is heterologous to the first subunit polypeptide, or (2) the first subunit polypeptide includes the tag polypeptide, the second subunit polypeptide includes the affinity polypeptide that binds to the tag polypeptide, and the affinity polypeptide is heterologous to the second subunit polypeptide. In an additional embodiment of this aspect, the TM receptor is a single-pass TM (SPTM) receptor, or the TM receptor is a SPTM including an intracellular kinase domain (SPTM-kinase). In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the binding partner for the first subunit polypeptide is unknown and (b) is repeated using two or more candidate second subunit polypeptides to identify the second subunit polypeptide that is the binding partner for the first subunit polypeptide. In a further embodiment of this aspect, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In an additional embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In a further embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the cell is a eubacterial cell, an archaeal cell, or a eukaryotic cell. In another embodiment of this aspect, the eukaryotic cell is a plant cell, an animal cell, or a fungal cell. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the cell is a plant cell and the first subunit polypeptide and/or the second subunit polypeptide are selected from a LysM receptor, a Leucine rich repeat (LRR) receptor, a Malectin like receptor, a plant TM receptor, a plant SPTM (pSPTM) receptor, and a plant SPTM receptor including an intracellular kinase domain (pSPTM-kinase). In a further embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor. In an additional embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide lacks an ectodomain and/or a transmembrane domain. In another embodiment of this aspect, which may be combined with any of the preceding embodiments where the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor, the first subunit polypeptide is a NFR1 polypeptide and the second subunit polypeptide is a NFR5 polypeptide, wherein the first subunit polypeptide is a NFR5 polypeptide and the second subunit is a NFR1 polypeptide, wherein the first subunit polypeptide is a LYK3 polypeptide and the second subunit polypeptide is a NFP polypeptide, wherein the first subunit polypeptide is a NFP polypeptide and the second subunit polypeptide is a LYK3 polypeptide, wherein the first subunit polypeptide is a RLK4 receptor polypeptide and the second subunit polypeptide is a RLK10 receptor polypeptide, or wherein the first subunit polypeptide is a RLK10 polypeptide and the second subunit polypeptide is a RLK4 polypeptide. In a further embodiment of this aspect, the NFR1, LYK3, or RLK4 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5, NFP, or RLK10 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide binding to the second subunit polypeptide is regulated by a small molecule.
Genetically Modified Plants and Related Methods
[0274] Some aspects of the disclosure are related to a genetically modified plant or part thereof including the genetically modified plant cell of any one of the preceding embodiments. An additional embodiment of this aspect further includes the TM receptor including the first subunit polypeptide and the second subunit polypeptide, wherein the first subunit polypeptide includes the affinity polypeptide that binds to the second subunit polypeptide intracellularly inducing oligomerization, and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates TM receptor signaling. In a further embodiment of this aspect, the affinity polypeptide binds directly to the second subunit polypeptide or wherein the second subunit polypeptide includes a tag polypeptide, and wherein the affinity polypeptide binds to the tag polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the genetically modified plant cell is selected from a root epidermal cell, a root cortex cell, a root endodermis cell, a root pericycle cell, a root primordia cell, a xylem cell, a phloem cell, a meristem cell, a leaf cell, a stem cell, a flower cell, or a fruit cell. In still another embodiment of this aspect, the genetically modified plant cell is a root epidermal cell, a root cortex cell, a root endodermis cell, a root pericycle cell, or a root primordia cell.
[0275] Some aspects of the disclosure are related to a genetically modified plant or part thereof including the bispecific affinity polypeptide of any one of the preceding embodiments. Another embodiment of this aspect further includes the first affinity polypeptide that binds to the intracellular portion of the first subunit polypeptide of the TM receptor and the second affinity polypeptide that binds to the intracellular portion of the second subunit polypeptide of the TM receptor, wherein binding of the first affinity polypeptide to the first subunit polypeptide and of the second affinity polypeptide to the second subunit polypeptide induces oligomerization; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates TM receptor signaling. In an additional embodiment of this aspect, the first affinity polypeptide binds directly to the first subunit polypeptide and/or wherein the second affinity polypeptide binds directly to the second subunit polypeptide; or wherein the first subunit polypeptide includes the tag polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide, and/or wherein the second subunit polypeptide includes the tag polypeptide, and wherein the second affinity polypeptide binds to the tag polypeptide.
[0276] In yet another embodiment of this aspect, which may be combined with any preceding embodiment that has a genetically modified plant or part thereof, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In still another embodiment of this aspect, which may be combined with any preceding embodiment that has a genetically modified plant or part thereof, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In a further embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In an additional embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In yet another embodiment of this aspect, which may be combined with any preceding embodiment that has a genetically modified plant or part thereof, the first subunit polypeptide and/or the second subunit polypeptide are selected from a LysM receptor, a Leucine rich repeat (LRR) receptor, a Malectin like receptor, a plant TM receptor, a plant SPTM (pSPTM) receptor, and a plant SPTM receptor including an intracellular kinase domain (pSPTM-kinase). In another embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor. In a further embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide lacks an ectodomain and/or a transmembrane domain. In yet another embodiment of this aspect, the first subunit polypeptide is a NFR1 polypeptide and the second subunit polypeptide is a NFR5 polypeptide, wherein the first subunit polypeptide is a NFR5 polypeptide and the second subunit is a NFR1 polypeptide, wherein the first subunit polypeptide is a LYK3 polypeptide and the second subunit polypeptide is a NFP polypeptide, wherein the first subunit polypeptide is a NFP polypeptide and the second subunit polypeptide is a LYK3 polypeptide, wherein the first subunit polypeptide is a RLK4 receptor polypeptide and the second subunit polypeptide is a RLK10 receptor polypeptide, or wherein the first subunit polypeptide is a RLK10 polypeptide and the second subunit polypeptide is a RLK4 polypeptide. In an additional embodiment of this aspect, the NFR1, LYK3, or RLK4 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5, NFP, or RLK10 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In a further embodiment of this aspect, which may be combined with any preceding embodiment that has a genetically modified plant or part thereof, the TM receptor is localized to a plant cell membrane. In yet another embodiment of this aspect, which may be combined with any preceding embodiment that has a genetically modified plant or part thereof, the plant is selected from the group of cassava (e.g., manioc, yucca, Manihot esculenta), corn (e.g., maize, Zea mays), rice (e.g., indica rice, japonica rice, aromatic rice, glutinous rice, Oryza sativa, Oryza glaberrima), wild rice (e.g., Zizania spp., Porteresia spp.), barley (e.g., Hordeum vulgare), sorghum (e.g., Sorghum bicolor), millet (e.g., finger millet, fonio millet, foxtail millet, pearl millet, barnyard millets, Eleusine coracana, Panicum sumatrense, Panicum milaceum, Setaria italica, Pennisetum glaucum, Digitaria spp., Echinocloa spp.), teff (e.g., Eragrostis tej), oat (e.g., Avena sativa), triticale (e.g., X Triticosecale Wittmack, Triticosecale schlanstedtense Wittm., Triticosecale neoblaringhemii A. Camus, Triticosecale neoblaringhemii A. Camus), rye (e.g., Secale cereale, Secale cereanum), wheat (e.g., common wheat, spelt, durum, einkorn, emmer, kamut, Triticum aestivum, Triticum spelta, Triticum durum, Triticum urartu, Triticum monococcum, Triticum turanicum, Triticum spp.), Trema spp. (e.g., Trema cannabina, Trema cubense, Trema discolor, Trema domingensis, Trema integerrima, Trema lamarckiana, Trema micrantha, Trema orientalis, Trema philippinensis, Trema strigilosa, Trema tomentosa, Trema levigata), apple (e.g., Malus domestica, Malus pumila, Pyrus malus), pear (e.g., Pyrus communis, Pyrus x bretschneideri, Pyrus pyrifolia, Pyrus sinkiangensis, Pyrus pashia, Pyrus spp.), plum (e.g., Mirabelle, greengage, damson, Prunus domestica, Prunus salicina, Prunus mume), apricot (e.g., Prunus armeniaca, Prunus brigantine, Prunus mandshurica), peach (e.g., Prunus persica), almond (e.g., Prunus dulcis, Prunus amygdalus), walnut (e.g., Persian walnut, English walnut, black walnut, Juglans regia, Juglans nigra, Juglans cinerea, Juglans californica), strawberry (e.g., Fragaria x ananassa, Fragaria chiloensis, Fragaria virginiana, Fragaria vesca), raspberry (e.g., European red raspberry, black raspberry, Rubus idaeus L., Rubus occidentalis, Rubus strigosus), blackberry (e.g., evergreen blackberry, Himalayan blackberry, Rubus fruticosus, Rubus ursinus, Rubus laciniatus, Rubus argutus, Rubus armeniacus, Rubus plicatus, Rubus ulmifolius, Rubus allegheniensis, Rubus subgenus Eubatus sect. Moriferi & Ursini), red currant (e.g., white currant, Ribes rubrum), black currant (e.g., cassis, Ribes nigrum), gooseberry (e.g., Ribes uva-crispa, Ribes grossulari, Ribes hirtellum), melon (e.g., watermelon, winter melon, casabas, cantaloupe, honeydew, muskmelon, Citrullus lanatus, Benincasa hispida, Cucumis melo, Cucumis melo cantalupensis, Cucumis melo inodorus, Cucumis melo reticulatus), cucumber (e.g., slicing cucumbers, pickling cucumbers, English cucumber, Cucumis sativus), pumpkin (e.g., Cucurbita pepo, Cucurbita maxima), squash (e.g., gourd, Cucurbita argyrosperma, Cucurbita ficifolia, Cucurbita maxima, Cucurbita moschata), grape (e.g., Vitis vinifera, Vitis amurensis, Vitis labrusca, Vitis mustangensis, Vitis riparia, Vitis rotundifolia), bean (e.g., Phaseolus vulgaris, Phaseolus lunatus, Vigna angularis, Vigna radiate, Vigna mungo, Phaseolus coccineus, Vigna umbellate, Vigna acontifolia, Phaseolus acutifolius, Vicia faba, Vicia faba equine, Phaseolus spp., Vigna spp.), soybean (e.g., soy, soya bean, Glycine max, Glycine soja), pea (e.g., Pisum spp., Pisum sativum var. sativum, Pisum sativum var. arvense), pea (e.g., Pisum spp., Pisum sativum var. sativum, Pisum sativum var. arvense), chickpea (e.g., garbanzo, Bengal gram, Cicer arietinum), cowpea (e.g., Vigna unguiculata), pigeon pea (e.g., Arhar/Toor, cajan pea, Congo bean, gandules, Caganus cajan), lentil (e.g., Lens culinaris), Bambara groundnut (e.g., earth pea, Vigna subterranea), lupin (e.g., Lupinus spp.), pulses (e.g., minor pulses, Lablab purpureaus, Canavalia ensiformis, Canavalia gladiate, Psophocarpus tetragonolobus, Mucuna pruriens var. utilis, Pachyrhizus erosus), Medicago spp. (e.g., Medicago sativa, Medicago truncatula, Medicago arborea), Lotus spp. (e.g., Lotus japonicus), forage legumes (e.g., Leucaena spp., Albizia spp., Cyamopsis spp., Sesbania spp., Stylosanthes spp., Trifolium spp., Vicia spp.), indigo (e.g., Indigofera spp., Indigofera tinctoria, Indigofera suffruticosa, Indigofera articulata, Indigofera oblongifolia, Indigofera aspalthoides, Indigofera suffruticosa, Indigofera arrecta), legume trees (e.g., locust trees, Gleditsia spp., Robinia spp., Kentucky coffeetree, Gymnocladus dioicus, Acacia spp., Laburnum spp., Wisteria spp.), or hemp (e.g., cannabis, Cannabis sativa).
[0277] Further aspects of the present disclosure relate to methods of making the genetically modified plant of any of the preceding embodiments that have a genetically modified plant including a genetically modified cell including a TM receptor complex, including introducing a genetic alteration to the plant cell including a first nucleic acid sequence encoding a heterologous first subunit polypeptide including an affinity polypeptide; and/or introducing a genetic alteration to the plant cell including a second nucleic acid sequence encoding a heterologous second subunit polypeptide optionally including a tag polypeptide. In some embodiments, the methods include introducing a genetic alteration to the plant cell comprising a nucleic acid sequence encoding an affinity polypeptide and/or introducing a genetic alteration to the plant cell comprising a nucleic acid sequence encoding a tag polypeptide such that these polypeptides are linked to the endogenous first or second subunit polypeptide in the correct location. In an additional embodiment of this aspect, the first nucleic acid sequence is operably linked to a promoter and/or wherein the second nucleic acid sequence is operably linked to a promoter. In a further embodiment of this aspect, the promoter is a root specific promoter, an inducible promoter, a constitutive promoter, or a combination thereof. In yet another embodiment of this aspect, which may be combined with any preceding embodiment that has a promoter, the promoter is a root specific promoter, and wherein the promoter is selected from the group of a NFR1 promoter, a NFR5/NFP promoter, a LYK3 promoter, a CERK6 promoter, a NFR5/NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, or an Arabidopsis pCO2 promoter. In still another embodiment of this aspect, which may be combined with any preceding embodiment that has a promoter, the promoter is a constitutive promoter, and wherein the promoter is selected from the group of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, or an Arabidopsis UBQ10 promoter. In a further embodiment of this aspect, the first nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter, and/or wherein the second nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter. In an additional embodiment of this aspect, the endogenous promoter is a root specific promoter.
[0278] Additional aspects of the present disclosure relate to methods of making the genetically modified plant of any of the preceding embodiments that have a genetically modified plant including a genetically modified cell including a TM receptor complex, including genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a first endogenous nuclear genome sequence encoding the first subunit polypeptide, wherein the first subunit polypeptide is genetically modified to include the affinity polypeptide; and/or genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a second endogenous nuclear genome sequence encoding the second subunit polypeptide, wherein the endogenous second subunit polypeptide is genetically modified to include a tag polypeptide. In another embodiment of this aspect, the one or more gene editing components include a ribonucleoprotein complex that targets the first and/or second nuclear genome sequence; a vector including a TALEN protein encoding sequence, wherein the TALEN protein targets the first and/or second nuclear genome sequence; a vector including a ZFN protein encoding sequence, wherein the ZFN protein targets the first and/or second nuclear genome sequence; an oligonucleotide donor (OND), wherein the OND targets the first and/or second nuclear genome sequence; or a vector CRISPR/Cas enzyme encoding sequence and a targeting sequence, wherein the targeting sequence targets the first and/or second nuclear genome sequence. In a further embodiment of this aspect, genetically modifying the first subunit to include the affinity polypeptide includes inserting a first nucleic acid sequence encoding a heterologous first subunit polypeptide including an affinity polypeptide into the first endogenous nuclear genome sequence; and wherein genetically modifying the second subunit to include the tag polypeptide includes inserting a second nucleic acid sequence encoding a heterologous second subunit polypeptide including a tag polypeptide into the second endogenous nuclear genome sequence.
[0279] Further aspects of the present disclosure relate to methods of making the genetically modified plant or part thereof of any one of the preceding embodiments that have a genetically modified plant including a genetically modified cell including a bispecific affinity polypeptide, including introducing a genetic alteration to the plant cell including a first nucleic acid sequence encoding a heterologous first subunit polypeptide including an affinity polypeptide; and/or introducing a genetic alteration to the plant cell including a second nucleic acid sequence encoding a heterologous second subunit polypeptide including a tag polypeptide. In a further embodiment of this aspect, the first nucleic acid sequence is operably linked to a promoter and/or wherein the second nucleic acid sequence is operably linked to a promoter. In an additional embodiment of this aspect, the promoter is a root specific promoter, a constitutive promoter, or a combination thereof. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments that has a promoter, the promoter is a root specific promoter, and wherein the promoter is selected from the group of a NFR1 promoter, a NFR5 promoter, a LYK3 promoter, a CERK6 promoter, a NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, or an Arabidopsis pCO2 promoter. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments that has a promoter, the promoter is a constitutive promoter, and wherein the promoter is selected from the group of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, or an Arabidopsis UBQ10 promoter. In another embodiment of this aspect, the first nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter, and/or wherein the second nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter. In a further embodiment of this aspect, the endogenous promoter is a root specific promoter.
[0280] Additional aspects of the present disclosure relate to methods of making the genetically modified plant or part thereof of any one of the preceding embodiments that have a genetically modified plant including a genetically modified cell including a bispecific affinity polypeptide, including genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a first nuclear genome sequence encoding an endogenous first subunit polypeptide, wherein the endogenous first subunit polypeptide is genetically modified to include an affinity polypeptide; and/or genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a second nuclear genome sequence encoding an endogenous second subunit polypeptide to include a tag polypeptide, wherein the endogenous second subunit polypeptide is genetically modified to include an affinity polypeptide. In a further embodiment of this aspect, the one or more gene editing components include a ribonucleoprotein complex that targets the first and/or second nuclear genome sequence; a vector including a TALEN protein encoding sequence, wherein the TALEN protein targets the first and/or second nuclear genome sequence; a vector including a ZFN protein encoding sequence, wherein the ZFN protein targets the first and/or second nuclear genome sequence; an oligonucleotide donor (OND), wherein the OND targets the first and/or second nuclear genome sequence; or a vector CRISPR/Cas enzyme encoding sequence and a targeting sequence, wherein the targeting sequence targets the first and/or second nuclear genome sequence.
[0281] Some aspects of the disclosure relate to a genetically modified plant or part thereof including the genetically modified plant cell of any of the preceding embodiments including a NFR1-NFR5 receptor complex. Another embodiment of this aspect further includes the NFR1-NFR5 receptor complex including the first subunit polypeptide and the second subunit polypeptide, wherein the first subunit polypeptide includes an affinity polypeptide that binds to the second subunit polypeptide inducing oligomerization; and wherein oligomerization of the first subunit polypeptide and the second subunit polypeptide activates NFR1-NFR5 receptor complex signaling. In an additional embodiment of this aspect, the affinity polypeptide binds directly to the second subunit polypeptide or wherein the second subunit polypeptide includes a tag polypeptide fused to an intracellular portion of the second subunit polypeptide, and wherein the affinity polypeptide binds to the tag polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the genetically modified plant cell is selected from a root epidermal cell, a root cortex cell, a root endodermis cell, a root pericycle cell, a root primordia cell, a xylem cell, a phloem cell, a meristem cell, a leaf cell, a stem cell, a flower cell, or a fruit cell. In a further embodiment of this aspect, the genetically modified plant cell is a root epidermal cell, a root cortex cell, a root endodermis cell, a root pericycle cell, or a root primordia cell.
[0282] Further aspects of the disclosure relate to a genetically modified plant or part thereof including the bispecific affinity polypeptide of any of the preceding embodiments including a NFR1-NFR5 receptor complex. Another embodiment of this aspect further includes the first affinity polypeptide that binds to an intracellular portion of the NFR1 polypeptide and the second affinity polypeptide that binds to the intracellular portion of the NFR5 polypeptide, wherein binding of the first affinity polypeptide to the NFR1 polypeptide and of the second affinity polypeptide to the NFR5 polypeptide induces oligomerization; and wherein oligomerization of the NFR1 polypeptide and the NFR5 polypeptide activates NFR1-NFR5 receptor complex signaling. In a further embodiment of this aspect, the first affinity polypeptide binds directly to the NFR1 polypeptide and/or wherein the second affinity polypeptide binds directly to the NFR5 polypeptide; or wherein the NFR1 polypeptide includes a tag polypeptide fused to the intracellular portion of the NFR1 polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide, and/or wherein the NFR5 polypeptide includes a tag polypeptide fused to the intracellular portion of the NFR5 polypeptide, and wherein the second affinity polypeptide binds to the tag polypeptide. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In another embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In an additional embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, the Nfr1-nfr5 receptor complex is localized to a plant cell membrane. In a further embodiment of this aspect, which may be combined with any of the preceding embodiments, the plant part is a leaf, a stem, a root, a root primordia, a flower, a seed, a fruit, a kernel, a grain, a cell, or a portion thereof. In another embodiment of this aspect, which may be combined with any of the preceding embodiments, the plant is selected from the group of cassava (e.g., manioc, yucca, Manihot esculenta), corn (e.g., maize, Zea mays), rice (e.g., indica rice, japonica rice, aromatic rice, glutinous rice, Oryza sativa, Oryza glaberrima), wild rice (e.g., Zizania spp., Porteresia spp.), barley (e.g., Hordeum vulgare), sorghum (e.g., Sorghum bicolor), millet (e.g., finger millet, fonio millet, foxtail millet, pearl millet, barnyard millets, Eleusine coracana, Panicum sumatrense, Panicum milaceum, Setaria italica, Pennisetum glaucum, Digitaria spp., Echinocloa spp.), teff (e.g., Eragrostis tef), oat (e.g., Avena sativa), triticale (e.g., X Triticosecale Wittmack, Triticosecale schlanstedtense Wittm., Triticosecale neoblaringhemii A. Camus, Triticosecale neoblaringhemii A. Camus), rye (e.g., Secale cereale, Secale cereanum), wheat (e.g., common wheat, spelt, durum, einkorn, emmer, kamut, Triticum aestivum, Triticum spelta, Triticum durum, Triticum urartu, Triticum monococcum, Triticum turanicum, Triticum spp.), Trema spp. (e.g., Trema cannabina, Trema cubense, Trema discolor, Trema domingensis, Trema integerrima, Trema lamarckiana, Trema micrantha, Trema orientalis, Trema philippinensis, Trema strigilosa, Trema tomentosa, Trema levigata), apple (e.g., Malus domestica, Malus pumila, Pyrus malus), pear (e.g., Pyrus communis, Pyrus x bretschneideri, Pyrus pyrifolia, Pyrus sinkiangensis, Pyrus pashia, Pyrus spp.), plum (e.g., Mirabelle, greengage, damson, Prunus domestica, Prunus salicina, Prunus mume), apricot (e.g., Prunus armeniaca, Prunus brigantine, Prunus mandshurica), peach (e.g., Prunus persica), almond (e.g., Prunus dulcis, Prunus amygdalus), walnut (e.g., Persian walnut, English walnut, black walnut, Juglans regia, Juglans nigra, Juglans cinerea, Juglans californica), strawberry (e.g., Fragaria x ananassa, Fragaria chiloensis, Fragaria virginiana, Fragaria vesca), raspberry (e.g., European red raspberry, black raspberry, Rubus idaeus L., Rubus occidentalis, Rubus strigosus), blackberry (e.g., evergreen blackberry, Himalayan blackberry, Rubus fruticosus, Rubus ursinus, Rubus laciniatus, Rubus argutus, Rubus armeniacus, Rubus plicatus, Rubus ulmifolius, Rubus allegheniensis, Rubus subgenus Eubatus sect. Moriferi & Ursini), red currant (e.g., white currant, Ribes rubrum), black currant (e.g., cassis, Ribes nigrum), gooseberry (e.g., Ribes uva-crispa, Ribes grossulari, Ribes hirtellum), melon (e.g., watermelon, winter melon, casabas, cantaloupe, honeydew, muskmelon, Citrullus lanatus, Benincasa hispida, Cucumis melo, Cucumis melo cantalupensis, Cucumis melo inodorus, Cucumis melo reticulatus), cucumber (e.g., slicing cucumbers, pickling cucumbers, English cucumber, Cucumis sativus), pumpkin (e.g., Cucurbita pepo, Cucurbita maxima), squash (e.g., gourd, Cucurbita argyrosperma, Cucurbita ficifolia, Cucurbita maxima, Cucurbita moschata), grape (e.g., Vitis vinifera, Vitis amurensis, Vitis labrusca, Vitis mustangensis, Vitis riparia, Vitis rotundifolia), bean (e.g., Phaseolus vulgaris, Phaseolus lunatus, Vigna angularis, Vigna radiate, Vigna mungo, Phaseolus coccineus, Vigna umbellate, Vigna acontifolia, Phaseolus acutifolius, Vicia faba, Vicia faba equine, Phaseolus spp., Vigna spp.), soybean (e.g., soy, soya bean, Glycine max, Glycine soja), pea (e.g., Pisum spp., Pisum sativum var. sativum, Pisum sativum var. arvense), pea (e.g., Pisum spp., Pisum sativum var. sativum, Pisum sativum var. arvense), chickpea (e.g., garbanzo, Bengal gram, Cicer arietinum), cowpea (e.g., Vigna unguiculata), pigeon pea (e.g., Arhar/Toor, cajan pea, Congo bean, gandules, Caganus cajan), lentil (e.g., Lens culinaris), Bambara groundnut (e.g., earth pea, Vigna subterranea), lupin (e.g., Lupinus spp.), pulses (e.g., minor pulses, Lablab purpureaus, Canavalia ensiformis, Canavalia gladiate, Psophocarpus tetragonolobus, Mucuna pruriens var. utilis, Pachyrhizus erosus), Medicago spp. (e.g., Medicago sativa, Medicago truncatula, Medicago arborea), Lotus spp. (e.g., Lotus japonicus), forage legumes (e.g., Leucaena spp., Albizia spp., Cyamopsis spp., Sesbania spp., Stylosanthes spp., Trifolium spp., Vicia spp.), indigo (e.g., Indigofera spp., Indigofera tinctoria, Indigofera suffruticosa, Indigofera articulata, Indigofera oblongifolia, Indigofera aspalthoides, Indigofera suffruticosa, Indigofera arrecta), legume trees (e.g., locust trees, Gleditsia spp., Robinia spp., Kentucky coffeetree, Gymnocladus dioicus, Acacia spp., Laburnum spp., Wisteria spp.), or hemp (e.g., cannabis, Cannabis sativa).
[0283] Additional aspects of the disclosure relate to methods of making the genetically modified plant cell of any of the preceding embodiments including a NFR1-NFR5 receptor complex, including introducing a genetic alteration to the plant cell including a first nucleic acid sequence encoding a heterologous NFR1 polypeptide including an affinity polypeptide; and/or introducing a genetic alteration to the plant cell including a second nucleic acid sequence encoding a heterologous NFR5 polypeptide optionally including a tag polypeptide. In a further embodiment of this aspect, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the first nucleic acid sequence is operably linked to a promoter and/or wherein the second nucleic acid sequence is operably linked to a promoter. In another embodiment of this aspect, the promoter is a root specific promoter, a constitutive promoter, or a combination thereof. In a further embodiment of this aspect, the promoter is a root specific promoter, and wherein the promoter is selected from the group of a NFR1 promoter, a NFR5/NFP promoter, a LYK3 promoter, a CERK6 promoter, a NFR5/NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, or an Arabidopsis pCO2 promoter. In yet another embodiment of this aspect, the promoter is a constitutive promoter, and wherein the promoter is selected from the group of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, or an Arabidopsis UBQ10 promoter. In still another embodiment of this aspect, the first nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter, and/or wherein the second nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter. In a further embodiment of this aspect, the endogenous promoter is a root specific promoter.
[0284] Further aspects of the disclosure relate to methods of making the genetically modified plant cell of any of the preceding embodiments including a NFR1-NFR5 receptor complex, including genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a first nuclear genome sequence encoding an endogenous NFR1 polypeptide, wherein the endogenous NFR1 polypeptide is genetically modified to include an affinity polypeptide; and/or genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a second nuclear genome sequence encoding an endogenous NFR5 polypeptide to include a tag polypeptide, wherein the endogenous NFR5 polypeptide is genetically modified to include a tag polypeptide. In a further embodiment of this aspect, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the one or more gene editing components include a ribonucleoprotein complex that targets the first and/or second nuclear genome sequence; a vector including a TALEN protein encoding sequence, wherein the TALEN protein targets the first and/or second nuclear genome sequence; a vector including a ZFN protein encoding sequence, wherein the ZFN protein targets the first and/or second nuclear genome sequence; an oligonucleotide donor (OND), wherein the OND targets the first and/or second nuclear genome sequence; or a vector CRISPR/Cas enzyme encoding sequence and a targeting sequence, wherein the targeting sequence targets the first and/or second nuclear genome sequence. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments, genetically modifying the endogenous NFR1 polypeptide to include the affinity polypeptide includes inserting a first nucleic acid sequence encoding a heterologous NFR1 polypeptide including an affinity polypeptide into the endogenous NFR1 nuclear genome sequence; and wherein genetically modifying the endogenous NFR5 polypeptide to include the tag polypeptide includes inserting a second nucleic acid sequence encoding a heterologous NFR5 polypeptide including a tag polypeptide into the endogenous NFR5 nuclear genome sequence.
[0285] Yet further aspects of the disclosure relate to methods of making the genetically modified plant cell of any of the preceding embodiments including a NFR1-NFR5 receptor complex, including introducing a genetic alteration to the plant cell including a first nucleic acid sequence encoding a heterologous NFR1 polypeptide including an affinity polypeptide; and/or introducing a genetic alteration to the plant cell including a second nucleic acid sequence encoding a heterologous NFR5 polypeptide optionally including a tag polypeptide. In a further embodiment of this aspect, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments, the first nucleic acid sequence is operably linked to a promoter and/or wherein the second nucleic acid sequence is operably linked to a promoter. In another embodiment of this aspect, the promoter is a root specific promoter, a constitutive promoter, or a combination thereof. In a further embodiment of this aspect, the promoter is a root specific promoter, and wherein the promoter is selected from the group of a NFR1 promoter, a NFR5/NFP promoter, a LYK3 promoter, a CERK6 promoter, a NFR5/NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, or an Arabidopsis pCO2 promoter. In yet another embodiment of this aspect, the promoter is a constitutive promoter, and wherein the promoter is selected from the group of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, or an Arabidopsis UBQ10 promoter. In still another embodiment of this aspect, the first nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter, and/or wherein the second nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter. In a further embodiment of this aspect, the endogenous promoter is a root specific promoter.
[0286] Further aspects of the present disclosure relate to methods of making the genetically modified plant of any of the preceding embodiments that have a genetically modified plant including the NFR1-NFR5 receptor complex and a bispecific affinity polypeptide, including introducing a genetic alteration to a plant cell including one or more nucleotide sequences encoding a bispecific affinity polypeptide including a first nucleic acid sequence encoding a first affinity polypeptide that binds to an intracellular portion of a NFR1 polypeptide, and a second nucleic acid sequence encoding a second affinity polypeptide that binds to an intracellular portion of a NFR5 polypeptide. In a further embodiment of this aspect, the first affinity polypeptide binds directly to the NFR1 polypeptide and/or wherein the second affinity polypeptide binds directly to the NFR5 polypeptide. In an additional embodiment of this aspect, the NFR1 polypeptide comprises a first tag polypeptide, and wherein the first affinity polypeptide binds to the first tag polypeptide, and/or wherein the NFR5 polypeptide comprises a second tag polypeptide, and wherein the second affinity polypeptide binds to the second tag polypeptide. In yet another embodiment of this aspect, the method further includes introducing a genetic alteration to a plant cell comprising a third nucleic acid sequence encoding a heterologous NFR1 polypeptide comprising a first tag polypeptide; and/or introducing a genetic alteration to the plant cell comprising a fourth nucleic acid sequence encoding a heterologous NFR5 polypeptide comprising a second tag polypeptide. In still another embodiment of this aspect, which may be combined with any preceding embodiment, the first nucleic acid, the second nucleic acid sequence, the third nucleic acid sequence, and/or the fourth nucleic acid sequence is operably linked to a promoter. In a further embodiment of this aspect, the promoter is a root specific promoter, an inducible promoter, a constitutive promoter, or a combination thereof. In an additional embodiment of this aspect, which may be combined with any preceding embodiment that has a promoter, the promoter is a root specific promoter, and wherein the promoter is selected from the group consisting of a NFR1 promoter, a NFR5 promoter, a LYK3 promoter, a CERK6 promoter, a NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, and an Arabidopsis pCO2 promoter. In yet another embodiment of this aspect, which may be combined with any preceding embodiment that has a promoter, the promoter is a constitutive promoter, and wherein the promoter is selected from the group consisting of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, and an Arabidopsis UBQ10 promoter. In still another embodiment of this aspect, the first nucleic acid sequence, the second nucleic acid sequence, the third nucleic acid sequence, and/or the fourth nucleic acid sequence is inserted into the genome of the plant so that the nucleic acid sequence is operably linked to an endogenous promoter. In a further embodiment of this aspect, the endogenous promoter is a root specific promoter.
[0287] Additional aspects of the present disclosure relate to methods of making the genetically modified plant of any of the preceding embodiments that have a genetically modified plant including the NFR1-NFR5 receptor complex and a bispecific affinity polypeptide, including genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a first endogenous nuclear genome sequence, wherein the first endogenous nuclear genome sequence is genetically modified to insert bispecific affinity polypeptide comprising a first affinity polypeptide and a second affinity polypeptide, wherein the first affinity polypeptide binds to an intracellular portion of a NFR1 polypeptide, and wherein the second affinity polypeptide binds to an intracellular portion of a NFR5 polypeptide. In a further embodiment of this aspect, the first affinity polypeptide binds directly to the NFR1 polypeptide and/or wherein the second affinity polypeptide binds directly to the NFR5 polypeptide. In an additional embodiment of this aspect, the NFR1 polypeptide comprises a first tag polypeptide, and wherein the first affinity polypeptide binds to the first tag polypeptide, and/or wherein the NFR5 polypeptide comprises a second tag polypeptide, and wherein the second affinity polypeptide binds to the second tag polypeptide. In yet another embodiment of this aspect, the method further includes genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a second endogenous nuclear genome sequence encoding the NFR1 polypeptide, wherein the NFR1 polypeptide is genetically modified to comprise the tag polypeptide; and/or genetically modifying the plant cell by transforming the plant cell with one or more gene editing components that target a third endogenous nuclear genome sequence encoding the NFR5 polypeptide, wherein the endogenous NFR5 polypeptide is genetically modified to comprise a tag polypeptide. In another embodiment of this aspect, the one or more gene editing components comprise a ribonucleoprotein complex that targets the first, second, and/or third nuclear genome sequence; a vector comprising a TALEN protein encoding sequence, wherein the TALEN protein targets the first, second, and/or third nuclear genome sequence; a vector comprising a ZFN protein encoding sequence, wherein the ZFN protein targets the first, second, and/or third nuclear genome sequence; an oligonucleotide donor (OND), wherein the OND targets the first, second, and/or third nuclear genome sequence; or a vector CRISPR/Cas enzyme encoding sequence and a targeting sequence, wherein the targeting sequence targets the first, second, and/or third nuclear genome sequence.
[0288] In some aspects, the present disclosure relates to a pollen grain or an ovule of the genetically altered plant of any of the above embodiments.
[0289] In some aspects, the present disclosure relates to a protoplast produced from the plant of any of the above embodiments.
[0290] In some aspects, the present disclosure relates to a tissue culture produced from protoplasts or cells from the plant of any of the above embodiments, wherein the cells or protoplasts are produced from a plant part selected from the group of leaf, anther, pistil, stem, petiole, root, root primordia, root tip, fruit, seed, flower, cotyledon, hypocotyl, embryo, or meristematic cell.
[0291] In certain embodiments, the plant part may be a seed, pod, fruit, leaf, flower, stem, root, any part of the foregoing or a cell thereof, or a non-regenerable part or cell of a genetically modified plant part. As used in this context, a non-regenerable part or cell of a genetically modified plant or part thereof is a part or cell that itself cannot be induced to form a whole plant or cannot be induced to form a whole plant capable of sexual and/or asexual reproduction. In certain embodiments, the non-regenerable part or cell of the plant part is a part of a transgenic seed, pod, fruit, leaf, flower, stem or root or is a cell thereof.
[0292] Processed plant products that contain a detectable amount of a nucleotide segment, expressed RNA, and/or protein comprising a genetic modification disclosed herein are also provided. Such processed products include, but are not limited to, plant biomass, oil, meal, animal feed, flour, flakes, bran, lint, hulls, and processed seed. The processed product may be non-regenerable. The plant product can comprise commodity or other products of commerce derived from a transgenic plant or transgenic plant part, where the commodity or other products can be tracked through commerce by detecting a nucleotide segment, expressed RNA, and/or protein that comprises distinguishing portions of a genetic modification disclosed herein.
[0293] A control as described herein can be a control sample or a reference sample from a wild-type, an azygous, or a null-segregant plant, species, or sample or from populations thereof. A reference value can be used in place of a control or reference sample, which was previously obtained from a wild-type, azygous, or null-segregant plant, species, or sample or from populations thereof or a group of a wild-type, azygous, or null-segregant plant, species, or sample. A control sample or a reference sample can also be a sample with a known amount of a detectable composition or a spiked sample.
Expression Vectors or Isolated DNA Molecules, Cells or Kits Including the Same, and Related Methods
[0294] A further aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding a first subunit polypeptide of a TM receptor including an affinity polypeptide, wherein the affinity polypeptide is heterologous to the first subunit polypeptide, and wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
[0295] Yet another aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding a second subunit polypeptide of a TM receptor optionally including a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
[0296] Still another aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding: (a) a first subunit polypeptide of a transmembrane (TM) receptor complex including an affinity polypeptide, wherein the affinity polypeptide is heterologous to the first subunit polypeptide; and/or (b) a second subunit polypeptide of a TM receptor optionally including a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
[0297] Still another aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding a bispecific affinity polypeptide including a first affinity polypeptide that binds to an intracellular portion of a first subunit polypeptide of a TM receptor and a second affinity polypeptide that binds to an intracellular portion of a second subunit polypeptide of a TM receptor, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence. In an additional embodiment of this aspect, the first affinity polypeptide binds directly to the first subunit polypeptide and/or wherein the second affinity polypeptide binds directly to the second subunit polypeptide. In yet another embodiment of this aspect, the first subunit polypeptide includes a tag polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide, and/or wherein the second polypeptide includes a tag polypeptide, and wherein the second affinity polypeptide binds to the tag polypeptide. In still another embodiment of this aspect, which may be combined with any preceding embodiments and aspects that have a tag polypeptide, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In yet another embodiment of this aspect, which may be combined with any preceding embodiments that have a first affinity polypeptide and a second affinity polypeptide, the first affinity polypeptide and the second affinity polypeptide are selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In still another embodiment of this aspect, the first affinity polypeptide and/or the second affinity polypeptide is a heavy-chain variable domain (VHH). In a further embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects that have an expression vector or isolated DNA molecule, the first subunit polypeptide and/or the second subunit polypeptide are selected from a LysM receptor, a Leucine rich repeat (LRR) receptor, a Malectin like receptor, a single-pass TM (SPTM) receptor, a plant TM receptor, a plant SPTM (pSPTM) receptor, a SPTM receptor including an intracellular kinase domain (SPTM-kinase), and a plant SPTM receptor including an intracellular kinase domain (pSPTM-kinase). In a further embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide is a LysM receptor. In another embodiment of this aspect, the first subunit polypeptide and/or the second subunit polypeptide lacks an ectodomain and/or a transmembrane domain. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects that have a LysM receptor, the first subunit polypeptide is a NFR1 polypeptide and the second subunit polypeptide is a NFR5 polypeptide, wherein the first subunit polypeptide is a NFR5 polypeptide and the second subunit is a NFR1 polypeptide, wherein the first subunit polypeptide is a LYK3 polypeptide and the second subunit polypeptide is a NFP polypeptide, wherein the first subunit polypeptide is a NFP polypeptide and the second subunit polypeptide is a LYK3 polypeptide, wherein the first subunit polypeptide is a RLK4 receptor polypeptide and the second subunit polypeptide is a RLK10 receptor polypeptide, or wherein the first subunit polypeptide is a RLK10 polypeptide and the second subunit polypeptide is a RLK4 polypeptide. In yet another embodiment of this aspect, the NFR1, LYK3, or RLK4 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5, NFP, or RLK10 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In an additional embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects that have an expression vector or isolated DNA molecule, the at least one expression control sequence includes a promoter selected from the group of a root specific promoter, a constitutive promoter, or a combination thereof. In a further embodiment of this aspect, the promoter is a root specific promoter, and wherein the promoter is selected from the group of a NFR1 promoter, a NFR5/NFP promoter, a LYK3 promoter, a CERK6 promoter, a NFR5/NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, or an Arabidopsis pCO2 promoter. In another embodiment of this aspect, the promoter is a constitutive promoter, and wherein the promoter is selected from the group of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, or an Arabidopsis UBQ10 promoter.
[0298] Some aspects of the present disclosure relate to a bacterial cell or an Agrobacterium cell including the expression vector or isolated DNA molecule of any one of the preceding embodiments.
[0299] Additional aspects of the present disclosure relate to a genetically modified plant, plant part, plant cell, or seed including the expression vector or isolated DNA molecule of any one of the preceding embodiments.
[0300] Further aspects of the present disclosure relate to a kit including the expression vector or isolated DNA molecule of any one of the preceding embodiments of the bacterial cell or the Agrobacterium cell of the preceding embodiments.
[0301] Still further aspects of the present disclosure relate to methods of activating a target transmembrane (TM) receptor complex or inducing organogenesis including: introducing a genetic alteration via an expression vector or isolated DNA molecule of any one of the preceding embodiments to a cell. In an additional embodiment of this aspect, activating the target TM receptor complex or inducing organogenesis is in the absence of a native, an endogenous, or exogenous stimulus (e.g., Nod). In a further embodiment of this aspect, which may be combined with any preceding embodiments, the method further includes knocking out a native target TM receptor complex or subunits thereof in the cell. In still another embodiment of this aspect, which may be combined with any preceding embodiments, the cell is a plant cell.
[0302] A further aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding a NFR1 polypeptide including an affinity polypeptide, wherein the affinity polypeptide is heterologous to the NFR1 polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
[0303] Yet another aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding a NFR5 polypeptide optionally including a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
[0304] Still another aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding: (a) a NFR1 polypeptide including an affinity polypeptide, wherein the affinity polypeptide is heterologous to the first subunit polypeptide; and/or (b) a NFR5 polypeptide optionally including a tag polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence.
[0305] An additional aspect of the present disclosure includes an expression vector or isolated DNA molecule including one or more nucleotide sequences encoding a bispecific affinity polypeptide including a first affinity polypeptide that binds to an intracellular portion of a NFR1 polypeptide and a second affinity polypeptide that binds to an intracellular portion of a NFR5 polypeptide, wherein the one or more nucleotide sequences are operably linked to at least one expression control sequence, and wherein the first affinity polypeptide is heterologous to the NFR1 polypeptide and the second affinity polypeptide is heterologous to the NFR5 polypeptide. In a further embodiment of this aspect, the first affinity polypeptide binds directly to the NFR1 polypeptide and/or wherein the second subunit polypeptide binds directly to the NFR5 polypeptide. In another embodiment of this aspect, which may be combined with any of the preceding embodiments, the NFR1 polypeptide includes a tag polypeptide, and wherein the first affinity polypeptide binds to the tag polypeptide and/or wherein the wherein the NFR5 polypeptide includes a tag polypeptide, and wherein second affinity polypeptide binds to the tag polypeptide. In a further embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects, the NFR1 polypeptide is selected from the group of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 56, and wherein the NFR5 polypeptide is selected from the group of SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, or SEQ ID NO: 57. Additional suitable LysM receptor polypeptides may include RLK1, RLK2, RLK5, RLK7, CERK6, and SYMRK. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects including an expression vector or isolated DNA molecule, the tag polypeptide is selected from a fluorescent protein polypeptide, a luminescence polypeptide, a flu hemagglutin tag polypeptide, a c-myc tag polypeptide, a Herpes Simplex virus glycoprotein D (gD) tag polypeptide, a poly-histidine tag polypeptide, a FLAG? tag polypeptide, a KT3 epitope tag polypeptide, a tubulin epitope tag polypeptide, a T7 gene 10 protein tag polypeptide, streptavidin tag polypeptide, a Vesicular Stomatis viral glycoprotein (VSV-G) epitope tag polypeptide, a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (V5) tag polypeptide, an alkaline phosphatase (AP) tag polypeptide, a bluetongue virus tag (B-tag) polypeptide, a calmodulin binding peptide (CalBP) tag polypeptide, a chloramphenicol acetyl transferase (CAT) tag polypeptide, a choline-binding domain (CholBD) tag polypeptide, a chitin binding domain (ChitBD) tag polypeptide, a cellulose binding domain (CellBP) tag polypeptide, a dihydrofolate reductase (DHFR) tag polypeptide, a galactose-binding protein (GBP) tag polypeptide, a maltose binding protein (MBP) polypeptide, a glutathione-S-transferase (GST) polypeptide, a Glu-Glu (EE) tag polypeptide, a human influenza hemagglutinin (HA) tag polypeptide, a horseradish peroxidase (HRP) tag polypeptide, a NE-tag polypeptide, a HSV tag polypeptide, a ketosteroid isomerase (KSI) tag, a LacZ tag polypeptide, a luciferase tag polypeptide, a NusA tag polypeptide, a PDZ domain tag polypeptide, a AviTag polypeptide, a SBP-tag polypeptide, a Softag 1 polypeptide, a Softag 3 polypeptide, a TC tag polypeptide, a VSV-tag polypeptide, an Xpress tag polypeptide, an Isopeptag polypeptide, a SpyTag polypeptide, a SnoopTag polypeptide, a Profinity eXact tag polypeptide, a Protein C tag polypeptide, a 51-tag polypeptide, a S-tag polypeptide, a biotin-carboxy carrier protein (BCCP) tag polypeptide, a small ubiquitin-like modifier (SUMO) tag polypeptide, a tandem affinity purification (TAP) tag polypeptide, a HaloTag polypeptide, a Nus-tag polypeptide, a Thioredoxin-tag polypeptide, a CYD tag polypeptide, a HPC tag polypeptide, a TrpE tag polypeptide, or a ubiquitin tag polypeptide. In a further embodiment of this aspect, the tag polypeptide is a fluorescent protein polypeptide selected from a green fluorescent protein (GFP) polypeptide, a red fluorescent polypeptide (RFP) (e.g., mCherry), or a blue fluorescent polypeptide (BFP); wherein the tag polypeptide is a luminescence polypeptide selected from a luciferase polypeptide; or wherein the tag polypeptide is a combination of a fluorescent protein polypeptide and a luminescence polypeptide. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments, the affinity polypeptide is selected from a heavy-chain variable domain (VHH), a single-chain variable fragment (scFV), a designed ankyrin repeat protein (DARPins), a human fibronectin III domain 3 monobody, an Affibody, or an anticalin, or a synthetic version of any of the foregoing. In another embodiment of this aspect, the affinity polypeptide is a heavy-chain variable domain (VHH). In an additional embodiment of this aspect, the affinity polypeptide is a VHH.sub.LaG16. In still another embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects including an expression vector or isolated DNA molecule, the NFR1 polypeptide and/or the NFR5 polypeptide lacks an ectodomain and/or a transmembrane domain. In yet another embodiment of this aspect, which may be combined with any of the preceding embodiments and aspects including an expression vector or isolated DNA molecule, the at least one expression control sequence includes a promoter selected from the group of a root specific promoter, a constitutive promoter, or a combination thereof. In a further embodiment of this aspect, the promoter is a root specific promoter, and wherein the promoter is selected from the group of a NFR1 promoter, a NFR5/NFP promoter, a LYK3 promoter, a CERK6 promoter, a NFR5/NFP promoter, a Lotus japonicus NFR5 promoter (SEQ ID NO: 27), a Lotus japonicus NFR1 promoter (SEQ ID NO: 69), a Lotus japonicus CERK6 promoter (SEQ ID NO: 46), a Medicago truncatula NFP promoter (SEQ ID NO: 29), a Medicago truncatula LYK3 promoter (SEQ ID NO: 28), a maize metallothionein promoter, a chitinase promoter, a maize ZRP2 promoter, a tomato LeExtl promoter, a glutamine synthetase soybean root promoter, a RCC3 promoter, a rice antiquitin promoter, a LRR receptor kinase promoter, or an Arabidopsis pCO2 promoter. In yet another embodiment of this aspect, the promoter is a constitutive promoter, and wherein the promoter is selected from the group of a CaMV35S promoter, a derivative of the CaMV35S promoter, a maize ubiquitin promoter, a polyubiquitin promoter, a vein mosaic cassava virus promoter, or an Arabidopsis UBQ10 promoter.
[0306] Some aspects of the present disclosure relate to a bacterial cell or an Agrobacterium cell including the expression vector or isolated DNA molecule of any one of the preceding embodiments.
[0307] Additional aspects of the present disclosure relate to a genetically modified plant, plant part, plant cell, or seed including the expression vector or isolated DNA molecule of any one of the preceding embodiments.
[0308] Further aspects of the present disclosure relate to a kit including the expression vector or isolated DNA molecule of any one of the preceding embodiments of the bacterial cell or the Agrobacterium cell of the preceding embodiments.
[0309] Still further aspects of the present disclosure relate to methods of activating a target NFR1-NFR5 receptor complex or inducing organogenesis including: introducing a genetic alteration via an expression vector or isolated DNA molecule of any one of the preceding embodiments to a cell. In an additional embodiment of this aspect, activating the target NFR1-NFR5 receptor complex or inducing organogenesis is in the absence of a native, an endogenous, or exogenous stimulus (e.g., Nod). In a further embodiment of this aspect, which may be combined with any preceding embodiments, the method further includes knocking out a native target NFR1-NFR5 receptor complex or subunits thereof in the cell. In still another embodiment of this aspect, which may be combined with any preceding embodiments, the cell is a plant cell.
Affinity Polypeptides
Heavy-Chain Variable Domain (VHH)
[0310] A camelid heavy-chain variable domain (VHH) (also known as Nanobody?, Ablynx), also known as a single domain antibody (sdAb), single variable domain antibody or a single monomeric variable antibody domain, recombinant variable domain of a heavy-chain-only antibody, target-binding fragment of a monoclonal antibody, a polyclonal VHH fragment antibody, a miniature engineered antibody, or a multiple antigen-binding fragment, is an antibody fragment consisting of a single monomeric variable antibody domain. Like a whole antibody, the VHH is able to bind selectively to a specific antigen. With a molecular weight of only 12-15 kDa, VHHs are much smaller than common whole antibodies (150-160 kDa). A VHH is a peptide chain of about 110 amino acids in length, comprising one variable domain (VH) of a heavy chain antibody, or of a common IgG. Unlike whole antibodies, VHHs do not show complement system triggered cytotoxicity because they lack an Fc region. Camelid- and fish-derived VHHs are able to bind to hidden antigens that are not accessible to whole antibodies, for example to the active sites of enzymes. A VHH can be obtained by immunization of sharks or camelids with the desired antigen and subsequent isolation of the mRNA coding for heavy chain antibodies. Camelids are members of the biological family Camelidae, the only living family in the suborder Tylopoda. Camels, dromedaries, Bactrian Camels, llamas, alpacas, vicunas, and guanacos are in this group. Alternatively, VHHs can be synthesized or made by screening synthetic libraries.
[0311] VHH domains, also known as VHHs, VHH domains, VHH antibody fragments, and VHH antibodies, were originally described as the antigen binding immunoglobulin (variable) domain of heavy chain antibodies (i.e., of antibodies devoid of light chains; Hamers-Casterman et al. (1993) Nature 363: 446-448). The term VHH domain was chosen to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as VH domains) and from the light chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as VL domains). For a further description of VHHs, reference is made to the review article by Muyldermans (Reviews in J. Biotechnol. 74: 277-302, 2001), as well as to the following patent applications, which are mentioned as general background art: WO 94/04678, WO 95/04079, WO 96/34103; WO 94/25591, WO 99/37681, WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301, EP 1134231 and WO 02/48193; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527; WO 03/050531; WO 01/90190; WO 03/025020; WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863, WO 04/062551, WO 05/044858, WO 06/40153, WO 06/079372, WO 06/122786, WO 06/122787 and WO 06/122825. As described in these references, VHHs (in particular VHH sequences and partially humanized VHHs) can in particular be characterized by the presence of one or more Hallmark residues in one or more of the framework sequences. A further description of the VHHs, including humanization and/or camelization of VHHs, as well as other modifications, parts or fragments, derivatives or VHH fusions, multivalent constructs (including some non-limiting examples of linker sequences) and different modifications to increase the half-life of the VHHs and their preparations can be found, e.g., in WO 08/101985 and WO 08/142164.
Protein-Protein Interaction Domains
[0312] An affinity polypeptide of the present disclosure may include any known and characterized protein-protein interaction domain. By way of example, the Protein Data Bank (PDB) includes thousands of domains that make stable dimers. One of these can be a coiled-coil domain
[0313] In addition, an AI-based pipeline may be used for developing artificial binders de novo (Watson J L, Juergens D, Bennett N R, Trippe B L, Yim J, Eisenach H E, Ahern W, Borst A J, Ragotte R J, Milles L F, Wicky B I M, Hanikel N, Pellock S J, Courbet A, Sheffler W, Wang J, Venkatesh P, Sappington I, Torres S V, Lauko A, De Bortoli V, Mathieu E, Ovchinnikov S, Barzilay R, Jaakkola T S, DiMaio F, Baek M, Baker D. De novo design of protein structure and function with RFdiffusion. Nature. 2023 August; 620(7976):1089-1100. doi: 10.1038/s41586-023-06415-8. Epub 2023 Jul. 11. PMID: 37433327; PMCID: PMC10468394).
[0314] As another example, an affinity polypeptide can be any polypeptide that enables any stable protein-protein dimerization (e.g., two proteins that bind). Protein dimerization by affinity polypeptides can be or can be derived from known dimers, known protein interactions, or proteins that bind in silico. As another example, an affinity polypeptide can covalently link two proteins.
Tag Polypeptides
[0315] As used herein, the term epitope tag or affinity tag or tag polypeptides refers to a site on or fused to a target polypeptide (for example, an antigen, such as a protein, nucleic acid, carbohydrate or lipid) to which an affinity polypeptide (for example, a VHH, antibody, antibody fragment, or scaffold protein containing antibody binding regions) binds. As used herein, the term paratope refers to the region of an affinity polypeptide (for example, a VHH, antibody, antibody fragment, or scaffold protein containing antibody binding regions) which recognizes and binds to an epitope or epitope tag. Epitopes often include a chemically active surface grouping of molecules such as amino acids, polypeptides or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics. Epitopes can be formed both from contiguous and/or juxtaposed noncontiguous residues (for example, amino acids, nucleotides, sugars, lipid moiety) of the target molecule. An epitope may include but is not limited to at least 3, at least 5 or 8-10 residues (for example, amino acids or nucleotides). An epitope may be less than 20 residues (for example, amino acids or nucleotides) in length, less than 15 residues or less than 12 residues. Two antibodies may bind the same epitope within an antigen if they exhibit competitive binding for the antigen. Unless explicitly denoted, a set of residues as an epitope does not exclude other residues from being part of the epitope for a particular antibody. Rather, the presence of such a set designates a minimal series (or set of species) of epitopes. Thus, a set of residues identified as an epitope designates a minimal epitope of relevance for the antigen, rather than an exclusive list of residues for an epitope on an antigen.
[0316] The term tagged refers to a target polypeptide fused to a tag polypeptide. The tag polypeptide has enough residues to provide an epitope against which an affinity polypeptide can be made, yet does not interfere with the activity of the polypeptide to which it is fused. The tag polypeptide is sufficiently unique so that the antibody or Nanobody? (Ablynx) there against does not substantially cross-react with other epitopes. Non-limiting examples of tag polypeptides include poly-histidine tag, poly-histidine-glycine tag, poly-arginine tag, poly-aspartate tag, poly-cysteine tag, poly-phenylalanine, c-myc tag, Herpes simplex virus glycoprotein D (gD) tag, FLAG tag, FLAG? tag, KT3 epitope tag, tubulin epitope tag, T7 gene 10 protein peptide tag, streptavidin tag, streptavidin binding peptide (SPB) tag, Strep-tag, Strep-tag II, albumin-binding protein (ABP) tag, alkaline phosphatase (AP) tag, bluetongue virus tag (B-tag), calmodulin binding peptide (CBP) tag, chloramphenicol acetyl transferase (CAT) tag, choline-binding domain (CBD) tag, chitin binding domain (CBD) tag, cellulose binding domain (CBP) tag, dihydrofolate reductase (DHFR) tag, galactose-binding protein (GBP) tag, maltose binding protein (MBP), glutathione-S-transferase (GST), Glu-Glu (EE) tag, the flu HA tag polypeptide, horseradish peroxidase (HRP) tag, NE-tag, HSV tag, ketosteroid isomerase (KSI) tag, KT3 tag, LacZ tag, luciferase tag, NusA tag, PDZ domain tag, AviTag, Calmodulin-tag, E-tag, S-tag, SBP-tag, Softag 1, Softag 3, TC tag, VSV-tag, Xpress tag, Isopeptag, SpyTag, SnoopTag, Profinity eXact tag, Protein C tag, 51-tag, S-tag, biotin-carboxy carrier protein (BCCP) tag, green fluorescent protein (GFP) tag, superfolder green fluorescent protein (sfGFP), mCherry, yellow fluorescent protein (YFP), red fluorescent protein (RFP), small ubiquitin-like modifier (SUMO) tag, tandem affinity purification (TAP) tag, HaloTag, Nus-tag, Thioredoxin-tag, Fc-tag, CYD tag, HPC tag, TrpE tag, ubiquitin tag, a VSV-G epitope tag derived from the Vesicular Stomatis viral glycoprotein, or a V5 tag derived from a small epitope (Pk) found on the P and V proteins of the paramyxovirus of simian virus 5 (SV5). Other tag polypeptides exist that are well known and routinely used in the art, and are embraced by the invention.
[0317] Existing synthetic libraries may be used to generate new tag polypeptides (McMahon C, Baier A S, Pascolutti R, Wegrecki M, Zheng S, Ong J X, Erlandson S C, Hilger D, Rasmussen S G F, Ring A M, Manglik A, Kruse A C. Yeast surface display platform for rapid discovery of conformationally selective nanobodies. Nat Struct Mol Biol. 2018 March; 25(3):289-296. doi: 10.1038/s41594-018-0028-6. Epub 2018 Feb. 12. PMID: 29434346; PMCID: PMC5839991; Binz H K, Stumpp M T, Forrer P, Amstutz P, Pluckthun A. Designing repeat proteins: well-expressed, soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins. J Mol Biol. [0318] 2003 Sep. 12; 332(2):489-503. doi: 10.1016/s0022-2836(03)00896-9. PMID: 12948497).
[0319] Those of ordinary skill in the art will recognize that the terms tag polypeptide, affinity tag, epitope tag, or affinity acceptor tag may be used interchangeably herein. As used herein, the term tag polypeptide refers to an amino acid sequence that permits the tagged polypeptide to be readily bound by an affinity polypeptide. A tag polypeptide is generally (but need not be) placed at or near the N- or C-terminus of a protein or polypeptide. In most cases, a tag polypeptide is joined to a protein or polypeptide using a genetically encoded translational fusion.
Antibody or Antigen-Binding Fragment
[0320] An affinity polypeptide or tag polypeptide can be or comprise an antibody, an antigen-binding fragment, or a functional fragment or portion thereof (e.g., a VHH, a Fab, an scFv). In some embodiments, the antibody can be a monoclonal antibody, a chimeric antibody, a multivalent antibody, or a fragment or portion thereof. In some embodiments, the affinity polypeptide can be an agonist or an antagonist. In some embodiments, the affinity polypeptide can be synthetic.
[0321] Examples of antibodies or functional fragments thereof can be a multivalent antibody, a scFv-Fc (Sokolowska-Wedzina et al., Mol. Cancer Res. 15(8): 1040-1050, 2017), a VHH domain (Li et al., Immunol. Lett. 188:89-95, 2017), a VNAR domain (Hasler et al., Mol. Immunol. 75:28-37, 2016), a (scFv)2, a minibody, TriBi minibody, a monoclonal antibody, a humanized antibody, a chimeric antibody, a human or humanized monoclonal antibody (e.g., Hunter & Jones, Nat. Immunol. 16:448-457, 2015; Heo et al., Oncotarget 7(13): 15460-15473, 2016), a DVD-Ig (Wu et al., Nat. Biotechnolf. 25(11): 1290-1297, 2007; WO 08/024188; WO 07/024715), a dual-affinity re-targeting antibody (DART) (Tsai et al., Mol. Ther. Oncolytics 3: 15024, 2016), a triomab (Chelius et al., MAbs 2(3):309-3 19, 2010), a KiH IgG with a common LC (Kontermann et al., Drug Discovery Today 20(7):838-847, 2015), a crossmab (Regula et al., EMBO Mol. Med. 9(7):985, 2017), an ortho-Fab IgG (Kontermann et al., 2015), a 2-in-1-IgG (Kontermann et al., 2015), IgG-scFv (Cheal et al., Mol. Cancer Ther. 13(7): 1803-1812, 2014), an scFv2-Fc (Natsume et al., J. Biochem. 140(3):359-368, 2006), a bi-nanobody (Kontermann et al., 2015), a tandem antibody (Kontermann et al., 2015), a DART-Fe (Kontermann et al., 2015), a Legobody, a Fab-VHH, a scFv-HSA-scFv (Kontermann, 2015), a DNL-Fab3 (Kontermann, 2015), a DAF (two-in-one or four-in-one), a bispecific antibody, a triabody (Schoonooghe et al., BMC Biotechnol. 9:70, 2009), a tetrabody, scFv-Fc knobs-into-holes, a scFv-Fc-scFv, a (FabscFv)2, a V-IgG, a IvG-V, a dual V domain IgG, a heavy chain immunoglobulin or a camelid (Holt et al., Trends Biotechnol. 21(11):484-490, 2003), a heteroconjugate antibody (e.g., U.S. Pat. No. 4,676,980), a linear antibody (Zapata et al., Protein Eng. 8 (10: 1057-1062, 1995), a trispecific antibody (Tutt et al., J. Immunol. 147:60, 1991), a Fabs-in-Tandem immunoglobulin (WO 2015/103072), a humanized camelid antibody, a DutaMab, a DT-IgG, a knobs-in-holes common LC, a knobs-in-holes assembly, a charge pair antibody, a Fab-arm exchange antibody, a SEEDbody, a Triomab, a LUZ-Y, a Fcab, kk-body, an orthogonal Fab, a DVD-IgG, an IgG(H)-scFv, a scFv-(H)IgG, an IgG(L)-scFv, a scFv-(L)-IgG, an IgG (L,H)-Fe, an IgG(H)-V, a V(H)IgG, an IgG(L)-V, a V(L)-IgG, a KIH IgG-scFab, a 2scFv-IgG, a IgG-2scFv, a scFv4-Ig, a zybody, a DVI-IgG, a nanobody (e.g., antibodies derived from Camelus bactriamus, Calelus dromaderius, Lama paccos) (U.S. Pat. No. 5,759,808; Stijlemans et al., J. Biol. Chem. 279:1256-1261, 2004; Dumoulin et al., Nature 424:783-788, 2003; Pleschberger et al., Bioconjugate Chem. 14:440-448, 2003), a nanobody-HSA, a bispecific diabody, a diabody (e.g., Poljak, Structure 2(12): 1121-1123, 1994; Hudson et al., J. Immunol. Methods 23(1-2): 177-189, 1999), a scDiabody (Cuesta et al., Trends in Biotechnol. 28(7):355-362, 2010), a scDiabody-CH3 (Sanz et al., Trends in Immunol. 25(2):85-91, 2004), a scDiabody-Fe, a diabody-Fe, a scDiabody-HSA, a Diabody-CH3, a TandAb (Reusch et al., mAbs 6(3):727-738, 2014), a Triple Body, a miniantibody, an scFv-CH3 KIH, a Fab-scFv, a scFv-CH-CL-scFv, a F(ab)2-scFV2, a scFv-KIH, a Fab-scFv-Fe, a tetravalent HCAb, a tandem scFv-Fe, an intrabody (Huston et al., Human Antibodies 10(3-4): 127-142, 2001; Wheeler et al., Mol. Ther. 8(3):355-366, 2003; Stocks, Drug Discov. Today 9(22):960-966, 2004), a dock and lock bispecific antibody, an ImmTAC, an HSAbody, a tandem scFv, an IgG-IgG, a Cov-X-Body, a scFv1-PEG-scFv2, a synthetic polypeptide (e.g., DARPins) (Binz H K, Stumpp M T, Forrer P, Amstutz P, Pluckthun A. Designing repeat proteins: well-expressed, soluble and stable proteins from combinatorial libraries of consensus ankyrin repeat proteins. J Mol Biol. 2003 Sep. 12; 332(2):489-503. doi: 10.1016/s0022-2836(03)00896-9. PMID: 12948497), a fragment thereof, a portion thereof, or combinations thereof. An affinity polypeptide can be a synthetic polypeptide. For example, there are numerous synthetic polypeptide libraries that can be used for generating synthetic polypeptides (McMahon C, Baier A S, Pascolutti R, Wegrecki M, Zheng S, Ong J X, Erlandson S C, Hilger D, Rasmussen S G F, Ring A M, Manglik A, Kruse A C. Yeast surface display platform for rapid discovery of conformationally selective nanobodies. Nat Struct Mol Biol. 2018 March; 25(3):289-296. doi: 10.1038/s41594-018-0028-6. Epub 2018 Feb. 12. PMID: 29434346).
[0322] Additional examples of an antigen-binding fragment can be an Fv fragment, a Fab fragment, a F(ab)2 fragment, or a Fab fragment. Additional examples of an antigen-binding fragment of an antibody can be an antigen-binding fragment of an IgG (e.g., an antigen-binding fragment of IgG1, IgG2, IgG3, or IgG4) (e.g., an antigen-binding fragment of a human, humanized IgG; human or humanized IgG1, IgG2, IgG3, or IgG4); an antigen-binding fragment of an IgA (e.g., an antigen-binding fragment of IgA1 or IgA2) (e.g., an antigen-binding fragment of a human or humanized IgA; a human or humanized IgA1 or IgA2); an antigen-binding fragment of an IgD (e.g., an antigen-binding fragment of a human, humanized IgD); an antigen-binding fragment of an IgE (e.g., an antigen-binding fragment of a human, humanized IgE); or an antigen-binding fragment of an IgM (e.g., an antigen-binding fragment of a human, humanized IgM). Additional examples of antibodies and antigen-binding fragments thereof are described in U.S. Pat. Nos. 8,440,196; 7,842,144; 8,034,344; and 8,529,895; US 2013/0317203; US 2014/0322239; US 2015/0166666; US 2016/0152714; and US 2017/0002082, each of which is incorporated by reference in its entirety.
Affinity
[0323] An affinity polypeptide can have affinity for a polypeptide tag, a protein, such as a kinase or pseudokinase (e.g., NFR5), an intracellular domain of a protein, or an intracellular domain transmembrane receptor. A high-affinity can be any affinity value capable of activating the cognate receptor or having receptor-activating activity, e.g., via an intracellular domain interaction, wherein the activated receptor initiates nodule organogenesis. Increased nodule organogenesis can be measured by comparing organogenesis to a control or wild type cell, species, or plant.
[0324] In some embodiments, the affinity polypeptide has a dissociation constant (KD) of less than 1?10.sup.?5 M. In some embodiments, the affinity polypeptide has a dissociation constant of less than 0.5?10.sup.?5 M, less than 1?10.sup.?6 M, less than 0.5?10.sup.?6 M, less than 1?10.sup.?7 M, less than 0.5?10.sup.?7 M, less than 1?10.sup.?8 M, less than 0.5?10.sup.?8 M, less than 1?10.sup.?9 M, less than 0.5?10.sup.?9 M, less than 1?10.sup.?10 M, less than 0.5?10.sup.?10 M, less than 1?10.sup.?11 M, less than 0.5?10.sup.?11 M, less than 1?10.sup.?12 M, less than 0.5?10.sup.?12 M, less than 1?10.sup.?13 M, less than 0.5?10.sup.?13 M, less than 1?10.sup.?14 M, less than 0.5?10.sup.?14 M, or less than 1?10.sup.?15 M. Recitation of each of these discrete values is understood to include ranges between each value. Recitation of each range is understood to include discrete values within the range. In some embodiments, the affinity polypeptide has a KD of between about 1?10.sup.?15 M and about 1?10.sup.?5 M. In some embodiments, the affinity polypeptide has a KD of about 1?10.sup.?5 M, about 0.5?10.sup.?5 M, about 1?10.sup.?6 M, about 0.5?10.sup.?6 M, about 1?10.sup.?7 M, about 0.5?10.sup.?7 M, about 1?10.sup.?8 M, about 0.5?10.sup.?8 M, about 1?10.sup.?9 M, about 0.5?10.sup.?9 M, about 1?10.sup.?10 M, about 0.5?10.sup.?10 M, about 1?10.sup.?11 M, about 0.5?10.sup.?11 M, about 1?10.sup.?12 M, about 1?10.sup.?13M, about 1?10.sup.?14 M, or about 1?10.sup.?15 M. Recitation of each of these discrete values is understood to include ranges between each value. Recitation of each range is understood to include discrete values within the range.
[0325] In some embodiments, the affinity polypeptide has a K.sub.off between about 1?10.sup.?6 s.sup.?1 to about 1?10.sup.?3 s.sup.?1. In some embodiments, the affinity polypeptide has a K.sub.off of about 1?10.sup.?3 s.sup.?1, about 0.5?10.sup.?3 s.sup.?1, about 1?10.sup.?4 s.sup.?1, about 0.5?10.sup.?4 s.sup.?1, about 1?10.sup.?5 s.sup.?1, about 0.5?10.sup.?5 s.sup.?1, or about 1?10.sup.?6 s.sup.?1. Recitation of each of these discrete values is understood to include ranges between each value. Recitation of each range is understood to include discrete values within the range.
[0326] In some embodiments, the affinity polypeptide has a K.sub.on of between about 1?10.sup.?2 M.sup.?1s.sup.?1 and about 1?10.sup.?6 M.sup.?1s.sup.?1. In some embodiments, the affinity polypeptide described herein has a K.sub.on of about 1?10.sup.?6 M.sup.?1s.sup.?1, about 0.5?10.sup.?6 M.sup.?1s.sup.?1, about 1?10.sup.?5 M.sup.?1s.sup.?1, about 0.5?10.sup.?5 M.sup.?1s.sup.?1, about 1?10.sup.?4 M.sup.?1s.sup.?1, about 0.5?10.sup.?4 M.sup.?1s.sup.?1, about 1?10.sup.?3 M.sup.?1s.sup.?1, about 0.5?10.sup.?3 M.sup.?1s.sup.?1, or 1?10.sup.?2 M.sup.?1s.sup.?1. Recitation of each of these discrete values is understood to include ranges between each value. Recitation of each range is understood to include discrete values within the range.
Transmembrane Receptor Complexes
[0327] Transmembrane receptor complexes can be synthetically activated by methods described herein. For example, it was discovered that some transmembrane receptor complexes can be activated by intracellular domain interactions between two or more intracellular domains of transmembrane proteins. These intracellular domain interactions can be initiated by exogenous or endogenous signals. As shown herein, the intracellular domain interactions can be synthetically achieved by using affinity polypeptides to mimic an interaction induced by endogenous signaling (e.g., Nod) such that in the absence of endogenous signals (e.g., Nod), the receptor is activated to induce a response (e.g., nodule organogenesis).
[0328] Examples of transmembrane receptor complexes can comprise two or more integral membrane proteins. For example an integral membrane protein can be a single-pass transmembrane (SPTM) protein, a single-pass ?-helix or a bitopic membrane protein, a polytopic transmembrane ?-helical protein or helical bundle, or a polytopic transmembrane f-sheet protein or f-barrel. Integral polytopic proteins are transmembrane proteins that span across the membrane more than once. These proteins can have different transmembrane topology. These proteins can have one of two structural architectures: helix bundle proteins, which are present in all types of biological membranes or beta barrel proteins, which can be found in outer membranes of Gram-negative bacteria, or outer membranes of mitochondria or chloroplasts. Bitopic proteins are transmembrane proteins that span across the membrane only once. Transmembrane helices from these proteins have significantly different amino acid distributions to transmembrane helices from polytopic proteins. Integral monotopic proteins are integral membrane proteins that are attached to only one side of the membrane and do not span the whole way across.
LysM Receptors and NFR1-NFR5
[0329] LysM receptors may be defined as proteins that contain an N terminal signal peptide followed by 3 tandem LysM domains. These LysM domains are flanked by conserved CXXXC or CXC motifs. They can be followed by a membrane anchor domain (LYM receptors), or by a transmembrane and an intracellular kinase domain (LysM-RLK). Most plant LysM receptors contain an intracellular kinase, while some, including NFR1 and NFR5, contain an intracellular pseudokinase.
[0330] Lohmann et al., 2010 presents in detail the characteristics of NFR1-type and NFR5-type receptors (Lohmann G V, Shimoda Y, Nielsen M W, Jergensen F G, Grossmann C, Sandal N, Serensen K, Thirup S, Madsen L H, Tabata S, Sato S, Stougaard J, Radutoiu S. Evolution and regulation of the Lotus japonicus LysM receptor gene family. Mol Plant Microbe Interact. 2010; 23(4):510-21). In short, NFR1-type receptors are translated from multi-exon genes, while NFR5-type receptors are translated from single-exon genes. NFR1-type receptors contain all the subdomains typical for an intracellular kinase, while NFR5-type receptors contain intracellular pseudokinases where subdomain I and VII/VIII are missing, or the conserved residues are substituted. NFR5-type receptors may also be referred to as NFP-type receptors or Lys11-type receptors, as each of Lotus japonicus NFR5, Medicago truncatula NFP, and Lotus japonicus Lys11 belong to this receptor type. NFR1-type receptors may also be referred to as LYK3-type receptors, as Lotus japonicus NFR1 and Medicago truncatula LYK3 both belong to this receptor type.
[0331] LysM receptors have three characteristic domains located in the ectodomain of the protein: LysM1, LysM2, and LysM3, which are present in this order on the protein sequence and separated by CxC motifs. The LysM1 domain is located toward the N-terminal end of the protein sequence, and is preceded by an N-terminal signal peptide.
[0332] An alignment of NFR1-type LysM receptors is shown in
[0333] An alignment of NFR5-type LysM receptors is shown in
[0334] As described in Examples 1 through 5, the present disclosure provides VHH-based methods to dimerize the NFR1 and NFR5 receptors. These methods showed that the NFR1-NFR5 complex is essential for organogenesis signaling, and that VHH can be used to dimerize NFR1-NFR5 without impairing downstream signaling processes.
Plant Breeding Methods
[0335] Plant breeding begins with the analysis of the current germplasm, the definition of problems and weaknesses of the current germplasm, the establishment of program goals, and the definition of specific breeding objectives. The next step is the selection of germplasm that possess the traits to meet the program goals. The selected germplasm is crossed in order to recombine the desired traits and through selection, varieties or parent lines are developed. The goal is to combine in a single variety or hybrid an improved combination of desirable traits from the parental germplasm. These important traits may include higher yield, field performance, improved fruit and agronomic quality, resistance to biological stresses, such as diseases and pests, and tolerance to environmental stresses, such as drought and heat.
[0336] Each breeding program should include a periodic, objective evaluation of the efficiency of the breeding procedure. Evaluation criteria vary depending on the goal and objectives, but should include gain from selection per year based on comparisons to an appropriate standard, overall value of the advanced breeding lines, and number of successful cultivars produced per unit of input (e.g., per year, per dollar expended, etc.). Promising advanced breeding lines are thoroughly tested and compared to appropriate standards in environments representative of the commercial target area(s) for three years at least. The best lines are candidates for new commercial cultivars; those still deficient in a few traits are used as parents to produce new populations for further selection. These processes, which lead to the final step of marketing and distribution, usually take five to ten years from the time the first cross or selection is made.
[0337] The choice of breeding or selection methods depends on the mode of plant reproduction, the heritability of the trait(s) being improved, and the type of cultivar used commercially (e.g., F.sub.1 hybrid cultivar, inbred cultivar, etc.). For highly heritable traits, a choice of superior individual plants evaluated at a single location will be effective, whereas for traits with low heritability, selection should be based on mean values obtained from replicated evaluations of families of related plants. The complexity of inheritance also influences the choice of the breeding method. Backcross breeding is used to transfer one or a few genes for a highly heritable trait into a desirable cultivar (e.g., for breeding disease-resistant cultivars), while recurrent selection techniques are used for quantitatively inherited traits controlled by numerous genes, various recurrent selection techniques are used. Commonly used selection methods include pedigree selection, modified pedigree selection, mass selection, and recurrent selection.
[0338] Pedigree selection is generally used for the improvement of self-pollinating crops or inbred lines of cross-pollinating crops. Two parents which possess favorable, complementary traits are crossed to produce an F.sub.1. An F.sub.2 population is produced by selfing one or several F.sub.1s or by intercrossing two F.sub.1s (sib mating). Selection of the best individuals is usually begun in the F.sub.2 population; then, beginning in the F.sub.3, the best individuals in the best families are selected. Replicated testing of families, or hybrid combinations involving individuals of these families, often follows in the F.sub.4 generation to improve the effectiveness of selection for traits with low heritability. At an advanced stage of inbreeding (i.e., F.sub.6 and F.sub.7), the best lines or mixtures of phenotypically similar lines are tested for potential release as new cultivars.
[0339] Mass and recurrent selections can be used to improve populations of either self- or cross-pollinating crops. A genetically variable population of heterozygous individuals is either identified or created by intercrossing several different parents. The best plants are selected based on individual superiority, outstanding progeny, or excellent combining ability. The selected plants are intercrossed to produce a new population in which further cycles of selection are continued.
[0340] Backcross breeding (i.e., recurrent selection) may be used to transfer genes for a simply inherited, highly heritable trait into a desirable homozygous cultivar or line that is the recurrent parent. The source of the trait to be transferred is called the donor parent. The resulting plant is expected to have the attributes of the recurrent parent (e.g., cultivar) and the desirable trait transferred from the donor parent. After the initial cross, individuals possessing the phenotype of the donor parent are selected and repeatedly crossed (backcrossed) to the recurrent parent. The resulting plant is expected to have the attributes of the recurrent parent (e.g., cultivar) and the desirable trait transferred from the donor parent.
[0341] The single-seed descent procedure in the strict sense refers to planting a segregating population, harvesting a sample of one seed per plant, and using the one-seed sample to plant the next generation. When the population has been advanced from the F.sub.2 to the desired level of inbreeding, the plants from which lines are derived will each trace to different F.sub.2 individuals. The number of plants in a population declines each generation due to failure of some seeds to germinate or some plants to produce at least one seed. As a result, not all of the F.sub.2 plants originally sampled in the population will be represented by a progeny when generation advance is completed.
[0342] In addition to phenotypic observations, the genotype of a plant can also be examined. There are many laboratory-based techniques available for the analysis, comparison and characterization of plant genotype; among these are Isozyme Electrophoresis, Restriction Fragment Length Polymorphisms (RFLPs), Randomly Amplified Polymorphic DNAs (RAPDs), Arbitrarily Primed Polymerase Chain Reaction (AP-PCR), DNA Amplification Fingerprinting (DAF), Sequence Characterized Amplified Regions (SCARs), Amplified Fragment Length Polymorphisms (AFLPs), Simple Sequence Repeats (SSRs, which are also referred to as Microsatellites), Fluorescently Tagged Inter-simple Sequence Repeats (ISSRs), Single Nucleotide Polymorphisms (SNPs), Genotyping by Sequencing (GbS), and Next-generation Sequencing (NGS).
[0343] Molecular markers, or markers, can also be used during the breeding process for the selection of qualitative traits. For example, markers closely linked to alleles or markers containing sequences within the actual alleles of interest can be used to select plants that contain the alleles of interest. The use of markers in the selection process is often called genetic marker enhanced selection or marker-assisted selection. Methods of performing marker analysis are generally known to those of skill in the art.
[0344] Mutation breeding may also be used to introduce new traits into plant varieties. Mutations that occur spontaneously or are artificially induced can be useful sources of variability for a plant breeder. The goal of artificial mutagenesis is to increase the rate of mutation for a desired characteristic. Mutation rates can be increased by many different means including temperature, long-term seed storage, tissue culture conditions, radiation (such as X-rays, Gamma rays, neutrons, Beta radiation, or ultraviolet radiation), chemical mutagens (such as base analogs like 5-bromo-uracil), antibiotics, alkylating agents (such as sulfur mustards, nitrogen mustards, epoxides, ethyleneamines, sulfates, sulfonates, sulfones, or lactones), azide, hydroxylamine, nitrous acid or acridines. Once a desired trait is observed through mutagenesis the trait may then be incorporated into existing germplasm by traditional breeding techniques. Details of mutation breeding can be found in Principles of Cultivar Development: Theory and Technique, Walter Fehr (1991), Agronomy Books, 1 (https://lib.dr.iastate.edu/agron_books/1).
[0345] The production of double haploids can also be used for the development of homozygous lines in a breeding program. Double haploids are produced by the doubling of a set of chromosomes from a heterozygous plant to produce a completely homozygous individual. For example, see Wan, et al., Theor. Appl. Genet., 77:889-892, 1989.
[0346] Additional non-limiting examples of breeding methods that may be used include, without limitation, those found in Principles of Plant Breeding, John Wiley and Son, pp. 115-161 (1960); Principles of Cultivar Development: Theory and Technique, Walter Fehr (1991), Agronomy Books, 1 (https://lib.dr.iastate.edu/agron_books/1), which are herewith incorporated by reference. Molecular biological methods to produce transgenic plant cells, plant parts, and plants
[0347] One aspect of the present disclosure provides transgenic plant cells, plant parts, or plants including an oligomeric single-pass transmembrane (SPTM) receptor including a first receptor subunit polypeptide and a second receptor subunit polypeptide, wherein the first receptor subunit polypeptide comprises an affinity polypeptide that binds to the second receptor subunit polypeptide intracellularly inducing oligomerization; and wherein oligomerization of the first receptor subunit polypeptide and the second receptor subunit polypeptide activates the SPTM receptor, wherein the affinity polypeptide is heterologous to the first receptor subunit polypeptide. Another aspect of the present disclosure provides transgenic plant cells, plant parts, or plants including a bispecific affinity polypeptide, including: a first affinity polypeptide that binds to an intracellular portion of a first receptor subunit polypeptide of a SPTM receptor; and a second affinity polypeptide that binds to an intracellular portion of a second receptor subunit polypeptide of the SPTM receptor; wherein binding of the first affinity polypeptide to the first receptor subunit polypeptide and of the second affinity polypeptide to the second receptor subunit polypeptide induces oligomerization; and wherein oligomerization of the first receptor subunit polypeptide and the second receptor subunit polypeptide activates the SPTM receptor. In additional embodiments of these aspects, the SPTM receptor is a NFR1-NFR5 receptor including a NFR1 polypeptide and a NFR5 polypeptide. In addition, the present disclosure provides isolated DNA molecules of vectors and gene editing components used to produce transgenic plants of the present disclosure.
[0348] In some embodiments, the TM receptor is engineered to link the first subunit polypeptide and the second subunit polypeptide (e.g., intracellularly or extracellularly) (e.g., via linker, sulfide bonding). In some embodiments, an endogenous transmembrane receptor can be knocked out for more efficient receptor subunit pairing. In some embodiments, the affinity polypeptide can comprise an enzyme-cleavable binding fragment (e.g., ubiquitin) for spatial- or location-dependent activation of the receptor.
[0349] As used in the present disclosure, the term oligomerization may mean covalently bound subunits or non-covalently bound subunits. TM receptor complexes of the present disclosure may be covalent complexes or non-covalent complexes.
[0350] A subunit of the present disclosure may be a receptor subunit polypeptide. Receptor subunit polypeptides may be transmembrane (TM) receptors. Two or more TM receptors can together form a TM receptor complex (or oligomeric receptor) that activates TM receptor signaling.
[0351] Transformation and generation of genetically altered monocotyledonous and dicotyledonous plant cells is well known in the art. See, e.g., Weising, et al., Ann. Rev. Genet. 22:421-477 (1988); U.S. Pat. No. 5,679,558; Agrobacterium Protocols, ed: Gartland, Humana Press Inc. (1995); Wang, et al. Acta Hort. 461:401-408 (1998), and Broothaerts, et al. Nature 433:629-633 (2005). The choice of method varies with the type of plant to be transformed, the particular application, and/or the desired result. The appropriate transformation technique is readily chosen by the skilled practitioner.
[0352] Any methodology known in the art to delete, insert or otherwise modify the cellular DNA (e.g., genomic DNA and organelle DNA) can be used in practicing the compositions, methods, and processes disclosed herein. As an example, the CRISPR/Cas-9 system and related systems (e.g., TALEN, ZFN, ODN, etc.) may be used to insert a heterologous gene to a targeted site in the genomic DNA or substantially edit an endogenous gene to express the heterologous gene or to modify the promoter to increase or otherwise alter expression of an endogenous gene through, for example, removal of repressor binding sites or introduction of enhancer binding sites. For example, a disarmed Ti plasmid, containing a genetic construct for deletion or insertion of a target gene, in Agrobacterium tumefaciens can be used to transform a plant cell, and thereafter, a transformed plant can be regenerated from the transformed plant cell using procedures described in the art, for example, in EP 0116718, EP 0270822, PCT publication WO 84/02913 and published European Patent application (EP) 0242246. Ti-plasmid vectors each contain the gene between the border sequences, or at least located to the left of the right border sequence, of the T-DNA of the Ti-plasmid. Of course, other types of vectors can be used to transform the plant cell, using procedures such as direct gene transfer (as described, for example in EP 0233247), pollen mediated transformation (as described, for example in EP 0270356, PCT publication WO 85/01856, and U.S. Pat. No. 4,684,611), plant RNA virus-mediated transformation (as described, for example in EP 0 067 553 and U.S. Pat. No. 4,407,956), liposome-mediated transformation (as described, for example in U.S. Pat. No. 4,536,475), and other methods such as the methods for transforming certain lines of corn (e.g., U.S. Pat. No. 6,140,553; Fromm et al., Bio/Technology (1990) 8, 833-839); Gordon-Kamm et al., The Plant Cell, (1990) 2, 603-618), rice (Shimamoto et al., Nature, (1989) 338, 274-276; Datta et al., Bio/Technology, (1990) 8, 736-740), and the method for transforming monocots generally (PCT publication WO 92/09696). For cotton transformation, the method described in PCT patent publication WO 00/71733 can be used. For soybean transformation, reference is made to methods known in the art, e.g., Hinchee et al. (Bio/Technology, (1988) 6, 915) and Christou et al. (Trends Biotech, (1990) 8, 145) or the method of WO 00/42207.
[0353] Genetically altered plants of the present disclosure can be used in a conventional plant breeding scheme to produce more genetically altered plants with the same characteristics, or to introduce the genetic alteration(s) in other varieties of the same or related plant species. Seeds, which are obtained from the altered plants, preferably contain the genetic alteration(s) as a stable insert in chromosomal DNA or as modifications to an endogenous gene or promoter. Plants including the genetic alteration(s) in accordance with this disclosure include plants including, or derived from, root stocks of plants including the genetic alteration(s) of this disclosure, e.g., fruit trees or ornamental plants. Hence, any non-transgenic grafted plant parts inserted on a transformed plant or plant part are included in this disclosure.
[0354] Genetic alterations of the disclosure, including in an expression vector or expression cassette, which result in the expression of an introduced gene or altered expression of an endogenous gene will typically utilize a plant-expressible promoter. A plant-expressible promoter as used herein refers to a promoter that ensures expression of the genetic alteration(s) of this disclosure in a plant cell. Examples of constitutive promoters that are often used in plant cells are the cauliflower mosaic (CaMV) 35S promoter (Kay et al. Science, 236, 4805, 1987), the minimal CaMV 35S promoter (Benfey & Chua, Science, (1990) 250, 959-966), various other derivatives of the CaMV 35S promoter, the figwort mosaic virus (FMV) promoter (Richins, et al., Nucleic Acids Res. (1987) 15:8451-8466) the maize ubiquitin promoter (Christensen & Quail, Transgenic Res, 5, 213-8, 1996), the polyubiquitin promoter (Ljubql, Maekawa et al. Mol Plant Microbe Interact. 21, 375-82, 2008), the vein mosaic cassava virus promoter (International Application WO 97/48819), and the Arabidopsis UBQ10 promoter, Norris et al. Plant Mol. Biol. 21, 895-906, 1993).
[0355] Additional examples of promoters directing constitutive expression in plants are known in the art and include: the strong constitutive 35S promoters (the 35S promoters) of the cauliflower mosaic virus (CaMV), e.g., of isolates CM 1841 (Gardner et al., Nucleic Acids Res, (1981) 9, 2871-2887), CabbB S (Franck et al., Cell (1980) 21, 285-294) and CabbB JI (Hull and Howell, Virology, (1987) 86, 482-493); promoters from the ubiquitin family (e.g., the maize ubiquitin promoter of Christensen et al., Plant Mol Biol, (1992) 18, 675-689), the gos2 promoter (de Pater et al., The Plant J (1992) 2, 834-844), the emu promoter (Last et al., Theor Appl Genet, (1990) 81, 581-588), actin promoters such as the promoter described by An et al. (The Plant J, (1996) 10, 107), the rice actin promoter described by Zhang et al. (The Plant Cell, (1991) 3, 1155-1165); promoters of the figwort mosaic virus (FMV) (Richins, et al., Nucleic Acids Res. (1987) 15:8451-8466), promoters of the Cassava vein mosaic virus (WO 97/48819; Verdaguer et al., Plant Mol Biol, (1998) 37, 1055-1067), the pPLEX series of promoters from Subterranean Clover Stunt Virus (WO 96/06932, particularly the S4 or S7 promoter), an alcohol dehydrogenase promoter, e.g., pAdhlS (GenBank accession numbers X04049, X00581), and the TR1 promoter and the TR2 promoter (the TR1 promoter and TR2 promoter, respectively) which drive the expression of the 1 and 2 genes, respectively, of the T DNA (Velten et al., EMBO J, (1984) 3, 2723-2730).
[0356] Alternatively, a plant-expressible promoter can be a tissue-specific promoter, i.e., a promoter directing a higher level of expression in some cells or tissues of the plant, e.g., in root epidermal cells or root cortex cells. In preferred embodiments, LysM receptor promoters will be used. Non-limiting examples include NFR1 promoters, NFR5 promoters, LYK3 promoters, NFP promoters, the Lotus japonicus NFR5 promoter (SEQ ID NO: 27), the Lotus japonicus NFR1 promoter (SEQ ID NO: 69), the Medicago truncatula NFP promoter (SEQ ID NO: 29), the Lotus japonicus CERK6 promoter (SEQ ID NO: 46), and the Medicago truncatula LYK3 promoter (SEQ ID NO: 28). In additional preferred embodiments, root specific promoters will be used. Non-limiting examples include the promoter of the maize metallothionein (De Framond et al, FEBS 290, 103-106, 1991 Application EP 452269), the chitinase promoter (Samac et al. Plant Physiol 93, 907-914, 1990), the glutamine synthetase soybean root promoter (Hirel et al. Plant Mol. Biol. 20, 207-218, 1992), the RCC3 promoter (PCT Application WO 2009/016104), the rice antiquitin promoter (PCT Application WO 2007/076115), the LRR receptor kinase promoter (PCT application WO 02/46439), the maize ZRP2 promoter (U.S. Pat. No. 5,633,363), the tomato LeExtl promoter (Bucher et al. Plant Physiol. 128, 911-923, 2002), and the Arabidopsis pCO2 promoter (Heidstra et al, Genes Dev. 18, 1964-1969, 2004). These plant promoters can be combined with enhancer elements, they can be combined with minimal promoter elements, or can comprise repeated elements to ensure the expression profile desired.
[0357] Examples of constitutive promoters that are often used in plant cells are the cauliflower mosaic (CaMV) 35S promoter (Kay et al. Science, 236, 4805, 1987), and various derivatives of the promoter, virus promoter vein mosaic cassava (International Application WO 97/48819), the maize ubiquitin promoter (Christensen & Quail, Transgenic Res, 5, 213-8, 1996), polyubiquitin (Ljubql, Maekawa et al. Mol Plant Microbe Interact. 21, 375-82, 2008) and Arabidopsis UBQ10 (Norris et al. Plant Mol. Biol. 21, 895-906, 1993).
[0358] In some embodiments, further genetic alterations to increase expression in plant cells can be utilized. For example, an intron at the 5 end or 3 end of an introduced gene, or in the coding sequence of the introduced gene, e.g., the hsp70 intron. Other such genetic elements can include, but are not limited to, promoter enhancer elements, duplicated or triplicated promoter regions, 5 leader sequences different from another transgene or different from an endogenous (plant host) gene leader sequence, 3 trailer sequences different from another transgene used in the same plant or different from an endogenous (plant host) trailer sequence.
[0359] An introduced gene of the present disclosure can be inserted in host cell DNA so that the inserted gene part is upstream (i.e., 5) of suitable 3 end transcription regulation signals (i.e., transcript formation and polyadenylation signals). This is preferably accomplished by inserting the gene in the plant cell genome (nuclear or chloroplast). Preferred polyadenylation and transcript formation signals include those of the nopaline synthase gene (Depicker et al., J. Molec Appl Gen, (1982) 1, 561-573), the octopine synthase gene (Gielen et al., EMBO J, (1984) 3:835-845), the SCSV or the Malic enzyme terminators (Schunmann et al., Plant Funct Biol, (2003) 30:453-460), and the T DNA gene 7 (Velten and Schell, Nucleic Acids Res, (1985) 13, 6981-6998), which act as 3 untranslated DNA sequences in transformed plant cells. In some embodiments, one or more of the introduced genes are stably integrated into the nuclear genome. Stable integration is present when the nucleic acid sequence remains integrated into the nuclear genome and continues to be expressed (i.e., detectable mRNA transcript or protein is produced) throughout subsequent plant generations. Stable integration into the nuclear genome can be accomplished by any known method in the art (e.g., microparticle bombardment, Agrobacterium-mediated transformation, CRISPR/Cas9, electroporation of protoplasts, microinjection, etc.).
[0360] The term recombinant or modified nucleic acids refers to polynucleotides which are made by the combination of two otherwise separated segments of sequence accomplished by the artificial manipulation of isolated segments of polynucleotides by genetic engineering techniques or by chemical synthesis. In so doing one may join together polynucleotide segments of desired functions to generate a desired combination of functions.
[0361] As used herein, the term overexpression refers to increased expression (e.g., of mRNA, polypeptides, etc.) relative to expression in a wild type organism (e.g., plant) as a result of genetic modification and can refer to expression of heterologous genes at a sufficient level to achieve the desired result such as increased yield. In some embodiments, the increase in expression is a slight increase of about 10% more than expression in wild type. In some embodiments, the increase in expression is an increase of 50% or more (e.g., 60%, 70%, 80%, 100%, etc.) relative to expression in wild type. In some embodiments, an endogenous gene is upregulated. In some embodiments, an exogenous gene is upregulated by virtue of being expressed. Upregulation of a gene in plants can be achieved through any known method in the art, including but not limited to, the use of constitutive promoters with inducible response elements added, inducible promoters, high expression promoters (e.g., PsaD promoter) with inducible response elements added, enhancers, transcriptional and/or translational regulatory sequences, codon optimization, modified transcription factors, and/or mutant or modified genes that control expression of the gene to be upregulated in response to a stimulus such as cytokinin signaling.
[0362] Where a recombinant nucleic acid is intended for expression, cloning, or replication of a particular sequence, DNA constructs prepared for introduction into a host cell will typically include a replication system (e.g., vector) recognized by the host, including the intended DNA fragment encoding a desired polypeptide, and can also include transcription and translational initiation regulatory sequences operably linked to the polypeptide-encoding segment. Additionally, such constructs can include cellular localization signals (e.g., plasma membrane localization signals). In preferred embodiments, such DNA constructs are introduced into a host cell's genomic DNA, chloroplast DNA or mitochondrial DNA.
[0363] In some embodiments, a non-integrated expression system can be used to induce expression of one or more introduced genes. Expression systems (expression vectors) can include, for example, an origin of replication or autonomously replicating sequence (ARS) and expression control sequences, a promoter, an enhancer and necessary processing information sites, such as ribosome-binding sites, RNA splice sites, polyadenylation sites, transcriptional terminator sequences, and mRNA stabilizing sequences. Signal peptides can also be included where appropriate from secreted polypeptides of the same or related species, which allow the protein to cross and/or lodge in cell membranes, cell wall, or be secreted from the cell.
[0364] Selectable markers useful in practicing the methodologies disclosed herein can be positive selectable markers. Typically, positive selection refers to the case in which a genetically altered cell can survive in the presence of a toxic substance only if the recombinant polynucleotide of interest is present within the cell. Negative selectable markers and screenable markers are also well known in the art and are contemplated by the present disclosure. One of skill in the art will recognize that any relevant markers available can be utilized in practicing the compositions, methods, and processes disclosed herein.
[0365] Screening and molecular analysis of recombinant strains of the present disclosure can be performed utilizing nucleic acid hybridization techniques. Hybridization procedures are useful for identifying polynucleotides, such as those modified using the techniques described herein, with sufficient homology to the subject regulatory sequences to be useful as taught herein. The particular hybridization techniques are not essential to this disclosure. As improvements are made in hybridization techniques, they can be readily applied by one of skill in the art. Hybridization probes can be labeled with any appropriate label known to those of skill in the art. Hybridization conditions and washing conditions, for example, temperature and salt concentration, can be altered to change the stringency of the detection threshold. See, e.g., Sambrook et al. (1989) vide infra or Ausubel et al. (1995) Current Protocols in Molecular Biology, John Wiley & Sons, NY, N.Y., for further guidance on hybridization conditions.
[0366] Additionally, screening and molecular analysis of genetically altered strains, as well as creation of desired isolated nucleic acids can be performed using Polymerase Chain Reaction (PCR). PCR is a repetitive, enzymatic, primed synthesis of a nucleic acid sequence. This procedure is well known and commonly used by those skilled in this art (see Mullis, U.S. Pat. Nos. 4,683,195, 4,683,202, and 4,800,159; Saiki et al. (1985) Science 230:1350-1354). PCR is based on the enzymatic amplification of a DNA fragment of interest that is flanked by two oligonucleotide primers that hybridize to opposite strands of the target sequence. The primers are oriented with the 3 ends pointing towards each other. Repeated cycles of heat denaturation of the template, annealing of the primers to their complementary sequences, and extension of the annealed primers with a DNA polymerase result in the amplification of the segment defined by the 5 ends of the PCR primers. Because the extension product of each primer can serve as a template for the other primer, each cycle essentially doubles the amount of DNA template produced in the previous cycle. This results in the exponential accumulation of the specific target fragment, up to several million-fold in a few hours. By using a thermostable DNA polymerase such as the Taq polymerase, which is isolated from the thermophilic bacterium Thermus aquaticus, the amplification process can be completely automated. Other enzymes which can be used are known to those skilled in the art.
[0367] Nucleic acids and proteins of the present disclosure can also encompass homologues of the specifically disclosed sequences. Homology (e.g., sequence identity) can be 50%-100%. In some instances, such homology is greater than 80%, greater than 85%, greater than 90%, or greater than 95%. The degree of homology or identity needed for any intended use of the sequence(s) is readily identified by one of skill in the art. As used herein percent sequence identity of two nucleic acids is determined using an algorithm known in the art, such as that disclosed by Karlin and Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877. Such an algorithm is incorporated into the BLASTN, BLASTP, and BLASTX, programs of Altschul et al. (1990) J. Mol. Biol. 215:402-410. BLAST nucleotide searches are performed with the BLASTN program, score=100, wordlength=12, to obtain nucleotide sequences with the desired percent sequence identity. To obtain gapped alignments for comparison purposes, Gapped BLAST is used as described in Altschul et al. (1997) Nucl. Acids. Res. 25:3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (BLASTN and BLASTX) are used. See www.ncbi.nih.gov. One of skill in the art can readily determine in a sequence of interest where a position corresponding to amino acid or nucleic acid in a reference sequence occurs by aligning the sequence of interest with the reference sequence using the suitable BLAST program with the default settings (e.g., for BLASTP: Gap opening penalty: 11, Gap extension penalty: 1, Expectation value: 10, Word size: 3, Max scores: 25, Max alignments: 15, and Matrix: blosum62; and for BLASTN: Gap opening penalty: 5, Gap extension penalty: 2, Nucleic match: 1, Nucleic mismatch ?3, Expectation value: 10, Word size: 11, Max scores: 25, and Max alignments: 15).
[0368] Preferred host cells are plant cells. Recombinant host cells, in the present context, are those which have been genetically modified to contain an isolated nucleic molecule, contain one or more deleted or otherwise non-functional genes normally present and functional in the host cell, or contain one or more genes to produce at least one recombinant protein. The nucleic acid(s) encoding the protein(s) of the present disclosure can be introduced by any means known to the art which is appropriate for the particular type of cell, including without limitation, transformation, lipofection, electroporation or any other methodology known by those skilled in the art.
[0369] Isolated, isolated DNA molecule or an equivalent term or phrase is intended to mean that the DNA molecule or other moiety is one that is present alone or in combination with other compositions, but altered from or not within its natural environment. For example, nucleic acid elements such as a coding sequence, intron sequence, untranslated leader sequence, promoter sequence, transcriptional termination sequence, and the like, that are naturally found within the DNA of the genome of an organism are not considered to be isolated so long as the element is within the genome of the organism and at the location within the genome in which it is naturally found. However, each of these elements, and subparts of these elements, would be isolated from its natural setting within the scope of this disclosure so long as the element is not within the genome of the organism in which it is naturally found, the element is altered from its natural form, or the element is not at the location within the genome in which it is naturally found. Similarly, a nucleotide sequence encoding a protein or any naturally occurring variant of that protein would be an isolated nucleotide sequence so long as the nucleotide sequence was not within the DNA of the organism from which the sequence encoding the protein is naturally found in its natural location or if that nucleotide sequence was altered from its natural form. A synthetic nucleotide sequence encoding the amino acid sequence of the naturally occurring protein would be considered to be isolated for the purposes of this disclosure. For the purposes of this disclosure, any transgenic nucleotide sequence, i.e., the nucleotide sequence of the DNA inserted into the genome of the cells of a plant, alga, fungus, or bacterium, or present in an extrachromosomal vector, would be considered to be an isolated nucleotide sequence whether it is present within the plasmid or similar structure used to transform the cells, within the genome of the plant or bacterium, or present in detectable amounts in tissues, progeny, biological samples or commodity products derived from the plant or bacterium.
[0370] Having generally described the compositions, methods, and processes of this disclosure, the same will be better understood by reference to certain specific examples, which are included herein to further illustrate the disclosure and are not intended to limit the scope of the invention as defined by the claims.
Examples
[0371] The present disclosure is described in further detail in the following examples which are not in any way intended to limit the scope of the disclosure as claimed. The attached figures are meant to be considered as integral parts of the specification and description of the disclosure. The following example is offered to illustrate, but not to limit the claimed disclosure.
Example 1: Generation of a VHH to Drive In Vivo Receptor Assembly
[0372] The following example describes the generation of a VHH and the subsequent use of the antibody as a protein tag to enable controlled assembly of two receptors in living plant cells.
Expression and Purification of the Lotus NFR5 Kinase
[0373] The NFR5 kinase (residues A276-T563) was cloned into pET-32 Ek/LIC (Merck) and fused at the N-terminal to a TEV-cleavable thioredoxin 6?-histidine tag. The plasmid was transformed into E. coli Rosetta 2 (Sigma-Aldrich, St. Louis, MO, USA). The expression culture was grown in LB containing ampicillin and chloramphenicol at 37? C., 150 RPM until OD.sub.600=0.6 and incubated on ice for 20 minutes. Expression was induced by supplementing the culture with 0.2 mM IPTG and cells were incubated at 18? C. overnight in a shaking incubator at 100 RPM. Cells were pelleted by centrifugation (5000?g, 4? C. for 15 min), resuspended in lysis buffer (50 mM Tris-HCl pH 8.0, 500 mM NaCl, 20 mM Imidazole, 5 mM ?-mercaptoethanol, 10% Glycerol, 1 mM Benzamidine), and lysed by sonication. The lysate was cleared by centrifugation (16,000?g, 4? C. for 30 minutes) and the NFR5 kinase was purified from the supernatant using a 1 mL FPLC Protino Ni-NTA column (Macherey-Nagel, D?ren, Germany). The column was equilibrated in lysis buffer and NFR5 kinase was eluted in buffer B (50 mM Tris-HCl pH 8.0, 500 mM NaCl, 500 mM Imidazole, 5 mM ?-mercaptoethanol, 5% Glycerol) after extensive washing with lysis buffer. Histidine-tagged tobacco etch virus (TEV) protease was added to the NFR5 kinase sample in a 1:50 molar ratio and the digestion mixture was dialysed overnight at 4? C. against SEC buffer (50 mM Tris-HCl pH 8.0, 500 mM NaCl, 5 mM ?-mercaptoethanol). The TEV protease and digested thioredoxin-6? histidine tag was removed through a second nickel affinity chromatography purification step. The NFR5 kinase was purified in a final SEC step on a HiLoad? Superdex? 75 16/600 pg (Cytiva, Marlborough, MA, USA) in SEC buffer. All purification steps were analyzed by SDS-PAGE and elution fractions pooled accordingly.
Generation of a NFR5 VHH
[0374] One Lama glama was immunized with 400 ?g NFR5 kinase by Capralogics (Hardwick, USA). From a blood sample after 6-8 weeks, peripheral lymphocytes were isolated by Ficoll gradient centrifugation. Total RNA was purified using an RNeasy? Plus Mini Kit (Qiagen, Valencia, CA, USA) and cDNA was generated and amplified using a SuperScript TM III First-Strand Kit (Invitrogen) and random hexamer primers. The VHH/Nb regions were amplified by PCR and cloned into a phagemid pD-GFP vector as an E-tag pIII-fusion. E. coli ER2738 were transformed with VHH inserted phagemid and M13 phage-display libraries were produced using VCSM13 helper phages. A 96-well Nunc? Maxisorp? Immuno-Microplate (Thermo Fisher Scientific, Waltham, MA, USA) was coated with 1 ?g/well NFR5 kinase overnight at 4? C. and blocked by addition of PBS, 2% w/v BSA for 1 hour at room temperature. 3?10.sup.12 phages per selection were blocked in PBS, 2% w/v BSA for 1 hour before applying to antigen-coated wells for an additional 1 hour. Wells were washed 15 times in PBS supplemented with 0.1% Tween 20 (PBS-T) followed by 15 washes in PBS. Phages were eluted by addition of 100 ?L 0.2 M glycine pH 2.2 and incubated on a shaking table for 10 minutes. Elutions were pH adjusted by addition of 15 ?L 1 M Tris-HCl pH 9.1 and used for infecting 0.8 mL ER2738, OD.sub.600=0.6. The phage-library was amplified for a second round of selection, using a more stringent 0.1 ?g antigen-coating. After the second selection round, infected ER2738 were plated on Luria Agar, supplemented with 2% w/v glucose, 100 ?g/mL ampicillin, and 10 ?g/mL tetracycline and grown overnight at 37? C. Single colonies were picked and inoculated into a 96-well micro-titre plate filled with LB supplemented with 100 ?g/mL ampicilin and 10 ?g/mL tetracycline. The plate was covered with an AirPore sheet (Qiagen) and incubated for 6 hours at 37? C., 95 RPM at high humidity. E-tagged VHHs were expressed overnight at 30? C., 95 RPM by supplementing with 0.8 mM IPTG.
[0375] E. coli were pelleted at 1000?g, 4? C. for 15 minutes and the supernatant containing E-tagged VHHs were used to screen NFR5 kinase binding in an enzyme-linked immunosorbent assay (ELISA).
[0376] A 0.1 ?g/well NFR5 kinase coated 96-well Nunc? plate was generated as described above and 50 ?L VHH supernatant was incubated in the ELISA plate for 1 hour at room temperature followed by 6?PBS-T wash. Secondary anti-E-tag HRP antibody (Bethyl laboratories, Montgomery, Texas, USA) was diluted 10000-fold in PBS, 2% w/v BSA and 100 ?L was added to each ELISA well and incubated for 1 hour at room temperature. Wells were washed 3? in PBS-T and developed by addition of 100 ?L TMB (Thermo Scientific?). Reactions were quenched with 100 ?L 1 M HCl and ELISA plates were read at 450 nm using a Varioskan? LUX Multimode Microplate Reader (Thermo Scientific?).
[0377] Positive clones were propagated in 5 mL LB supplemented with 100 ?g/mL ampicillin and phagemid DNA was purified and sequenced. Nb.sub.NFR5 (VHH towards NFR5; SEQ ID NO: 2) was cloned into pET-22b(+) and fused at the C terminal to a non-cleavable 6?-histidine tag. Expression and purification were performed similarly as described for the NFR5 kinase. E. coli LOBSTR (Kerafast, Boston, MA, USA) (Andersen et al. (2013) Proteins 81, 1857-1861) was used as the expression strain, a single nickel affinity chromatography step was performed, and SEC was performed using a Superdex? 75 increase 10/300 GL column (Cytiva).
[0378] Analytical SEC was used to assay NFR5 kinase:Nb.sub.NFR5 complex formation. 100 ?g NFR5 kinase was mixed in a 1:1.5 molar ratio with Nb.sub.NFR5 and incubated on ice for 30 minutes. Assays were performed using a Superdex? 200 increase 10/300 (Cytiva) in SEC buffer. Chromatograms were processed in Unicorn 6 (Cytiva) and analysed in GraphPad Prism 9 (GraphPad Software, San Diego, CA, USA).
Generation of Plant Expression Vectors
[0379] For generation of the plant expression vector, the sequence of Nb.sub.NFR5 (SEQ ID NO: 2) was added in-frame as a C-terminal tag to the native NFR1 promoter and sequence into the pIV10_tYFP-NLS expression vector via Golden Gate cloning (Weber et al. (2011) PLoS One 6, e16765), where YFP fused to a nuclear localization signal (NLS) serves as a transformation control. Agrobacterium rhizogenes strain AR1193 was grown in LB medium at 28? C. and transformed with pIV10 vectors via conjugation. A construct overview is given in Table 1.
TABLE-US-00001 TABLE 1 Construct overview Standard Back Short ID name bone Combined modules For hairy root transformations: NFR1_ EC31220 EC31220_ EC25164_ PMC- EC31213_ EC25031_ EC31217_ EC49283 NFR5 pL2V_pIV10- pL2V-1 02596_ pL1R2- pL1V-F3- pL1F4- (ELB-4) R1-pLjUbi- pIV10 pL1R1- pLjNFR1- buffer pLjNFR5- tYFPnls- pLjUbi- gLjNFR1- LjNFR5- tNOS-R2- tYFPnls- 6xHis- 3xHA- pLjNFR1- tNOS tLjNFR1 tLjNFR5 gLjNFR1- 6xHis- tLjNFR1- F3- PUSCT- buffer-F4- pLjNFR5- LjNFR5- 3xHA- tLjNFR5- ELE-4 NFR1- EC31959 EC31959_ EC25164_ PMC- EC31468_ EC31914_ EC49283 NB.sub.NFR5 pL2V_ pL2V-1 02596_ pL1V_ pL1V-F4_ (ELB-4) pIV10- pIV10 pL1R1- pUC57G_ pNFR1_ R1_pLjUbi_ pLjUbi- F2 + 3 gNFR1_ tYFPnls_ tYFPnls- Buffer_ 20linker _ tNOS- tNOS GCAA_ KRA198- F4_pNFR1_ TTAC HA_tNFR1 gNFR1_20 linker_NB NFR5-HA- tNFR1_ ELB4 NFR1Nb_ EC31687 EC31687_ EC25164_ PMC- PMC- EC25031 EC31917_ EC49283 NFR5 pL2V_pIV10- pL2V-1 02596_ 03558_ pL1M- pL2V_ (ELB-4) sfGFP R1_pLjUbi_ pIV10 pL1R1- L1V-F2_ F3- pIV10- tYFPnls_ pLjUbi- PU- Buffer- R1_pLjUbi_ tNOS- tYFPnls- pLjNfr5- 25031 tYFPnls F2_pNFR5_ tNOS SC3- tNOS- NFR5_ LjNfr5_ F4_pNFR1_ sfGFP_ C4_ gNFR1_ tNFR5_ sfGFP_ 20linker_ F4_pNFR1_ T-LjNfr5 NbsfGFP- gNFR1_ HA_tNFR1- 20linker_ ELB4 NbsfGFP- HA_tNFR1_ ELB4 NFR1 EC31672 EC31672_ EC25164_ PMC- PMC- EC25031 EC31918_ EC49283 NbNb_ pL2V_ pL2V-1 02596_ 03558_ pL1M-F3- pL2V_ (ELB-4) NFR5 pIV10- pIV10 pL1R1- L1V-F2_ Buffer- pIV10- sfGFP R1_pLjUbi_ pLjUbi- PU- 25031 R1_pLjUbi_ tYFPnls_ tYFPnls- pLjNfr5- tYFPnls_ tNOS- tNOS SC3- tNOS- F2_pNFR5_ LjNfr5_ F4_pNFR1_ NFR5_ C4_ gNFR1_ sfGFP_tNFR5_ sfG 20linker_ F4_pNFR1_ FP_ NbsfGFP_ gNFR1_ T- 40linker_ 20linker_ LjNfr5 NbsfGFP- NbsfGFP- HA_tNFR1- 40linker- ELB4 NbsfGFP- HA_tNFR1_ ELB4 NFR1 EC31750 EC31750_ EC25164_ PMC- EC31650_ EC31073_ EC31655_ EC49283 NbNb_ pL2V_ pL2V-1 02596_ L1V-F2_ pL1V- L1V- (ELB-4) NFR5sfGFP pIV10_R1- pIV10 pL1R1- pLjNfr1_ R3_spacer1 F4_pNFR5- pLjUbi- pLjUbi- gLjNfr1- LjNFR5- tYFPnls- tYFPnls- 20aa- sfGFP_T- tNOS_F2- tNOS NbGFP- LjNFR5 pLjNfr1_ 40aa- gLjNfr1- NbGFP- 20aa- HA NbGFP- 40aa- NbGFP- HA_F3- spacer_F4- pNFR5- LjNFR5- sfGFP_T- LjNFR5_ ELB4 NFR1 EC31989 EC31989_ EC25164_ PMC- PMC- EC25031 EC31984_ EC49283 mutNb_ pL2V_pIV10- pL2V-1 02596_ 03558 pL1M- pL1V-F4_ (ELB-4) NFR5sfGFP R1_pLjUbi_ pIV10 pL1R1- PU- F3- pNFR1_ tYFPnls_ pLjUbi- pLjNfr5- Buffer- gNFR1_ tNOS- tYFPnls- SC3- 25031 20linker_ F2_pNFR5_ tNOS LjNfr5_ mutNbsfGFP- NFR5_ C4_ HA_tNFR1 sfGFP_ sfGFP_ tNFR5_ T-LjNfr5- F4_pNFR1_ L1-V F2 gNFR1_ 20linker_ mutNbsfGFP- HA_ tNFR1_ELB4 NFR1mut EC31996 EC31996_ EC25164_ PMC- PMC- EC25031 EC31985_ EC49283 NbmutNb_ pL2V_pIV10- pL2V-1 02596_ 03558 pL1M- pL1V- (ELB-4) NFR5sfGFP R1_pLjUbi_ pIV10 pL1R1- PU- F3- F4_pNFR1_ tYFPnls_ pLjUbi- pLjNfr5- Buffer- gNFR1_ tNOS- tYFPnls- SC3- 25031 20linker_ F2_pNFR5_ tNOS LjNfr5_ mutNbsfGFP- NFR5_sfGFP_ C4_ 40linker- tNFR5_F4_ sfGFP_ NbsfGFP- pNFR1_ T-LjNfr5- HA_tNFR1 gNFR1_ L1-V F2 20linker_ mutNbsfGFP- 40linker- mutNbsfGFP- HA_tNFR1_ ELB4 NFR1 EC31722 EC31722_ EC25164_ PMC- EC31072 EC31693_ EC31638_ EC49283 sfGFP_ pL2V_pIV10- pL2V-1 02596_ L1_V_ pL1V-R3_ pL1V- (ELB-4) NFR5Nb R1_pLjUbi_ pIV10 pL1R1- F2_ pNFR1_ F4_pNFR5_ tYFPnls_ pLjUbi- Buffer gNFR1_ NFR5_ tNOS- tYFPnls- sfGFP_ 20linker_ R3_pNFR1_ tNOS tNFR1 NbsfGFP- gNFR1_ HA_tNFR5 sfGFP_ tNFR1- F4_pNFR5_ NFR5_ 20linker_ NbsfGFP- HA_tNFR5- ELB4 NFR1 EC31724 EC31724_ EC25164_ PMC- EC31072 EC31693_ EC31640_ EC49283 sfGFP_ pL2V_pIV10- pL2V-1 02596_ L1_V_ pL1V-R3_ pL1V- (ELB-4) NFR5 R1_pLjUbi_ pIV10 pL1R1- F2_Buffer pNFR1_ F4_pNFR5_ NbNb tYFPnls_ pLjUbi- gNFR1_ NFR5_ tNOS- tYFPnls- sfGFP_ 20linker_ R3_pNFR1_ tNOS tNFR1 NbsfGFP- gNFR1_ 40linker- sfGFP_ NbsfGFP- tNFR1- HA_tNFR5 F4_pNFR5_ NFR5_ 20linker_ NbsfGFP- 40linker- NbsfGFP- HA_tNFR5- ELB4 NFR1_ EC55305 EC55305_ EC25164_ PMC- EC31213_ EC25031_ EC31074- EC31691_ EC49299 SYMRK pL2V_pIV10- pL2V-1 02596_ pL1R2- pL1V-F3- L1_V_ pL1V- (ELB-5) R1_pLjUbi_ pIV10 pL1R1- pLjNFR1- buffer F4_ R5_ tYFPnls_ pLjUbi- gLjNFR1- spacer1 pSymRK_ tNOS- tYFPnls- 6xHis- LjSymRK_ R2_pNFR1_ tNOS tLjNFR1 sfGFP_ gNFR1_ tSymRK 6xHis_ tNFR1- R5_pSYMRK_ SYRMK_ HAtag_ tSYMRK_ ELB5 NFR1Nb_ EC55303 EC55303_ EC25164_ PMC- EC31468_ EC31642_ EC31691_ EC49299 SYMRK pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1V-F4_ pL1V- (ELB-5) sfGFP R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pNFR1_ R5_ tYFPnls_ pLjUbi- F2 + 3 gNFR1_ pSymRK_ tNOS- tYFPnls- Buffer_ 20linker_ LjSymRK_ F4_pNFR1_ tNOS GCAA_ NbsfGFP- sfGFP_ gNFR1_ TTAC HA_tNFR1 tSymRK 20linker_ NbsfGFP- HA_tNFR1- R5_pSYMRK_ SYMRK_ sfGFP_ tSYMRK- ELB5 NFR5_ EC31748 EC31748_ EC25164_ PMC- EC31468_ EC31217_ EC31841_ EC49299 SYMRK pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1F4- pL2V_ (ELB-5) R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pLjNFR5- pIV10- tYFPnls_ pLjUbi- F2 + 3 LjNFR5- R1_pLjUbi_ tNOS- tYFPnls- Buffer_ 3xHA- tYFPnls_ F4_pNFR5_ tNOS GCAA_ tLjNFR5 tNOS-R5_ NFR5_3xHA_ TTAC pSYMRK_ tNFR5- SYRMK_ R5_pSYMRK_ HAtag_ SYRMK_ tSYMRK_ HAtag_ ELB5 tSYMRK_ ELB5 NFR5Nb_ EC31726 EC31726_ EC25164_ PMC- EC31468_ EC31638_ EC31691_ EC49299 SYMRK pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1V-F4_ pL1V-R5_ (ELB-5) sfGFP R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pNFR5_ pSymRK_ tYFPnls_ pLjUbi- F2 + 3 NFR5_ LjSymRK_ tNOS- tYFPnls- Buffer_ 20linker_ sfGFP_ F4_pNFR5_ tNOS GCAA_ NbsfGFP- tSymRK NFR5_ TTAC HA_ 20linker_ tNFR5 NbsfGFP- HA_tNFR5- R5_pSYMRK_ SYMRK_ sfGFP_ tSYMRK- ELB5 ?LysM- EC31944 EC31944_ EC25164_ PMC- PMC- EC25031 EC31908_ EC49283 NFR1Nb_ pL2V_pIV10- pL2V-1 02596_ 03558 pL1M-F3- pL1V- (ELB-4) NFR5sfGFP R1_pLjUbi_ pIV10 pL1R1- PU- Buffer- F4_pNFR1_ tYFPnls_ pLjUbi- pLjNfr5- 25031 ?LysM- tNOS- tYFPnls- SC3- gNFR1_ F2_pNFR5_ tNOS LjNfr5_ 20linker_ NFR5_ C4_ NbsfGFP- sfGFP_ sfGFP_ HA_tNFR1 tNFR5_ T-LjNfr5- F4_pNFR1_ L1-V ?LysM- F2 gNFR1_ 20linker_ NbsfGFP- HA_tNFR1_ ELB4 NFR1Nb_ EC31922 EC31922_ EC25164_ PMC- EC31663_ EC25031 EC31642_ EC49283 ?LysM- pL2V_pIV10- pL2V-1 02596_ pL1-F2_ pL1M-F3- pL1V- (ELB-4) NFR5sfGFP R1_pLjUbi_ pIV10 pL1R1- pNFR5_ Buffer- F4_pNFR1_ tYFPnls_ pLjUbi- ?LySM- 25031 gNFR1_ tNOS- tYFPnls- NFR5_ 20linker_ F2_pNFR5_ tNOS sfGFP_ NbsfGFP- ?LysM- tNFR5 HA_tNFR1 NFR5_sfGFP_ tNFR5-F4_ pNFR1_ gNFR1_ 20linker_ NbsfGFP- HA_tNFR1- ELB4 ?LysM- EC31963 EC31963_ EC25164_ PMC- EC31663_ EC25031 EC31908_ EC49283 NFR1Nb_ pL2V_pIV10- pL2V-1 02596_ pL1-F2_ pL1M-F3- pL1V-F4_ (ELB-4) ?LysM- R1_pLjUbi_ pIV10 pL1R1- pNFR5_ Buffer- pNFR1_ NFR5sfGFP tYFPnls_ pLjUbi- ?LySM- 25031 ?LysM- tNOS- tYFPnls- NFR5_ gNFR1_ F2_pNFR5_ tNOS sfGFP_ 20linker_ ?LysM- tNFR5 NbsfGFP- NFR5_sfGFP_ HA_tNFR1 tNFR5 F4_pNFR1_ ?LysM- gNFR1_ 20linker_ NbsfGFP- HA_tNFR1_ ELB4 NFR1 EC31961 EC31961_ EC25164_ PMC- PMC- EC25031 EC31942_ AE45 T483ANb_ pL2V_pIV10- pL2V-1 02596_ 03558_ pL1M-F3- pL1V-F4_ (ELB-4) NFR5sfGFP R1_pLjUbi_ pIV10 pL1R1- L1V-F2 Buffer- pNFR1_ tYFPnls_ pLjUbi- PU- 25031 gNFR1- tNOS- tYFPnls- pLjNfr5- kd- F2_pNFR5_ tNOS SC3- T483A_ NFR5_ LjNfr5_ 20linker_ sfGFP_ C4_ NbsfGFP- tNFR5_ sfGFP_ HA_tNFR1 F4_pNFR1_ T- gNFR1-kd- LjNfr5 T483A_ 20linker_Nbsf GFP- HA_tNFR1_ ELB4 NFR5sfGFP EC31916 EC31916_ EC25164_ PMC- PMC- EC49266 pL2V_pIV10- pL2V-1 02596_ 03558 (ELB-2) R1_pLjUbi_ pIV10 pL1R1- PU- tYFPnls_ pLjUbi- pLjNfr5- tNOS- tYFPnls- SC3- F2_pNFR5_ tNOS LjNfr5_ NFR5_ C4_ sfGFP_tNFR5- sfGFP_ ELB2 T- LjNfr5- L1-V F2 NFR1Nb EC31917 EC31917_ EC25164_ PMC- EC31468_ EC31642_ EC49283 pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1V-F4_ (ELB-4) R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pNFR1_ tYFPnls_ pLjUbi- F2 + 3 gNFR1_ tNOS- tYFPnls- Buffer_ 20linker_ F4_pNFR1_ tNOS GCAA_ NbsfGFP- gNFR1_ TTAC HA_ 20linker_ tNFR1 NbsfGFP- HA_tNFR1- ELB4 NFR1NbNb EC31918 EC31918_ EC25164_ PMC- EC31468_ EC31644_ EC49283 pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1V-F4_ (ELB-4) R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pNFR1_ tYFPnls_ pLjUbi- F2 + 3 gNFR1_ tNOS- tYFPnls- Buffer_ 20linker_ F4_pNFR1_ tNOS GCAA_ NbsfGFP- gNFR1_ TTAC 40linker- 20linker_ NbsfGFP- NbsfGFP_ HA_tNFR1 40linker_ NbsfGFP- HA_tNFR1- ELB4 NFR1sfGFP EC31919 EC31919_ EC25164_ PMC- EC31072 EC31693_ EC49277 pL2V_pIV10- pL2V-1 02596_ L1V_F2_ pL1V-R3_ (ELB3) R1_pLjUbi_ pIV10 pL1R1- Buffer pNFR1_ tYFPnls_ pLjUbi- gNFR1_ tNOS- tYFPnls- sfGFP_ R3_pNFR1_ tNOS tNFR1 gNFR1_ sfGFP_tNFR1_ ELB3 NFR5Nb EC31920 EC31920_ EC25164_ PMC- EC31468_ EC31638_ EC49283 pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1V-F4_ (ELB-4) R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pNFR5_ tYFPnls_ pLjUbi- F2 + 3 NFR5_ tNOS- tYFPnls- Buffer_ 20linker_ F4_pNFR5_ tNOS GCAA_ NbsfGFP- NFR5_ TTAC HA_tNFR5 20linker_ NbsfGFP- HA_tNFR5- ELB4 NFR5Nb EC31921 EC31921_ EC25164_ PMC- EC31468_ EC31640_ EC49283 pL2V_pIV10- pL2V-1 02596_ pL1V_ pL1V-F4_ (ELB-4) R1_pLjUbi_ pIV10 pL1R1- pUC57G_ pNFR5_ tYFPnls_ pLjUbi- F2 + 3 NFR5_ tNOS- tYFPnls- Buffer_ 20linker_ F4_pNFR5_ tNOS GCAA_ NbsfGFP- NFR5_ TTAC 40linker- 20linker_ NbsfGFP- NbsfGFP_ HA_tNFR5 40linker_ NbsfGFP- HA_tNFR5- ELB4 NFP_ EC55059 EC55059_ EC25164_ PMC- EC31972_ EC31073_ EC31968_ EC49283 LYK3Nb L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) pIV10_R1_ pIV10 pL1R1- pMtNFP_ spacer1 pMLYK3_ pLjUbi- pLjUbi- MtNFP- MtLyk3- tYFPnls- tYFPnls- 6xhis_ 20aa- tNOS_F2_ tNOS tNFP NbGFP_ pMtNFP_ t35S MtNFP- 6xhis_tNFP_ R3_spacer_ F4_pMLYK3_ MtLyk3-20aa- NbGFP_ t35S_ELB4 NFP_ EC55060 EC55060_ EC25164_ PMC- EC31972_ EC31073_ EC31969_ EC49283 LYK3NbNb L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) pIV10_R1_ pIV10 pL1R1- pMtNFP_ spacer1 pMLYK3_ pLjUbi- pLjUbi- MtNFP- MtLyk3- tYFPnls- tYFPnls- 6xhis_ 20aa- tNOS_F2_ tNOS tNFP NbGFP- pMtNFP_ 40aa- MtNFP- NbGFP- 6xhis_tNFP_ HA_t35S R3_spacer_ F4_pMLYK3_ MtLyk3- 20aa-NbGFP- 40aa- NbGFP- HA_t35S_ ELB4 NFPsfGFP_ EC55051 EC55051_ EC25164_ PMC- EC31971_ EC31073_ EC31968_ EC49283 LYK3Nb L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) pIV10_R1_ pIV10 pL1R1- pMtNFP_ spacer1 pMLYK3_ pLjUbi- pLjUbi- MtNFP- MtLyk3- tYFPnls- tYFPnls- sfGFP_ 20aa- tNOS_F2_ tNOS tNFP NbGFP_t35S pMtNFP_ MtNFP- sfGFP_tNFP_ R3_spacer_ F4_pMLYK3_ MtLyk3- 20aa- NbGFP_ t35S_ELB4 NFP EC55056 EC55056_ EC25164_ PMC- EC31971_ EC31073_ EC31969_ EC49283 sfGFP_ L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) LYK3 pIV10_R1_ pIV10 pL1R1- pMtNFP_ spacer1 pMLYK3_ NbNb pLjUbi- pLjUbi- MtNFP- MtLyk3- tYFPnls- tYFPnls- sfGFP_ 20aa- tNOS_F2_ tNOS tNFP NbGFP- pMtNFP_ 40aa- MtNFP- NbGFP- sfGFP_tNFP_ HA_t35S R3_spacer_ F4_pMLYK3_ MtLyk3- 20aa- NbGFP- 40aa- NbGFP- HA_t35S_ ELB4 NFP EC55057 EC55057_ EC25164_ PMC- EC31971_ EC31073_ EC32021_ EC49283 sfGFP_ L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) LYK3 pIV10_R1_ pIV10 pL1R1- pMtNFP_ spacer1 pMLYK3_ mutNb pLjUbi- pLjUbi- MtNFP- MtLyk3- tYFPnls- tYFPnls- sfGFP_ 20aa- tNOS_F2_ tNOS tNFP mutNbGFP_ pMtNFP_ t35S MtNFP- sfGFP_tNFP_ R3_spacer_ F4_pMLYK3_ MtLyk3- 20aa- mutNbGFP_ t35S_ELB4 NFP EC55058 EC55058_ EC25164_ PMC- EC31971_ EC31073_ EC32022_ EC49283 sfGFP_ L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) LYK3 pIV10_R1_ pIV10 pL1R1- pMtNFP_ spacer1 pMLYK3_ mutNb pLjUbi- pLjUbi- MtNFP- MtLyk3- mutNb tYFPnls- tYFPnls- sfGFP_ 20aa- tNOS_F2_ tNOS tNFP mutNbGFP- pMtNFP_ 40aa- MtNFP- mutNbGFP- sfGFP_tNFP_ HA_t35S R3_spacer_ F4_pMLYK3_ MtLyk3- 20aa- mutNbGFP- 40aa- mutNbGFP- HA_t35S_ ELB4 NFR5 EC31730 EC31730_ EC25164_ PMC- PMC- EC31073_ EC31652_ EC49283 sfGFP_ pL2V_pIV10_ pL2V-1 02596_ 03558_ pL1V-R3_ L1V-F4_ (ELB-4) RLK4 R1-pLjUbi- pIV10 pL1R1- L1V-F2_ spacer1 pLjNfr1_ NbNb tYFPnls- pLjUbi- PU- HvRLK4cds- tNOS_F2- tYFPnls- pLjNfr5- 20aa- pNFR5- tNOS SC3- NbGFP- LjNFR5- LjNfr5_ 40aa- sfGFP_T- C4_ NbGFP-HA LjNFR5_F3- sfGFP_ spacer_F4- T- pLjNfr1_ LjNfr5 HVRLK4cds- 20aa- NbGFP- 40aa- NbGFP- HA_ELB4 NFR1 EC31792 EC31792_ EC25164_ PMC- EC31650_ EC31073_ EC31658_ EC49283 NbNb_ pL2V_pIV10_ pL2V-1 02596_ L1V-F2 pL1V-R3_ L1V-F4_ (ELB-4) RLK10 R1- pIV10 pL1R1- pLjNfr1_ spacer1 pNFR5- sfGFP pLjUbi- pLjUbi- gLjNfr1- LjNFR5- tYFPnls- tYFPnls- 20aa- HvRLK10cds_ tNOS_F2- tNOS NbGFP- T-LjNFR5 pLjNfr1_ 40aa- gLjNfr1- NbGFP- 20aa- HA NbGFP- 40aa- NbGFP- HA_F3- spacer_F4- pNFR5- HvRLK10- sfGFP_ T-LjNFR5_ ELB4 RLK4 EC31793 EC31793_ EC25164_ PMC- EC31652_ EC31073_ EC31658_ EC49283 NbNb_ pL2V_pIV10_ pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) RLK1 R1-pLjUbi- pIV10 pL1R1- pLjNfr1_ spacer1 pNFR5- sfGFP tYFPnls- pLjUbi- HvRLK4cds- LjNFR5- tNOS_F2- tYFPnls- 20aa- HvRLK10cds_ pLjNfr1_ tNOS NbGFP- T-LjNFR5 HVRLK4cds- 40aa- 20aa- NbGFP-HA NbGFP- 40aa- NbGFP- HA_F3- spacer_F4- pNFR5- HvRLK10- sfGFP_T- LjNFR5_ ELB4 RLK10 EC55049 EC55049_ EC25164_ PMC- EC31973_ EC31073_ AE2017 EC49283 sfGFP_ L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ EC31970_ (ELB-4) RLK4Nb pIV10_R1_ pIV10 pL1R1- pNFR5- spacer1 L1V-F4_ pLjUbi- pLjUbi- HvRLK10cds- pLjNfr1_ tYFPnls- tYFPnls- sfGFP_ HvRLK4cds- tNOS_F2_ tNOS T-LjNFR5 20aa- pNFR5- NbGFP-HA HvRLK10cds- sfGFP_T- LjNFR5_R3_ spacer_F4_ pLjNfr1_ HvRLK4cds- 20aa- NbGFP- HA_ELB4 RLK10 EC55050 EC55050_ EC25164_ PMC- EC31973_ EC31073_ EC32023_ EC49283 sfGFP_ L2V- pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) RLK4 pIV10_R1_ pIV10 pL1R1- pNFR5- spacer1 pLjNfr1_ mutNb pLjUbi- pLjUbi- HvRLK10cds- HvRLK4cds- tYFPnls- tYFPnls- sfGFP_ 20aa- tNOS_F2_ tNOS T-LjNFR5 mutNbGFP-HA pNFR5- HvRLK10cds- sfGFP_T- LjNFR5_ R3_spacer_ F4_pLjNfr1_ HvRLK4cds- 20aa- mutNbGFP- HA_ELB4 CERK6 EC31751 EC31751_ EC25164_ PMC- EC31651_ EC31073_ EC31655_ EC49283 NbNb_ pL2V_pIV10_ pL2V-1 02596_ L1V-F2_ pL1V-R3_ L1V-F4_ (ELB-4) NFR5 R1- pIV10 pL1R1- pLjNfr1_ spacer1 pNFR5- sfGFP pLjUbi- pLjUbi- gCerk6- LjNFR5- tYFPnls- tYFPnls- 20aa- sfGFP_ tNOS_F2- tNOS NbGFP- T-LjNFR5 pLjNfr1_ 40aa- gCerk6- NbGFP-HA 20aa- NbGFP- 40aa- NbGFP- HA_F3- spacer_F4- pNFR5- LjNFR5- sfGFP_ T-LjNFR5_ ELB4 For tobacco transformation: NFR5 EC32013 EC32013_ EC50507_ EC31048 EC31888_ EC25031 EC31994_ EC49283 sfGFP_ pL2V_binary_ pL2V L1R1- L1V-F2_ pL1M- L1V- (ELB-4) mCherryNb KAN- PUSCT- pLjUbi_ F3- F4_p35S_ F2_pLjUbi_ buffer 1 LjNFR5- Buffer- mCherry_ LjNFR5- sfGFP_ 25031 20linker_ sfGFP_T- T-35S NbsfGFP- 35S- HA_tNOS F4_p35S mCherry_ 20linker_ NbsfGFP- HA_tNOS_ ELB4 NFR5 EC32015 EC32015_ EC50507_ EC31048 EC31888_ EC25031 EC31994_ EC49283 sfGFP_ pL2V_binary_ pL2V L1R1- L1V-F2_ pL1M-F3- L1V- (ELB-4) mCherry KAN- PUSCT- pLjUbi_ Buffer- F4_p35S_ mutNb F2_pLjUbi_ buffer 1 LjNFR5- 25031 mCherry_ LjNFR5- sfGFP_ 20linker_ sfGFP_T-35S- T-35S NbsfGFP- F4_p35S_ HA_tNOS mCherry_ 20linker_ mutNbsfGFP- HA_tNOS_ ELB4 For stable lines: NFR5 EC31974 EC31974_ EC50507_ PMC- PMC- EC31073_ EC31642_ EC49283 sfGFP_ pL2V_R1- pL2V 03816_ 03558 pL1V- pL1V-F4_ (ELB-4) NFR1Nb pLjUbi_Hyg_ L1R1_ PU-pLjNfr5- R3_spacer1 pNFR1_ t35S_F2- pLjUbi_ SC3-LjNfr5 gNFR1_ pNFR5- Hyg_ C4_sfGFP_ 20linker_ LjNFR5- t35S T-LjNfr5- NbsfGFP- sfGFP_ L1-VF2 HA_tNFR1 T-LjNFR5_ F3-spacer_F4- pLjNfr1_ gLjNfr1- 20aa- NbGFP- HA_tNFR1_ ELB4
Bacteria and Culture Conditions
[0380] E. coli TOP10 (ThermoFisher Scientific) were used for molecular cloning and grown in LB medium at 37? C. Agrobacterium rhizogenes strain AR1193 (32) was used for hairy root transformations. Agrobacterium strains were grown in LB medium at 28? C.
Plant Materials
[0381] The Lotus japonicus ecotype Gifu pNin-gus wild type and mutant line nfr1-1 pNin-gus were used for nodulation assays. Plants were grown at 21? C. (16/8-hour light/dark conditions).
Hairy Root Transformation
[0382] For scarification, Lotus seeds were either immersed in sulfuric acid for 15 minutes or treated with sandpaper. Seeds were then surface sterilized for 3 minutes with 3% sodium hypochlorite, washed 3 times in ddH.sub.2O and dispersed on wet filter paper for germination. Three-day-old seedlings were transferred to square agar plates solidified with 0.8% Gelrite (Duchefa Biochemi) supplemented with ? Gamborg's B35 nutrient solution (Duchefa Biochemi). A. rhizogenes AR1193 strains carrying the construct of interest were grown for three days on LB Agar containing Ampicillin, Rifampicin, and Spectinomycin (final concentration of each antibiotic was 100 ?g/ml). For each construct the cells grown on one plate were resuspended in 4 mL YMB (5 g/L mannitol, 0.5 g/L yeast extract, 0.5 g/L K.sub.2HPO.sub.4, 0.2 g/L MgSO.sub.4.Math.7H.sub.2O, 0.1 g NaCl, pH=6.8). The bacterial suspension was then used to transform 6-day-old seedlings using a 1 mL. syringe with a needle (Sterican? ? 0.40?20 mm), punching the hypocotyl and placing a droplet on the root emerging from the wound. Square plates containing the transformed seedlings were sealed and left in the dark for one day and then moved to 21? C. under 16/8-hour light/dark conditions. After three weeks, primary roots were removed and seedlings with transformed roots were transferred to Magenta? vessels (Sigma-Aldrich) filled with lightweight expanded clay aggregate (Leca?, 2-4 mm; Saint-Gobain Weber A/S) supplemented with 80 mL nitrogen-free ?? B&D nutrient solution.
Nodulation Assay
[0383] If the roots were inoculated, nodules were counted six weeks after the transfer to Magenta? vessels (Sigma-Aldrich) and inoculation with Rhizobia. If the roots were not inoculated, nodules were counted six weeks after the transfer to Magenta? vessels (Sigma-Aldrich) (equivalent to nine weeks after hairy root transformations). All nodulation assays in roots transformed using hairy root transformation occurred in Magenta? vessels (Sigma-Aldrich). Nodulation assays in stable lines (see
[0384] A Kruskal-Wallis test (Kruskal et al. (1952) J Am Stat Assoc 47, 583-621) followed by Dunn's post-hoc test (Dunn (1964) Technometrics 6, 241-252) was used for statistical analysis of nodule counts.
Results
A VHH Tag was Able to Drive Specific Receptor Assembly
[0385] To investigate receptor complex activation, a technology that enables controlled assembly of receptors in living plant cells was developed. Symbiotic receptors NFR1 and NFR5 were chosen as proof-of-principle targets. To drive assembly, llama-derived VHHs were used as they are small, specific, and high-affinity binders that are active in the reducing environment of the cytosol (Ingram et al. (2018) Annual Review of Immunology 36, 695-715). A VHH with high affinity to the Lotus NFR5 kinase (Nb.sub.NFR5) was generated (
[0386] This indicated that the presence of the VHH was necessary and sufficient for assembly of NFR1 and NFR5, which resulted in the formation of nodules. These data confirmed that VHHs were functional in planta and could serve as a tool to synthetically induce complex formation. It also showed that the formation of an NFR1-NFR5 complex mediated by VHHs binding to the NFR5 kinase domain induced symbiotic signaling, which led to organogenesis.
Example 2: A VHH Towards GFP was Also Able to Drive In Vivo Receptor Assembly
[0387] The following example describes the use of a GFP tag and a VHH directed towards GFP to drive receptor assembly. The results presented in this example have widespread implications for uses in synthetic biology, as it is not always feasible to generate new customized VHHs for every experiment. As such, this general approach that does not rely on generating new customized VHHs each time provides a biological toolkit that can be used in many biological contexts.
Materials and Methods
Generation of Plant Expression Vector
[0388] For generation of the plant expression vector, the sequence of LaG16 (VHH directed toward GFP; SEQ ID NO: 3) was added in-frame as a C-terminal tag to the native NFR1 promoter and sequence into the pIV10_tYFP-NLS expression vector via Golden Gate cloning, and GFP (sfGFP; SEQ ID NO: 1) was added in-frame as a C-terminal tag to the native NFR5 promoter and sequence and cloned via Golden Gate cloning into PIV10_tYFP-NLS expression vector (Weber et al. (2011)PLoS One 6, e16765). The reverse, with GFP on NFR1 and LaG16 on NFR5, was also cloned. Agrobacterium rhizogenes strain AR1193 was grown in LB medium at 28? C. and transformed with pIV10 vectors via conjugation. For immunoprecipitation studies in N. benthamiana, plasmids expressing pLjUbi:Nfr5-sfGFP and p35S:mCherry-NbsfGFP were assembled by Golden Gate cloning in the pICH binary vector backbone. A construct overview is given in Table 1. VHH and fluorophore tag sequences are given in Table 2.
Bacteria and Culture Conditions
[0389] E. coli TOP10 (ThermoFisher Scientific) were used for molecular cloning and grown in LB medium at 37? C. Agrobacterium rhizogenes strain AR1193 (32) was used for hairy root transformations and Agrobacterium tumefaciens strain GV3101 was used for transient transformation of N. benthamiana. Agrobacterium strains were grown in LB medium at 28? C.
Plant Materials and Growth Conditions
[0390] L. japonicus ecotype Gifu wild type and mutant lines nfr1-1, nfr5-2, nfr1-1nfr5-2, symRK-3 and nfr1-1nfr5-2symRK-3 were used for nodulation assays. Nicotiana benthamiana was used for transient expression. All plants were grown at 21? C. under 16/8-h light/dark cycles.
Hairy Root Transformation and Nodulation Assay
[0391] Hairy root transformation and nodulation assays were performed as in Example 1.
Transient Transformation of N. benthamiana Plants
[0392] The assay was performed as in Ochoa-Fernandez et al. (Nature Methods 17, 717-725 (2020)). In short, A. tumefaciens GV3101 bacteria carrying the indicated constructs in Table 2 were resuspended in infiltration solution (10 mM MgCl.sub.2, 10 mM MES, 150 ?M acetosyringone, pH 5.6) to an OD.sub.600=0.025, incubated for two hours in the dark, and infiltrated into N. benthamiana leaves from the abaxial side with a blunt end syringe. Two days after infiltration, leaves were harvested and expression and localization were analyzed using microscopy.
TABLE-US-00002 TABLE2 VHHandfluorophoretagsequences Construct Sequence SuperfolderGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT (GFP) TGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK(SEQIDNO:1) Nb.sub.NFR5(NFR5 MQVQLVETGGGLVQDGDSLRLSCAASGFTFSNYYMSWVRQAPGKGLE VHH) WVSGITSGGTYTYDAVKDRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAK GGTSVAVRGFYDYRGQGTQVTVSS(SEQIDNO:66) LaG16(GFP MAQVQLVESGGRLVQAGDSLRLSCAASGRTFSTSAMAWFRQAPGRERE VHH) FVAAITWTVGNTILGDSVKGRFTISRDRAKNTVDLQMDNLEPEDTAVYYC SARSRGYVLSVLRSVDSYDYWGQGTQVTVSS(SEQIDNO:67) LaG16m MAQVQLVESGGRLVQAGDSLRLSCAASGRTWSTSAMAWFRQAPGRER (mutatedLaG16) EFVAAITWWVGNTILGDSVKGRFTISRDRAKNTVDLQMDNLEPEDTAVYY CSARSRWYVLSVLRSVDSYDYWGQGTQVTVSS(SEQIDNO:68)
Co-Immunoprecipitation
[0393] The assay was performed as in Arora et al. (The Plant Cell 34, 7, 2806 (2022)). In short, N. benthamiana leaves were crushed to a powder in liquid nitrogen using a mortar and pestle, then incubated for 1 hour at 4? C. on a rotor in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% (v/v) glycerol, 2 mM EDTA, 5 mM DTT, 1 mM phenylmethylsulfonyl fluoride, Protease Inhibitor Cocktail (Sigma-Aldrich), and 1% (v/v) IGEPAL? CA-630 (Alfa Aesar) in a ratio of 2 mL/g tissue. Extracts were centrifuged at 4? C. and 4700 rpm for 30 minutes. Supernatants were directly incubated with RFP-Trap? Magnetic Agarose beads (ChromoTek?) overnight at 4? C. The beads were washed five times in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% (v/v) glycerol, 2 mM EDTA, Protease Inhibitor Cocktail (Sigma-Aldrich), and 0.5% (v/v) IGEPAL? CA-630 (Alfa Aesar) on ice. To release the proteins, 50 ?L of SDS sample buffer (25 mM Tris-HCl, pH 6.8, 10% glycerol, 2% SDS, 0.2% 2-mercaptoethanol, 0.6 mg/mL Bromophenol blue) was added and samples were heated for 5 minutes at 95? C.
Western Blot
[0394] Proteins were separated on 12% SDS-polyacrylamide gels at 120 V for 3 h. Blotting to PVDF membranes (Merck) was done by wet transfer for 2 hours at 90 V. Membranes were blocked with 5% milk for 1 hour. For detection of GFP, membranes were incubated over night at 4? C. with mouse anti-GFP (632592; TaKaRa; 1:5000) followed by anti-mouse HRP (A4416; Sigma-Aldrich; 1:10,000) for 2 hours. For detection of mCherry, membranes were incubated overnight at 4? C. with rabbit anti-mCherry (632496; TaKaRa; 1:5000) followed by anti-rabbit HRP (A6154; Sigma-Aldrich; 1:10,000) for 2 hours. Chemiluminescence was detected on a G-BOX (Syngene) using ECL Prime Western Blotting Detection Reagent (Cytiva).
Results
A GFP-Tag and a VHH-Tag Towards GFP on Separate Receptors Resulted in Receptor Association
[0395] The well-characterized LaG16 VHH that binds superfolder green fluorescent protein (GFP) (Fridy et al. (2014) Nature Methods 11, 1253-1260) was fused to NFR1, and GFP was fused to NFR5. These constructs were expressed from their native promoters and terminators in nfr1 nfr5 double mutant plants (
Receptor Association was Abolished when the VHH Towards GFP Lost GFP-Binding Ability
[0396] To test whether the observed phenotype was dependent on the direct binding between VHH and GFP, a mutant version of LaG16 was engineered to have three bulky tryptophan residues in the VHH paratope. In contrast to functional LaG16, mutated LaG16 (LaG16m) did not have the ability to bind GFP-tagged NFR5 in tobacco pull-down assays (
A Single VHH was Sufficient to Induce Nodulation
[0397] To explore whether signaling was enhanced by assembling more receptors, two LaG16 VHHs were coupled in series to either NFR1 or NFR5, separated by a 40-residue long (?130 ?) flexible linker which should sterically allow one receptor to associate with two co-receptors (
Example 3: Identification of a Conserved Core Receptor Complex in Legumes Through Use of VHH Activation of Dimeric Receptors
[0398] The following example describes the use of VHH activation of a heteromeric LYK3-NFP receptor state in Medicago truncatula, resulting in the identification of a conserved receptor complex in legumes.
Materials and Methods
Generation of Plant Expression Vector
[0399] For generation of Medicago expression vectors, sequences of NFP and LYK3 were assembled with NFP and LYK3 promoters, respectively, and with 35S terminators. These sequences were further assembled with VHH or fluorophore tags into the pIV10_tYFP-NLS expression vector via Golden Gate cloning (Weber et al. (2011) PLoS One 6, e16765). Agrobacterium rhizogenes strain AR1193 was grown in LB medium at 28? C. and transformed with pIV10 vectors via conjugation. A construct overview is given in Table 1.
Plant Materials
[0400] The Medicago strains used were Medicago truncatula cv. wild type Jemalong A17 and lyk3nfp (hcl1-1nfp2). All plants were grown at 21? C. under 16/8-h light/dark cycles.
Hairy Root Transformation and Nodulation Assay
[0401] Hairy root transformation and nodulation assays were performed as in Example 1, with the following exception: Medicago truncatula seeds were immersed in sulfuric acid for 3 minutes, instead of 15 minutes, and one-day old Medicago seedlings were transferred to agar plates, compared to 3-day-old Lotus seedlings.
Results
Conservation of the NRF1-NFR5 Dimeric Receptor Complex in the Process of Symbiotic Organogenesis Signaling is Observed in Medicago.
[0402] To understand if the heteromeric receptor complex corresponds to the activated receptor state in other legume-rhizobia symbioses, analogous experiments were performed in Medicago truncatula (Medicago), where the two Nod factor receptors LYK3 and NFP were associated via VHHs. A heteromeric LYK3-NFP receptor complex (i.e., VHH-driven dimerization of NFP and LYK3) was observed to be sufficient to initiate organogenesis in Medicago in the absence of external signals (
Conserved Core Complex Activity is Mediated by Phosphorylation and Cytokinin Signaling
[0403] To understand if symbiotic signaling was exclusively dependent on the physical assembly of the receptors or if it also requires a phosphorylation event, a point mutation was introduced into NFR1, impairing its kinase function (Madsen et al. (2011) Plant Journal 65, 405-417). Plants that expressed the kinase-dead NFR1 failed to form nodules (
[0404] To investigate if it was possible to drive symbiotic signaling from SYMRK independently of the formed NFR1-NFR5 complex, VHHs were used to associate SYMRK to either NFR1 or NFR5. Neither the SYMRK-NFR1 nor the SYMRK-NFR5 complex drove organogenesis signaling (FIG. 2C, rightmost two columns), showing that the essential role of SYMRK in nodulation requires either a ligand- or VHH-induced NFR1-NFR5 complex.
[0405] To verify that the activated receptor complex operated through the known organogenesis pathways (Tirichine et al. (2007) Science 315, 104-107; Murray et al. (2007) Science 315, 101-104), its dependency on cytokinin signaling was explored. The activated NFR1-NFR5 complex was unable to initiate organogenesis in the lhk1 loss-of-function cytokinin receptor mutant (
Example 4: VHH-Mediated Receptor Complex Initiates Both Cortical and Epidermal Programs
[0406] The following example describes the use of VHH-mediated NFR1-NFR5 receptor assembly to investigate the independent roles of the complex in infection and organogenesis signaling.
Materials and Methods
Generation of Plant Expression Vector
[0407] For generation of plant expression vectors, sequences of RLKs were assembled with the native NFR1 or NFR5 promoter- and terminator sequences and VHH or fluorophore tags into the pIV10_tYFP-NLS expression vector via Golden Gate cloning (Weber et al. (2011) PLoS One 6, e16765). A construct overview is given in Table 1.
Bacteria and Culture Conditions
[0408] E. coli TOP10 (ThermoFisher Scientific) were used for molecular cloning and grown in LB medium at 37? C. Mesorhizobium loti strain R7A (Kelly et al. (2013) Molecular Plant-Microbe Interactions 26, 319-329) constitutively expressing the fluorescent protein DsRed or IRBG74 (Cummings et al. (2009) Environmental Microbiology 11, 2510-2525) was grown in YMB (5 g/L mannitol, 0.5 g/L yeast extract, 0.5 g/L K.sub.2HPO.sub.4, 0.2 g/L MgSO.sub.4.Math.7H.sub.2O, 0.1 g NaCl, pH 6.8) medium at 28? C. Agrobacterium rhizogenes strain AR1193 was used for hairy root transformations. Agrobacterium strains were grown in LB medium at 28? C.
Plant Materials
[0409] The following lines were used for nodulation assays: Lotus japonicus Gifu (Handberg et al. (1992) Plant Journal 2, 487-796), Gifu_pNin-gus, nfr1-1_pNin-gus, nfr5-2_pNin-gus, nfr1-1nfr5-2_pNin-gus (Madsen et al. (2003) Nature 425, 637-640; Gysel et al. (2021) PNAS 118, e2111031118), lhk1-1 (Murray et al. (2007) Science 315, 101-104), symRK-3 (Stracke et al. (2002) Nature 417, 959-962), and nfr1-1nfr5-2symRK-3. All plants were grown at 21? C. under 16/8-h light/dark cycles. Stable transformants of Lotus were generated as described in Thykjor et al. (Cell Biology: A Laboratory Manual, Academic Press Inc., Orlando Florida, 1997, pg. 518-525) using Agrobacterium-mediated hypocotyl transformation and regeneration with the phytohormone concentrations of Lombari et al. (Lotus japonicus Handbook, A. J. Marquez et al., Eds. Springer, Berlin, Germany, 2005, 251-259).
Hairy Root Transformation and Nodulation Assay
[0410] Hairy root transformation was performed as in Example 1. Nodulation assays were done in Magenta? vessels (Sigma-Aldrich). Mesorhizobium loti strain R7A constitutively expressing the fluorescent protein DsRed was grown in TY/YMB medium at 28? C. After transfer to magentas, plants were inoculated with 150 ?l per plant of M. loti R7A DsRed strain, at a final concentration of OD.sub.600=0.04. At six weeks post inoculation, nodules were counted and pictures were acquired with a Leica M165FC Fluorescent Stereo Microscope equipped with the Leica DFC310 FX camera. Nodulation assays were performed four weeks after inoculation with IRBG74.
[0411] A Kruskal-Wallis test (Kruskal et al. (1952) J Am Stat Assoc 47, 583-621) followed by Dunn's post-hoc test (Dunn (1964) Technometrics 6, 241-252) was used for statistical analysis of nodule counts. Statistical analyses for pink and white nodule counts were done separately.
Nodulation and Infection Thread Assays on Plates
[0412] Three-day-old seedlings were transferred to square plates containing a slope of ? B&D medium (Broughton et al. (1971) Biochem J 125, 1075-1080) solidified with 1.4% Noble Agar (Difco?). The slope was covered with wet filter paper (AGF 651; Frisenette Aps) and a metal bar with 3 mm holes for roots was placed at the top of the agar slope. Plates were placed in boxes excluding light from the roots below the metal bar. Where needed, plants were inoculated with 75 ?L of M. loti per plant at an OD.sub.600 of 0.02. A Kruskal-Wallis test was used for statistical analysis of infection thread counts.
GUS Staining
[0413] Roots of 15-day-old stable line seedlings were cut and incubated in GUS staining buffer (0.5 mg/mL 5-bromo-4-chloro-3-indolyl-?-D-glucuronic acid (X-Gluc), 100 mM potassium phosphate buffer (pH 7.0), 10 mM EDTA (pH 8.0), 1 mM potassium ferricyanide, 1 mM potassium ferrocyanide and 0.1% Triton X-100) at 37? C. overnight. Roots were washed with 70% ethanol. Pictures were taken using a Zeiss Axioplan 2 imaging microscope and processed using ImageJ (Schneider et al. (2012) Nature Methods 9, 671-675). The WT line used for GUS staining was a transformed line carrying pNIN:GUS (Gifu_pNin-gus).
Results
[0414] Infection Occurred but was Reduced in Plants with VHH-Mediated NFR1-NFR5 Complexes
[0415] To investigate the effect of the VHH-induced NFR1-NFR5 complex on the infection program, plants with and without the VHH receptor fusion system were inoculated with Mesorhizobium loti (M. loti) bacteria, the symbiont of Lotus. Infection by M. loti was monitored via the appearance of pink, leghemoglobin-producing nodules on the roots. While an increased number of white nodules formed on plants expressing the VHH-associated NFR1-NFR5 complex, formation of infected pink nodules was reduced compared to plants expressing the native receptors (
[0416] It was considered possible that rhizobia that use an intercellular infection mechanism and circumvent the epidermal root hair infection program could more efficiently colonize the nodules induced by the VHH-mediated receptor complexes. To test this, infection of nodules was tested after inoculation with IRBG74, which uses an intercellular, crack-entry mechanism (Cummings et al. (2009) Environmental Microbiology 11, 2510-2525; Montiel et al. (2021) Plant Physiology 185, 1131-1147). The nfr1 nfr5 mutant roots only formed white, uninfected nodules (
VHHs Induce Constitutive Receptor Complex Formation in Roots
[0417] To understand how downstream processes are affected by the presence of the VHH-activated receptor complex, stable Lotus lines were generated that expressed GFP-tagged NFR5 and LaG16-tagged NFR1 in the nfr1 nfr5 double mutant background with a 0-glucuronidase (GUS) reporter gene driven by the NIN promoter. The effect of the activated receptor state on both infection and organogenesis was evaluated by looking at the expression of the transcription factor NIN, which orchestrates both the epidermal infection program and the cortical organogenesis program (Schauser et al. (1999) Nature 402, 191-195). Nodule organogenesis was observed independent of rhizobia in three independent stable lines at 7 to 10 days after germination. GUS staining revealed NIN activation in nodules as well as in dividing cortical cells which mark sites of emerging nodule primordia (
[0418] Since transgenic roots expressing the VHH-mediated complex initiated both organogenesis and infection, the possibility that certain receptor domains contributed differently to the two developmental processes could be investigated. For this, VHH-mediated complexes were engineered with receptors lacking the ectodomains of NFR1, NFR5 or both. These complexes were expressed in transgenic roots. All these ectodomain-lacking versions of the complexes were still found to activate organogenesis, albeit with a reduced efficiency compared to full-length receptors. As shown in
Example 5: VHH Constructs Showed Conservation of Function of NFR1 and NFR5 Orthologs in Barley
[0419] The following example describes the use of VHHs in molecular biology to test the conservation of functionality of orthologs of NFR1 and NFR5 from Medicago and barley, and their role in infection and symbiosis-mediated organogenesis.
Materials and Methods
Generation of Plant Expression Vector
[0420] For generation of plant expression vectors, sequences of barley RLKs were assembled with the native NFR1 or NFR5 promoter- and terminator sequences and VHH or fluorophore tags into the pIV10_tYFP-NLS expression vector via Golden Gate cloning (Weber et al. (2011) PLoS One 6, e16765). Agrobacterium rhizogenes strain AR1193 was grown in LB medium at 28? C. and transformed with pIV10 vectors via conjugation. A construct overview is given in Table 1.
Plant Materials
[0421] L. japonicus ecotype Gifu_pNin-gus wild type and mutant lines nfr1-1_pNin-gus, nfr5-2_pNin-gus, and nfr1-1nfr5-2_pNin-gus were utilized. All plants were grown at 21? C. under 16/8-h light/dark cycles.
Hairy Root Transformation and Nodulation Assay
[0422] Hairy root transformation was performed as in Example 1. Nodulation assays were performed as in Example 4.
Protein Modeling
[0423] Structure predictions were made using Alphafold v.2.2.0 (Jumper et al. (2021) Nature 596, 583-589; Varadi et al. (2022) Nucleic Acids Research 50, D439-D444) with default parameters. Since lipids are not included in the predictions the receptor ectodomains and kinases were not restricted to be on opposite sides of the membrane. To visualize a possible physical orientation of the receptors, the conformations of a few residues were manually rebuilt in the juxtamembrane parts in Coot (Crystallographic Object-Oriented Toolkit, Emsley et al. (2010) Acta Crystrallographica D. Biological Crystallography 66, 486-501). The models were aligned and visualized in PyMOL (The PyMOL Molecular Graphics System, Version 2.0, Schr?dinger, LLC).
Phylogenetic Analysis
[0424] Phylogenetic trees were constructed based on a multiple sequence alignment of full-length receptors created with the CLC Main Workbench 22.0.1 (QIAGEN). UPGMA and Jukes-Cantor were set as algorithm and distance measures, respectively. Amino acid sequence percent identities were compared with the CLC Main Workbench 22.0.1 (QIAGEN).
Results
Cereal Receptors can Activate Root Nodule Organogenesis
[0425] The ability to develop nitrogen-fixing root nodules is restricted to a single clade of flowering plants (Soltis et al. (1995) PNAS 92, 2647-2651). However, most plants, including cereals, can form arbuscular mycorrhizal symbiosis by activating the common symbiosis pathway that is shared with root nodule symbiosis in legumes (Kistner et al. (2005) Plant cell 17, 2217-2229; Radhakrishnan et al. (2020) Nature Plants 6, 280-289). This dichotomy indicates that the LysM receptors from cereals are unable to activate downstream signaling leading to nodulation.
[0426] Genomic analysis was performed to identify receptors in barley with symbiotic signaling capacity, resulting in the identification of seven LysM receptor-like kinases (RLKs) belonging to the NFR1 and NFR5 families (
[0427] Together, these surprising data demonstrated that LysM receptors from barley, which diverged from Lotus 200 million years ago (Wolfe et al. (1989) PNAS 86, 6201-6205), have retained the basic ability to activate the symbiotic pathway leading to root nodule organogenesis in legumes. Further investigation was performed to determine if the Lotus chitin receptor CERK6 (SEQ ID NO: 58; Bozsoki et al. (2017) PNAS 114, E8118-E8127), the closest homologue to Lotus NFR1 and in the same receptor family as barley RLK4, could support nodulation. Lotus CERK6 shares 62% sequence identity with Lotus NFR1 (Table 3), but only two out of 27 plants formed a single nodule when CERK6 and NFR5 were associated via VHHs in the nfr1 nfr5 mutants (
TABLE-US-00003 TABLE 3 Comparison of amino acid sequence identities Percentage of amino acid identity between full-length receptors and intracellular domains (in parenthesis) of receptors used in this application. LjNFR1 MtLYK3 LjCERK6 HvRLK4 LjNFR5 MtNFP HvRLK10 LjSYMRK LjNFR1 78 (88) 62 (70) 51 (63) 24 (29) 25 (30) 24 (24) 18 (28) MtLYK3 62 (72) 52 (64) 25 (30) 26 (30) 23 (24) 17 (28) LjCERK6 58 (70) 24 (28) 23 (29) 24 (26) 18 (28) HvRLK4 24 (28) 23 (28) 24 (26) 17 (29) LjNFR5 72 (80) 38 (42) 15 (22) MtNFP 37 (40) 16 (20) HvRLK10 14 (19) LjSYMRK
Distal Barley NFR5-Type Receptors Activate Root Nodule Organogenesis, but Distal Barley NFR1-Type Receptors do not
[0428] The barley genome contains four NFR5-type receptors, RLK1 (SEQ ID NO: 59; SEQ ID NO: 64), RLK2 (SEQ ID NO: 60; SEQ ID NO: 65), RLK3 (SEQ ID NO: 62), and RLK10 (SEQ ID NO: 57), of which RLK11 was the closest relative to the Lotus NFR5 (
[0429] The barley genome contains three NFR1-type receptors, RLK4 (SEQ ID NO: 56), RLK5 (SEQ ID NO: 61), and RLK7 (SEQ ID NO: 63) (