METHODS OF DIAGNOSING AND PREDICTING RENAL DECLINE

20240192227 ยท 2024-06-13

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides methods for identifying a human subject at risk of developing progressive renal decline by examining a level(s) of a protective protein(s) in a sample from the subject. Level(s) of protein(s) identified in the disclosure are associated with protection against progressive renal failure and end-stage kidney disease (ESKD). Examples of such protective proteins include FGF20, ANGPT1, and TNFSF12.

    Claims

    1. A method of identifying a human subject at risk of developing progressive renal decline, said method comprising detecting a level of at least one protective protein in a sample(s) from a subject in need thereof, wherein the protective protein is selected from the group consisting of fibroblast growth factor 20 (FGF20), angiopoietin-2 (ANGPT1), and tumor necrosis factor ligand superfamily member 12 (TNFSF12), comparing the level of the protective protein with a reference level of the protective protein, wherein the reference level is a level of the protective protein in a non-progressor human subject, wherein a lower level of the protective protein in comparison to the non-progressor reference level indicates that the human subject is at risk of developing progressive renal decline, or wherein an equivalent or higher level of the protective protein in comparison to the reference level indicates that the human subject is not at risk of developing progressive renal decline.

    2. The method of claim 1, wherein levels of a combination of protective proteins are detected, wherein the combination of protective proteins is selected from the group consisting of FGF20 and TNFSF12; FGF20 and ANGPT1; and TNFSF12 and ANGPT1; or wherein the combination of protective proteins includes FGF20, TNFSF12, and ANGPT1.

    3. A method of identifying a human subject at risk of developing progressive renal decline, said method comprising detecting a level of at least one protective protein in a sample(s) from a subject in need thereof, wherein the protective protein is selected from the group consisting of a protective protein from a first group of protective proteins selected from the group consisting of Testican-2, secreted protein acidic and rich in cysteine (SPARC), C-C motif chemokine 5 (CCL5), amyloid beta A4 protein (APP), platelet factor-4 (PF4) and ANGPT1, a protective protein from a second group of protective proteins selected from the group consisting of DNAJC19 and TNFSF12, and FGF20, comparing the level of the protective protein with a reference level of the protective protein, wherein the reference level is a level of the protective protein in a non-progressor human subject, wherein a lower level of the protective protein in comparison to the reference level indicates that the human subject is at risk of developing progressive renal decline, or wherein an equivalent or higher level of the protective protein in comparison to the reference level indicates that the human subject is not at risk of developing progressive renal decline.

    4. The method of claim 3, wherein levels of a combination of protective proteins are detected, wherein the combination of protective proteins is selected from the group consisting of FGF20 and a group 1 protective protein; FGF20 and a group 2 protective protein; a group 1 protective protein and a group 2 protective protein; and FGF20, a group 1 protective protein and a group 2 protective protein.

    5. The method of claim 1, wherein the non-progressor is a non-diabetic human subject.

    6. The method of claim 1, further comprising administering a therapy to improve kidney function if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject FGF20, an active fragment of FGF20, an FGF20 mimic, or a nucleic acid encoding FGF20, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject ANGPT1, an active fragment of ANGPT1, an ANGPT1 mimic, or a nucleic acid encoding ANGPT1, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject TNFSF12, an active fragment of TNFSF12, a TNFSF12 mimic, or a nucleic acid encoding TNFSF12, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject SPARC, an active fragment of SPARC, a mimic of SPARC, or a nucleic acid encoding SPARC, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline.

    7-10. (canceled)

    11. The method of claim 1, wherein the human subject has impaired kidney function, diabetes, or both, wherein the diabetes is type I diabetes or type II diabetes; or wherein the human subject is non-diabetic.

    12-14. (canceled)

    15. The method of claim 1, wherein the level of the protective protein is determined using an immunoassay, mass spectrometry, liquid chromatography (LC) fractionation, SOMAscam, Mesoscale platform, or electrochemiluminescence detection, wherein the immunoassay is an ELISA or a Western blot analysis; and wherein the mass spectrometry matrix assisted laser desorption ionization-time-of-flight (MALDI-TOF), inductively coupled plasma mass spectrometry (ICP-MS), triggered-by-offset, multiplexed, accurate-mass, high-resolution, and absolute quantification (TOMAHAQ), direct analysis in real time mass spectrometry (DART-MS) or secondary ion mass spectrometry (SIMS).

    16-17. (canceled)

    18. The method of claim 1, wherein the sample is a blood sample, a serum sample, a plasma sample, a lymph sample, a urine sample, a saliva sample, a tear sample, a sweat sample, a semen sample, a vaginal sample, a bronchial sample, a mucosal sample, or a cerebrospinal fluid (CSF) sample.

    19. A protein array for identifying or monitoring progressive renal decline of a human subject, said protein array comprising antibodies or antigen-binding fragments thereof, specific for human FGF20, human TNFSF12, human ANGPT1, human Testican-2, human SPARC, human CCL5, human APP, human PF4, human ANGPT1, human DNAJC19, human TNFSF12, or combinations thereof; and/or a plurality of probes for specifically binding a protein biomarker, wherein the protein biomarker is at least one of human FGF20, human TNSF12, human ANGPT1 human Testican-2, human SPARC, human CCL5, human APP, human PF4, and human DNAJC19.

    20-22. (canceled)

    23. A test panel comprising the protein array of claim 19.

    24. A kit or assay device comprising the test panel of claim 23.

    25. (canceled)

    26. A method of treating or preventing renal decline in a human subject, said method comprising administering to a subject an effective amount of at least one protective protein and/or at least one agonist of a protective protein.

    27. (canceled)

    28. The method of claim 26, wherein the at least one protective protein is one or more of FGF20, TNFSF12, ANGPT1, Testican-2, SPARC, CCL5, APP, PF4, and DNAJC19; wherein at least one protective protein is FGF20, an active fragment of FGF20, a FGF20 mimic, or a nucleic acid encoding FGF20, or an active fragment thereof; and/or wherein the at least one protective protein is TNFSF12, an active fragment of TNFS12, a TNFSF12 mimic, or a nucleic acid encoding TNFSF12, or an active fragment thereof; and/or wherein the at least one protective protein is ANGPT1, an active fragment of ANGPT1, a ANGPT1 mimic, or a nucleic acid encoding ANGPT1, or an active fragment thereof; and/or wherein the at least one protective protein is SPARC, an active fragment of SPARC, a SPARC mimic, or a nucleic acid encoding SPARC, or an active fragment thereof; and/or wherein the at least one protective protein is CCL5, an active fragment of CCL5, a CCL5 mimic, or a nucleic acid encoding CCL5, or an active fragment thereof; and/or wherein the at least one protective protein is APP, an active fragment of APP, a APP mimic, or a nucleic acid encoding APP, or an active fragment thereof; and/or wherein the at least one protective protein is PF4, an active fragment of PF4, a PF4 mimic, or a nucleic acid encoding PF4, or an active fragment thereof; and/or wherein the at least one protective protein is DNAJC19, an active fragment of DNAJC19, a DNAJC19 mimic, or a nucleic acid encoding DNAJC19, or an active fragment thereof; and/or wherein the at least one protective protein is Testican-2, an active fragment of Testican-2, a Testican-2 mimic, or a nucleic acid encoding Testican-2, or an active fragment thereof.

    29-37. (canceled)

    38. The method of claim 28, wherein the nucleic acid is in a vector.

    39. The method of claim 26, wherein the human subject was previously identified as a progressor at risk of developing progressive renal decline.

    40. A method of determining the approximate risk of renal decline in a human subject in a defined time period, the method comprising: a) obtaining a biological sample from the human subject; b) detecting the level of at least one protective protein in the biological sample, wherein the at least one protective protein is selected from the group consisting of FGF20, TNFSF12, ANGPT1, Testican-2, SPARC, CCL5, APP, PF4, and DNAJC19; c) combining data on the level of the protective proteins with clinical data features of the human subject (such as eGFR, uACR, Clinical Chemistry laboratory measurements, vital signs, patient demographics); and d) determining the approximate risk of renal decline (RD) for the human subject as determined using a machine-learned or statistically modelled, prognostic risk-score algorithm (e.g., KidneyIntelX test platform).

    41. The method of claim 40, further comprising comparing the level of the at least one protective protein in the biological sample to a non-progressor control level or a normoalbuminuric control level.

    42. The method of claim 40, wherein the biological sample is obtained from the human subject at a first time point and a second time point, wherein the second time point is obtained from the human subject about 6 months, about 12 months, about 18 months, about 24 months, about 3 years, about 4 years, about 5 years, about 10 years or about 15 years after the first time point.

    43. (canceled)

    44. The method of claim 42, further comprising comparing the level of the at least one protective protein in the biological sample obtained from the human subject at a first time point to the biological sample obtained from the human subject at a second time point.

    45. The method of claim 3, wherein the non-progressor is a non-diabetic human subject.

    46. The method of claim 3, further comprising administering a therapy to improve kidney function if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject FGF20, an active fragment of FGF20, an FGF20 mimic, or a nucleic acid encoding FGF20, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject ANGPT1, an active fragment of ANGPT1, an ANGPT1 mimic, or a nucleic acid encoding ANGPT1, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject TNFSF12, an active fragment of TNFSF12, a TNFSF12 mimic, or a nucleic acid encoding TNFSF12, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline; and/or further comprising administering to the subject SPARC, an active fragment of SPARC, a mimic of SPARC, or a nucleic acid encoding SPARC, or an active fragment thereof, if the subject is identified as having a risk for progressive renal decline.

    47. The method of claim 3, wherein the human subject has impaired kidney function, diabetes, or both, wherein the diabetes is type I diabetes or type II diabetes; or wherein the human subject is non-diabetic.

    48. The method of claim 3, wherein the level of the protective protein is determined using an immunoassay, mass spectrometry, liquid chromatography (LC) fractionation, SOMAscam, Mesoscale platform, or electrochemiluminescence detection, wherein the immunoassay is an ELISA or a Western blot analysis; and wherein the mass spectrometry matrix assisted laser desorption ionization-time-of-flight (MALDI-TOF), inductively coupled plasma mass spectrometry (ICP-MS), triggered-by-offset, multiplexed, accurate-mass, high-resolution, and absolute quantification (TOMAHAQ), direct analysis in real time mass spectrometry (DART-MS) or secondary ion mass spectrometry (SIMS).

    49. The method of claim 3, wherein the sample is a blood sample, a serum sample, a plasma sample, a lymph sample, a urine sample, a saliva sample, a tear sample, a sweat sample, a semen sample, a vaginal sample, a bronchial sample, a mucosal sample, or a cerebrospinal fluid (CSF) sample

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0029] FIGS. 1A-1B provide histograms showing distribution of the top 3 protective protein candidates FGF20, TNFSF12, and ANGPT1 after log 10 transformation. FIG. 1A provides histograms showing distribution of FGF20, TNFSF12, and ANGPT1 after log 10 transformation in the combined T1D discovery and T2D replication cohorts. FIG. 1B provides histograms showing distribution of FGF20, TNFSF12, and ANGPT1 after log 10 transformation in the T1D validation cohort.

    [0030] FIG. 2 is a graph showing distribution of eGFR slopes (ml/min/1.73 m.sup.2/year) in the Joslin Kidney Study cohorts with T1D and T2D. Slow decliners were defined as eGFR loss <3.0 ml/min/1.73 m.sup.2/year and fast decliners as eGFR loss ?3.0 ml/min/1.73 m.sup.2/year or ESKD progressors. In each cohort, only ESKD cases that developed during the first 10 years after study entry were considered in the present study. Dashed line indicates eGFR loss equals to 3.0 ml/min/1.73 m.sup.2/year.

    [0031] FIG. 3 is a schematic representation of study design showing the study participants in the exploratory and replication panels and how the candidate protective proteins were selected.

    [0032] FIGS. 4A-4B provide graphs showing candidate circulating proteins associated with protection against fast progressive renal decline. FIG. 4A is a graph showing Spearman's rank correlation coefficients (r.sub.s) between baseline concentration of 19 plasma proteins and eGFR slope in the Joslin cohorts with T1D (N=214) and T2D (N=144). Shaded bars are a graphic representation of the effect size. Corresponding two-sided P-values have been provided. *Thresholds for the significance used: FDR adjusted P<0.005 in the T1D exploratory cohort and a nominal P<0.05 in the T2D replication cohort. FIG. 4B is a graph showing odds ratios (95% CI) for the 19 candidate protective proteins and fast progressive renal decline (eGFR loss ?3.0 ml/min/year) in the combined cohorts with T1D and T2D in univariate and adjusted logistic regression models. The effect is shown as an odds ratio (95% CI) per one quartile increase in circulating baseline concentration of the specific protein. The final model was adjusted for baseline eGFR, HbA1c and ACR with stratification by type of diabetes. The 8 selected markers are in red. PKM2 included in the analysis is based on a previous publication.

    [0033] FIGS. 5A-5C provide graphs showing association of 8 confirmed protective proteins with clinical covariates and with risk of fast progressive renal decline. FIG. 5A is a graph showing Spearman's rank correlation matrix among 8 candidate protective proteins with TNF-R1 and important clinical covariates in the two cohorts adjusted for type of diabetes. Correlation coefficients (r.sub.s) are presented as shades of red (positive; marked with #) and blue (negative; marked with ##) which correspond to the magnitude of the effect size. FIG. 5B is a graph showing hierarchical cluster analysis in the combined Joslin cohorts. FIG. 5C is a graph showing odds ratios (95% CI) of covariates selected from a backward selection of covariates using the significance criterion ?=0.1. The effects of eGFR and HbA1c on fast progressive renal decline are estimated per 10 ml/min/1.73 m.sup.2 increase and per 1% increase, respectively. The effect of ACR on fast progressive renal decline is estimated as one-unit increase of log.sub.10 ACR. The effect of each protein is shown as an odds ratio (95% CI) per one quartile increase in circulating baseline concentration of the relevant protein. *P<0.05; **P<0.01; ***P<0.001; ****P<0.0001; ns, not significant.

    [0034] FIG. 6 is a graph Spearman's rank correlation matrix among 11 candidate protective proteins with ACR adjusted for type of diabetes. Correlation coefficients (r.sub.s) are presented as shades of red (positive) and blue (negative; marked with #) which correspond to the magnitude of the effect size.

    [0035] FIGS. 7A-7D provide graphs showing the combined effect of protective proteins (FGF20, TNFSF12 and ANGPT1) on risk of fast progressive renal decline and progression to ESKD. FIG. 7A is a graph showing odds ratios for fast progressive renal decline according to index of protection considered as a discrete covariate in the combined exploratory and replication cohorts (N=358) with both types of diabetes and impaired kidney function (also referred to as renal function). FIG. 7B is a graph showing cumulative incidence of ESKD (%) according to discrete values of index of protection in the combined exploratory and replication cohorts. FIG. 7C is a graph showing odds ratios for fast progressive renal decline according to index of protection considered as a discrete covariate in the validation cohort (N=294) of T1D subjects with normal kidney function. FIG. 7D is a graph showing cumulative incidence of ESKD (%) according to discrete values of index of protection in the validation cohort. Index of protection: Value above median for each protein was scored as 1 and below as 0; by summing up these scores, a subject could have a total protection index varying between 0 (all proteins below median) and 3 (all proteins above median). *P<0.05; ****P<0.0001; ns, not significant.

    [0036] FIG. 8 is an extracted ion chromatogram of FGF20 tryptic peptide GGPGAAQLAHLHGILR (SEQ ID NO: 9) (amino acids 50-65). The FGF20 SOMAmer plasma pull-downs in the presence (top) or absence (bottom) of recombinant FGF20.

    [0037] FIG. 9 provides graphs showing plasma concentrations of exemplar protective proteins ANGPT1 (left panel), TNFSF12 (middle panel), FGF20 (right panel) in the combined Joslin cohorts, for non-progressors and progressors, compared to non-diabetics. Bars depict the mean?standard deviations. One-way ANOVA with Dunn's multiple comparisons test. **P<0.01; ***P<0.001; ****P<0.0001; ns, not significant.

    [0038] FIG. 10 is a histogram showing the data of comparison of Testican-2 (SPOCK2) plasma levels (RFU) between non-ESKD progressors and ESKD progressors.

    DETAILED DESCRIPTION OF INVENTION

    I. Definitions

    [0039] Prior to setting forth the invention in detail, definitions of certain terms to be used herein are provided. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art.

    [0040] The term subject or patient, as used interchangeably herein, refers to a human.

    [0041] The term sample as used herein refers to plasma, serum, cells or tissue obtained from a subject. The source of the tissue or cell sample may be solid tissue (as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate); whole blood or any blood constituents; or bodily fluids, such as serum, plasma, urine, saliva, sweat or synovial fluid. In one embodiment, the sample is a plasma sample obtained from a human subject.

    [0042] The term level or amount of a biomarker, as used herein, refers to the measurable quantity of a biomarker, e.g., protein level of a biomarker. The amount may be either (a) an absolute amount as measured in molecules, moles or weight per unit volume or cells or (b) a relative amount, e.g., measured by densitometric analysis.

    [0043] As used herein, the term known standard level, reference level or control level, used interchangeably, refers to an accepted or pre-determined level of the biomarker which is used to compare the biomarker level derived from a sample of a patient. In one embodiment, when compared to the reference level of a certain biomarker (protective protein), deviation from the reference level generally indicates either an improvement or deterioration in the disease state or future disease state. In one embodiment, when compared to the reference level of a protective protein, deviation from the reference level generally indicates an increased or decreased likelihood of disease progression in a subject. A reference level can be generated from a sample taken from a healthy (e.g., non-diabetic) individual or from an individual known to have a predisposition to ESKD. In one embodiment, the reference level of a protective protein described herein is the level of the protein in a non-diabetic subject.

    [0044] As used herein, the term comparable level refers to a level of one biomarker that is substantially similar to the level of another, e.g., a control level. In one embodiment, two biomarkers have a comparable level if the level of the biomarker is within one standard deviation of the control biomarker level. In another embodiment, two biomarkers have a comparable level if the level of the biomarker is 20% or less of the level of the control biomarker level.

    [0045] As used herein, the term estimated Glomerular Filtration Rate or eGFR, refers to a means for estimating kidney function. In one embodiment, eGFR may be determined based on a measurement of serum creatinine levels. In another embodiment, eGFR may be determined based on a measurement of serum cystatin C levels. In yet another embodiment, eGFR may be determined using the CKD-EPI creatinine equation.

    [0046] As used herein, the term a disorder associated with chronic kidney disease or a disorder associated with chronic renal disease refers to a disease or condition associated with impaired kidney function which can cause kidney damage over time. Examples of disorders associated with chronic kidney disease include, but are not limited to, type 1 diabetes, type 2 diabetes, high blood pressure, glomerulonephritis, interstitial nephritis, polycystic kidney disease, prolonged obstruction of the urinary tract (e.g., from conditions such as enlarged prostate, kidney stones and some cancers), vesicoureteral reflux, and recurrent kidney infection. Chronic kidney disease and its stages (CKD 1-5) can usually be characterized or classified accordingly, such as based on the presence of either kidney damage (albuminuria) or impaired estimated glomerular filtration rate (GFR<60 [ml/min/1.73 m.sup.2], with or without kidney damage).

    [0047] As used herein, the term ESKD progressor, progressor or rapid progressor refers to a subject having a disorder associated with chronic kidney disease who has been identified as having an elevated risk for developing ESKD (also referred to herein as ESRD). While an ESKD progressor has a disorder associated with chronic kidney disease, which may put the subject at risk for developing ESKD, the term is meant to include those subjects who have an identified risk elevated above that normally associated with the disorder associated with chronic kidney disease. In one embodiment, a progressor has a level of any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, Testican-2, and/or DNAJC19 that is statistically significantly lower than a non-progressor control level or a normoalbuminuric control, and, as such, has an increased risk for developing ESKD. In another embodiment, a progressor has a level of any one or more of FGF20, TNFSF12, and/or ANGPT1 that is statistically significantly lower than a non-progressor control level or a normoalbuminuric control, and, as such, has an increased risk for developing ESKD.

    [0048] As used herein, the term non-progressor refers to a subject having a disorder associated with chronic kidney disease who has a reduced risk of developing ESKD. In one embodiment, a non-progressor is a subject having a disorder associated with chronic kidney disease who is in stage 1 or 2 CKD (Chronic Kidney Disease) but who has a lower risk of progressing to ESKD due, at least in part, to elevated or comparable levels of a protective proteins (e.g., in comparison to a normoalbuminuric control). In one embodiment, a non-progressor is defined as a subject who has a level of any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, Testican-2, and/or DNAJC19 that is statistically significantly higher than a progressor control level or is higher or comparable to a normoalbuminuric control. In another embodiment, a non-progressor is defined as a subject who has a level of any one or more of FGF20, TNFSF12, and/or ANGPT1, that is statistically significantly higher than a progressor control level or is higher or comparable to a normoalbuminuric control. In another embodiment, a non-progressor is defined as a subject who has a level of Testican-2, that is statistically significantly higher than a progressor control level or is higher or comparable to a normoalbuminuric control. In one embodiment, a non-progressor is a non-diabetic human subject. Non-diabetic refers to a person who has not been diagnosed with diabetes (Type II).

    [0049] As used herein, the term protective protein refers to a protein whole level in a human subject is associated with renal decline, and/or with an increased or a decreased risk of progressing to ESKD. Protective proteins, as used herein, are proteins whose presence or increased level provides apparent protection against progressive renal decline. Examples of protective proteins include FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, Testican-2, and/or DNAJC19.

    [0050] As used herein, the term renal decline or RD (also referred to herein as kidney decline (KD)) refers to a condition associated with impaired kidney function. In one embodiment, renal decline is defined as an estimated Glomerular Filtration Rate (eGFR) change of at least ?3 ml/min/year (i.e., eGFR loss ?3.0 ml/min/year). In one embodiment, renal decline is defined as an estimated Glomerular Filtration Rate (eGFR) change of at least ?5 ml/min/year (i.e., eGFR loss ?5.0 ml/min/year). In one embodiment, renal decline is defined as a ?40% sustained decline in eGFR from baseline (confirmed for at least 3 months).

    [0051] The term therapeutically effective amount or an effective amount refers to an amount which, when administered to a living subject, achieves a desired effect on the living subject. The exact amount will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques. As is known in the art, adjustments for systemic versus localized delivery, age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition may be necessary, and will be ascertainable with routine experimentation by those skilled in the art. For example, an effective amount of an agent described herein for administration to the living subject is an amount that prevents and/or treats ESKD. For example, for a renal protective agent, a therapeutically effective amount can be an amount that has been shown to provide an observable therapeutic benefit compared to baseline clinically observable signs and symptoms of chronic kidney disease.

    [0052] As used herein, the term renal protective agent refers to an agent that can prevent or delay the progression of nephropathy in a subject having moderately increased albuminuria or diabetic nephropathy. Examples of renal protective agents include, but are not limited to, angiotensin-converting enzyme (ACE) inhibitors and angiotensinII receptor blockers (ARBs). In one embodiment, a renal protective agent is a protective protein describe herein, or an equivalent there, e.g., an active fragment.

    II. Protective Proteins

    [0053] The present disclosure is based, at least in part, on the discovery of certain biomarkers whose protein levels can be used to identify subjects/patients who will be progressing to ESKD (also referred to herein as ESRD) and those who will be protected.

    [0054] Disclosed herein is are methods for identifying whether a human subject is at risk of developing progressive renal decline. The methods include detecting the level of at least one protective protein in a sample(s) from a subject in need thereof. Secreted protein acidic and rich in cysteine (SPARC), C-C motif chemokine 5 (CCL5), amyloid beta A4 protein (APP), platelet factor-4 (PF4), DNAJC19, angiopoietin-2 (ANGPT1), tumor necrosis factor ligand superfamily member 12 (TNFSF12), fibroblast growth factor 20 (FGF20), and Testican-2 (SPOCK2) have been identified by the studies herein as protective proteins whose levels correlate with non-progression of kidney disease. These levels are higher than patients who show progressive disease, and have lower levels of these proteins.

    [0055] The level of a protective protein or proteins in a sample or samples from a subject can be compared to the level of the protective protein on proteins with a reference level of the protective protein in order to determine the risk of the patient developing progressive renal decline, and eventually ESKD (also referred to herein as ESRD).

    [0056] Levels of at least one, at least two, at least three, at least four, at least five, at least six, at least seven, or all eight of the protective proteins can be used in the methods disclosed herein.

    [0057] In one embodiment, a level of each of fibroblast growth factor 20 (FGF20), angiopoietin-2 (ANGPT1), and tumor necrosis factor ligand superfamily member 12 (TNFSF12), or a combination thereof, is compared to a reference level in order to determine the risk of the patient for developing or continuing to have progressive renal decline. In one embodiment, a level of Testican-2 is compared to a reference level in order to determine the risk of the patient for developing or continuing to have progressive renal decline. In another embodiment, levels of each of FGF20 and TNFSF12; FGF20 and ANGPT1; TNFSF12 and ANGPT1; and FGF20, TNFSF12, and ANGPT1, FGF20 and Testican-2; ANGPT1 and Testican-2; TNFSF12 and Testican-2; FGF20, ANGPT1, and Testican-2; ANGPT1, TNFSF12 and Testican-2; FGF20, TNFSF12 and Testican-2; or FGF20, ANGPT1, TNFSF12 and Testican-2 are used in the methods disclosed herein.

    [0058] In one embodiment, a level of each of fibroblast growth factor 20 (FGF20); a protective protein from a first group of protective proteins including SPARC, CCL5, APP, PF4 and ANGPT1 (Group 1 protective proteins); a protective protein from a second group of protective proteins including DNAJC19 and TNFSF12 (Group 2 protective proteins), or combinations thereof, e.g., a group 1 and a group 2 protective protein, or FGF20 and either a group 1 or a group 2 protective protein, is compared to a reference level in order to determine the risk of the patient for developing or continuing to have progressive renal decline.

    TABLE-US-00001 A table describing the nine protective proteins identified herein is provided below: Protective Protein Full Name UniProt ID Gene Symbol Tumor necrosis factor ligand superfamily O43508 TNFSF12 member 12 Secreted protein acidic and rich in cysteine P09486 SPARC C-C motif chemokine 5 P13501 CCL5 Amyloid beta A4 protein P05067 APP Platelet factor 4 P02776 PF4 Fibroblast growth factor 20 Q9NP95 FGF20 Angiopoietin-1 Q15389 ANGPTI DnaJ Heat Shock Protein Family Member Q96DA6 DNAJC19 C19 Testican-2 Q92563 SPOCK2

    [0059] Once the protective protein level is detected in a sample from the subject, the level is compared to a reference level in order to determine whether the level coincides with a progressor profile (risk) or a non-progressor (protection).

    [0060] The onset of progressive renal decline begins when patients have normal kidney function and it progresses almost linearly to ESKD, although the rate of decline expressed as the slope of the estimated glomerular filtration rate (eGFR) varies among those individuals ranging from ?72 to 3.0 ml/min/year.

    [0061] In one embodiment, the reference level of a protective protein is a level of a non-diabetic human subject, wherein a lower level of the protective protein in comparison to the reference level indicates that the human subject is at risk of developing progressive renal decline. Alternatively, equivalent or higher level of the protective protein in comparison to the reference level indicates that the human subject is not at risk of developing progressive renal decline.

    [0062] In one embodiment, the human subject who provides the sample for testing is a subject who has a condition associated with progressive renal decline, such as diabetes or high blood pressure. In another embodiment, the subject may have impaired kidney function, where determining the risk of further renal decline would be desirable to mitigate kidney destruction. In one embodiment, the subject has type I diabetes or type II diabetes.

    [0063] For subjects with diabetes, the risk of chronic kidney disease and ESKD remains relatively high despite improvements in glycemic control and advances in reno-protective therapies over the last 20 years for the prevention and treatment of DKD (Rosolowsky et al., J Am Soc Nephrol 22: 545-553 (2011); de Boer et al., JAMA 305: 2532-2539 (2011)). Findings from Joslin Kidney Study, a longitudinal study of more than 3000 subjects with diabetes, demonstrate that progressive renal decline is the major clinical manifestation of DKD that underlies progression to ESKD (Perkins et al., N Engl J Med 348: 2285-2293 (2003); Perkins et al., J Am Soc Nephrol 18: 1353-1361 (2007); Krolewski, Diabetes Care 38, 954-962 (2015); Krolewski et al., Kidney International 91: 1300-1311 (2017)).

    [0064] The incidence of ESKD in diabetes patients continues to increase despite improvements in glycemic control and advances in reno-protective therapies, which are almost universally implemented.

    [0065] Diabetic kidney disease (DKD) and its important clinical manifestation, progressive renal decline that leads to end-stage kidney disease (ESKD; also referred to herein as ESRD), is a major health burden for subjects with diabetes. The disease process that underlies progressive renal decline comprises factors/pathways that increase risk of this outcome as well as factors/pathways that protect against progressive renal decline. Using an untargeted proteomic profiling of circulating proteins from subjects in three independent cohorts with longstanding Type 1 and Type 2 diabetes and varying stages of DKD followed for 7-15 years has identified 3 elevated plasma proteins, fibroblast growth factor 20 (FGF20; OR=0.69; 95% CI: 0.54-0.88), angiopoietin-1 (ANGPT1; OR=0.72; 95% CI: 0.57-0.91) and tumor necrosis factor ligand superfamily member 12 (TNFSF12; OR=0.75; 95% CI: 0.59-0.95), that were associated with protection against progressive renal decline and progression to ESKD. The combined effect of these 3 protective proteins was well demonstrated by very low cumulative risk of ESKD in subjects who had high baseline concentrations (above median) for all 3 proteins, whereas the cumulative risk of ESKD was high in subjects with low concentrations (below median) of these proteins at the beginning of follow-up. This protective effect was manifested strongly and independently from circulating inflammatory proteins and important clinical covariates, and was confirmed in an independent cohort of diabetic subjects with normal kidney function. The three protective proteins may serve as biomarkers to stratify diabetic subjects according to risk of progression to ESKD.

    [0066] In one embodiment, the sample tested from the subject is a plasma sample. Multiple samples may be used in testing one or more protective proteins. Alternatively, one sample can be used to test one or more protective proteins.

    [0067] Detection of the protective proteins can be determined according to standard immunoassays. For example, ELISA or electrochemiluminescence detection (e.g., Meso Sector S600 (Meso Scale Diagnostics)).

    [0068] Also included herein is a protein array for identifying or monitoring progressive renal decline of a human subject. In one embodiment, said protein array comprises antibodies or antigen-binding fragments thereof, specific for human FGF20, human TNFSF12, human ANGPT1, and/or human Testican-2.

    [0069] In another embodiment, the disclosure provides a protein array for identifying or monitoring progressive renal decline of a human subject, said protein array comprising antibodies or antigen-binding fragments thereof, specific for human FGF20, human TNFSF12 and human ANGPT1, human SPARC, human CCL5, human APP, human PF4, human DNAJC19, human Testican-2, or combinations thereof.

    [0070] In one embodiment, an array comprises a plurality of probes for specifically binding a protein biomarker, wherein the protein biomarker is at least one or more of human FGF20, human TNFSF12 and human ANGPT1.

    [0071] In one embodiment, an array comprises a plurality of probes for specifically binding a protein biomarker, wherein the protein biomarker is at least one or more of human FGF20, human TNFSF12, human ANGPT1, human SPARC, human CCL5, human APP, human PF4, human DNAJC19, human Testican-2.

    [0072] The studies described herein identify nine protective proteins (i.e., secreted protein acidic and rich in cysteine (SPARC), C-C motif chemokine 5 (CCL5), amyloid beta A4 protein (APP), platelet factor-4 (PF4), DNAJC19, angiopoietin-2 (ANGPT1), tumor necrosis factor ligand superfamily member 12 (TNFSF12), fibroblast growth factor 20 (FGF20), and Testican-2, that can be used to identify patients, according to levels in a sample, who are likely to develop ESKD or have continued progressive kidney disease leading to ESKD or will be protected against progression to ESKD.

    SPARC

    [0073] A protective protein of the present disclosure is Secreted Protein Acidic and Cysteine Rich (SPARC).

    [0074] The terms Secreted Protein Acidic and Cysteine Rich gene, or SPARC gene, also known as Osteonectin, ONT, Basement-Membrane Protein 40, BM-40 and OI17, refers to the gene that is expressed at high levels in tissues undergoing morphogenesis, remodeling and wound repair. The SPARC gene encodes for a protein called SPARC. SPARC is a 32-35 kD Ca2+-binding matricellular glycoprotein whose modular organization is phylogenetically conserved (Martinek, et al. Dev. Genes Evol. 212: 124-133.) SPARC binds to collagen type I in the extracellular space (Mendozo-Londono, et al. Am J Hum Genet. 2015 Jun. 4; 96(6): 979-985.) Biochemical studies indicate that SPARC binds to several collagenous and non-collagenous ECM molecules, including a Ca2+-dependent interaction with network-forming collagen IV. SPARC protein comprises three domains, a Follistin-like domain, a Kazal like domain and an EF hand domain, and comprises two calcium binding sites. The Follistin like acidic domain binds 5 to 8 Ca.sup.2+ with a low affinity and an EF-hand loop binds a Ca.sup.2+ ion with a high affinity. In bone, SPARC is expressed by osteoblasts. SPARC-null mice develop progressive osteoporosis, due to a defect in bone formation (Delany, et al. J. Clin. Invest. 2000; 105: 915-923).

    [0075] SPARC polymorphisms, particularly the polymorphism in the 3 UTR influences SPARC accumulation in bone, and is associated with variations in bone formation, variations in bone mass, and may play a role in the pathogenesis of osteoporosis in adults (Delany, et al. (2016) Osteoporos. Int. 2008; 19: 969-978; Dole, et al. (2016) J. Bone Miner. Res. 2015; 30:723-732). Homozygous mutations in SPARC can give rise to severe bone fragility in humans (Mendozo-Londono, et al. Am J Hum Genet. 2015 Jun. 4; 96(6): 979-985.)

    [0076] The nucleotide sequence of the genomic region of human chromosome harboring the SPARC gene may be found in, for example, the Genome Reference Consortium Human Build 38 (also referred to as Human Genome build 38 or GRCh38) available at GenBank. The nucleotide sequence of the genomic region of human chromosome 5 harboring the SPARC gene may also be found at, for example, GenBank Accession No. NC_000005.10, corresponding to nucleotides 151,661,096-151,686,975 of human chromosome 5. Three transcript variants encoding different isoforms have been found for this gene. Exemplary nucleotide and amino acid sequences of SPARC can be found, for example, at GenBank Accession No. NM_003118.4 (Homo sapiens SPARC transcript variant 1). Amino acid sequence of human SPARC transcript variant 1 is provided below:

    TABLE-US-00002 (SEQIDNO:1) MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANP VQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCV CQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKL HLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLL TEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQF GQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LDEWAGCFGIKQKDIDKDLVI

    [0077] Further examples of SPARC sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (P09486). Additional information on SPARC can be found, for example, at the NCBI web site that refers to gene 6678. The term SPARC as used herein also refers to variations of the SPARC gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_003118.4.

    CCL5

    [0078] A protective protein of the present disclosure is C-C Motif Chemokine Ligand 5 (CCL5).

    [0079] The terms C-C Motif Chemokine Ligand 5 gene, or CCL5 gene, also known as RANTES, SCYA5, SISd, EoCP and D17S136E, refers to the gene that encodes a CCL5 protein, a chemotactic for T cells, eosinophils, and basophils, that plays an active role in recruiting leukocytes into inflammatory sites. The CCL5 protein is a 8 kD protein with a single domain. CCL5 is a chemoattractant for blood monocytes, memory T-helper cells and eosinophils. CCL5 causes the release of histamine from basophils and activates eosinophils and is known to activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. CCL5 and one of its cognate receptors, CCR5 are best known as one of the major HIV-suppressive factors produced by CD8+ T-cells and recombinant CCL5 protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). CCL5 activates T cells when in high concentration through a tyrosine kinase pathway (Wong et al. J Biol Chem 273:309-314 (1998); Bacon et al. Science 269:1727-1730 (1995)) leads to production of IFN? by T cells (Appay et al. Int Immunol 12:1173-1182 (2000)) and is thought to induce maturation of dendritic cells (Fischer, et al. J Immunol 167:1637-1643 (2001)). High levels of CCL5 protein was demonstrated in synovial CD8+ T cells, from which it is rapidly released on T cell receptor triggering (Pharoah et al. Arthritis Res Ther 8(2): R50 (2006)) CCL5 signals directly on cancer cells to promote survival, invasion, and stem cell renewal. In breast cancer, CCL5 expressed by MSCs act on breast cancer cells to promote invasion and metastasis (Karnoub et al. Nature 449(7162):557-63 (2007)).

    [0080] The nucleotide sequence of the genomic region of human chromosome harboring the CCL5 gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. CCL5 gene is one of several chemokine genes clustered on the q-arm of chromosome 17. The nucleotide sequence of the genomic region of human chromosome 17 harboring the CCL5 gene may also be found at, for example, GenBank Accession No. NC_000017.11, corresponding to nucleotides 35871491-35880360 of human chromosome 17. Four transcript variants encoding different isoforms have been found for this gene. Exemplary nucleotide and amino acid sequences of CCL5 can be found, for example, at GenBank Accession No. NM_002985.3 (Homo sapiens CCL5 transcript variant 1). Amino acid sequence of human CCL5 transcript variant 1 is provided below:

    TABLE-US-00003 (SEQIDNO:2) MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHI KEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

    [0081] Further examples of CCL5 sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (P13501). Additional information on CCL5 can be found, for example, at the NCBI web site that refers to gene 6352. The term CCL5 as used herein also refers to variations of the CCL5 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_002985.3.

    APP

    [0082] Another protective protein of the present disclosure is Amyloid Beta Precursor Protein (APP).

    [0083] The terms Amyloid Beta Precursor Protein gene, or APP gene, also known as ABPP, A4, AD1, Peptidase Nexin-II and PreA4, refers to the gene that encodes a Amyloid Beta A4 protein. APP is a type I transmembrane protein with a short cytoplasmic tail and a large ectodomain, including copper-binding sites in its E1 and E2 domains (Kong et al. Eur Biophys J 37(3):269-79 (2008); Dahms et al. J Mol Biol 416(3):438-52 (2012)). APP protein plays a central role in Alzheimer's pathogenesis (Masters et al. Brain 129(Pt 11):2823-39 (2006)). APP is also essential in synaptic processes, including trans-cellular synaptic adhesion as a cell surface receptor, neurite growth, neuronal adhesion, axonogenesis, synaptogenesis, promotion of cell mobility and transcription regulation through protein-protein interactions (M?ller et al. Cold Spring Harb Perspect Med 2(2):a006288 (2012)). App is implicated in copper homeostasis/oxidative stress through copper ion reduction. In vitro, copper-metallated APP induces neuronal death directly or is potentiated through Cu.sup.2+-mediated low-density lipoprotein oxidation (White et al. J Neurosci 19(21):9170-9 (1999); Maynard et al. J Biol Chem 277(47):44670-6 (2002)). APP knock-out mice show cognitive deficits, and inactivation of APP on the APLP2 knock-out background in either the presynaptic or postsynaptic compartment caused defects in the neuromuscular synapse (M?ller et al. Cold Spring Harb Perspect Med 2(2):a006288(2012)).

    [0084] The nucleotide sequence of the genomic region of human chromosome harboring the APP gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 21 harboring the APP gene may also be found at, for example, GenBank Accession No. NC_000021.9, corresponding to nucleotides 25880550-26171128 of human chromosome 21. Multiple transcript variants encoding different isoforms have been found for this gene. Exemplary nucleotide and amino acid sequences of APP can be found, for example, at GenBank Accession No. NM_000484.4 (Homo sapiens APP transcript variant 1). Amino acid sequence of human APP transcript variant 1 is provided below:

    TABLE-US-00004 (SEQIDNO:3) MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNV QNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTI QNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERM DVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCP LAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVA EVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTES VEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRN NFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVD KYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNL PKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRR LALENYITALQAVPPRPRHVENMLKKYVRAEQKDRQHTLKHFEHVRM VDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDE LLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNG EFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGL TNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL MVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKM QQNGYENPTYKFFEQMQN

    [0085] Further examples of APP sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (P05067). Additional information on APP can be found, for example, at the NCBI web site that refers to gene 351. The term APP as used herein also refers to variations of the APP gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_000484.4.

    PF4

    [0086] A protective protein of the present disclosure is platelet factor-4 (PF4).

    [0087] The terms platelet factor-4 gene, or PF4 gene, also known as CXCL4, Chemokine (C-X-C Motif) Ligand 4, Oncostatin-A, SCYB4 and Iroplact, refers to the gene that encodes a PF4 protein. PF4 is a chemokine primarily released from the alpha granules of activated platelets in the form of a homo-tetramer which has high affinity for heparin and is involved in platelet aggregation. PF4 is known to be secreted by a variety of immune cells (Levine et al. J Biol Chem 251(2):324-8 (1976); Bon et al. N Engl J Med 370(5):433-43 (2014)). PF4 is chemotactic for numerous other cell types and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum. PF4 has also been implicated in the pathology of a variety of inflammatory diseases including myelodysplastic syndromes, malaria, HIV-1, atherosclerosis, inflammatory bowel disease, and rheumatoid arthritis (Affandi et al. Eur J Immunol 48(3):522-531 (2018); Yeo et al. Ann Rheum Dis 75(4):763-71 (2016)).

    [0088] The nucleotide sequence of the genomic region of human chromosome harboring the APP gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 4 harboring the PF4 gene may also be found at, for example, GenBank Accession No. NC_000004.12, corresponding to nucleotides 73,980,811-73,982,027 of human chromosome 4. This gene has one identified transcript. Exemplary nucleotide and amino acid sequences of PF4 can be found, for example, at GenBank Accession No. NM_002619.4 (Homo sapiens PF4 transcript variant 1). Amino acid sequence of human PF4 transcript variant 1 is provided below:

    TABLE-US-00005 (SEQIDNO:4) MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTT SQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKI IKKLLES

    [0089] Further examples of PF4 sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (P02776). Additional information on PF4 can be found, for example, at the NCBI web site that refers to gene 5196. The term PF4 as used herein also refers to variations of the PF4 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_002619.4.

    DNAJC19

    [0090] A protective protein of the present disclosure is DnaJ Heat Shock Protein Family (Hsp40) Member C19 (DNAJC19).

    [0091] The terms DnaJ Heat Shock Protein Family (Hsp40) Member C19 gene, or DNAJC19 gene, also known as TIMM14, TIM14, PAM18, and Mitochondrial Import Inner Membrane Translocase Subunit TIM14, refers to the gene that encodes a DNAJC19 protein. The DNAJC19 protein is a 6.29 kDa protein composed of 59 amino acids possessing an unusual structure compared to the rest of the DNAJ protein family. The DNAJ domain of DNAJC19 is located at the C-terminal rather than the N-terminal, and the transmembrane domain confers membrane-bound localization for DNAJC19 while other DNAJ proteins are cytosolic (Zong et al. Circulation Research 113 (9): 1043-53). DNAJC19 is required for the ATP-dependent import of mitochondrial pre-proteins into the mitochondrial matrix. The J-domain of DNAJC19 stimulates mtHsp70 ATPase activity to power this transport (Mokranjac et al. EMBO J 22 (19): 4945-56). Defects in DNAJC19 have been associated with dilated cardiomyopathy with ataxia (DCMA), growth failure, microcytic anemia, and male genital anomalies. DNAJC19 was first implicated in DCMA in a study on the consanguineous Hutterite population, which has since been confirmed in other European populations (Ojala et al. Pediatric Research 72 (4): 432-7). In the clinic, DNAJC19 mutations were detected by screening for elevated levels of 3-methylglutaconic acid, mitochondrial distress, dilated cardiomyopathy, prolongation of the QT interval in the electrocardiogram, and cerebellar ataxia (Ojala et al. Pediatric Research 72 (4): 432-7; Koutras et al. Frontiers in Cellular Neuroscience 8: 191).

    [0092] The nucleotide sequence of the genomic region of human chromosome harboring the DNAJC19 gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 3 harboring the DNAJC19 gene may also be found at, for example, GenBank Accession No. NC_000003.12, corresponding to nucleotides 180983709-180989838 of human chromosome 3. Exemplary nucleotide and amino acid sequences of DNAJC19 can be found, for example, at GenBank Accession No. NM_145261.4 (Homo sapiens DnaJ heat shock protein family (Hsp40) member C19 (DNAJC19) transcript variant 1). Amino acid sequence of human DNAJC19 is provided below:

    TABLE-US-00006 (SEQIDNO:5) MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSG GYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKG GSPYIAAKINEAKDLLEGQAKK

    [0093] Further examples of DNAJC19 sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (Q96DA6). Additional information on DNAJC19 can be found, for example, at the NCBI web site that refers to gene 131118. The term DNAJC19 as used herein also refers to variations of the DNAJC19 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_145261.4.

    ANGPT1

    [0094] A protective protein of the present disclosure is Angiopoietin 1 (ANGPT1).

    [0095] The terms Angiopoietin 1 gene, or ANGPT1 gene, also known as KIAA0003, ANG-1, AGP1, and AGPT, refers to the gene that encodes a ANGPT1 protein. ANGPT1 is a secreted 70-kDa glycoprotein and a member of the angiopoietin family of growth factors. ANGPT1 is the major agonist for the tyrosine kinase receptor, Tek, which is found primarily on endothelial cells. ANGPT1 is produced by vasculature support cells and specialized pericytes such as podocytes in the kidney and ITO cells in the liver (Satchell et al. J Am Soc Nephrol 13(2):544-550 (2002)). ANGPT1 plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, and maintenance of vascular quiescence (Jeansson et al. J Clin Invest 121(6): 2278-2289 (2011)). The ANGPT1/Tek pathway is critical for normal development, as conventional ANGPT1 or Tek knockout mice exhibit lethality between E9.5 and E12.5, with similar abnormal vascular phenotypes and loss of heart trabeculations (Suri et al. Cell 87(7):1171-80 (1996); Tachibana et al. Mol Cell Biol 25(11):4693-702 (2005)).

    [0096] The nucleotide sequence of the genomic region of human chromosome harboring the ANGPT1 gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 8 harboring the ANGPT1 gene may also be found at, for example, GenBank Accession No. NC_000008.11, corresponding to nucleotides 107249482-107497918 of human chromosome 8. Exemplary nucleotide and amino acid sequences of ANGPT1 can be found, for example, at GenBank Accession No. NM_001146.5 (Homo sapiens angiopoietin 1 (ANGPT1), transcript variant 1). Amino acid sequence of human ANGPT1 is provided below:

    TABLE-US-00007 (SEQIDNO:6) MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFIL PEHDGNCRESTTDQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYT QWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQ TRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIH EKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEK QLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKP FRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQH REDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIE LMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGA DFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGK LNGIKWHYFKGPSYSLRSTTMMIRPLDF

    [0097] Further examples of ANGPT1 sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (Q15389). Additional information on ANGPT1 can be found, for example, at the NCBI web site that refers to gene 284. The term ANGPT1 as used herein also refers to variations of the ANGPT1 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_001146.5.

    TNFSF12

    [0098] A protective protein of the present disclosure is Tumor Necrosis Factor Superfamily Member 12 (TNFSF12).

    [0099] The terms Tumor Necrosis Factor Superfamily Member 12 gene, or TNFSF12 gene, also known as APO3L, DR3LG, TWEAK, and TNLG4A, refers to the gene that encodes a TNFSF12 protein. TNFSF12 is a member of the tumor necrosis factor (TNF) family of proteins that play pivotal roles in the regulation of the immune system. TNFSF12 is expressed widely in many tissues and induces interleukin-8 synthesis in a number of cell lines (Chicheportiche et al. Cell Biology and Metabolism 272(51): 32401-32410 (1997)). The human adenocarcinoma cell line, HT29, underwent apoptosis in the presence of both TNFSF12 and interferon-7. Leukocytes are the main source of TNFSF12 including human resting and activated monocytes, dendritic cells and natural killer cells (Maecker et al. Cell 123(5): 931-44). TNFSF12 suppresses production of IFN-? and IL-12, curtailing the innate response and its transition to adaptive TH1 immunity. TNFSF12 also promotes proliferation and migration of endothelial cells, acting as a regulator of angiogenesis.

    [0100] The nucleotide sequence of the genomic region of human chromosome harboring the TNFSF12 gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 17 harboring the TNFSF12 gene may also be found at, for example, GenBank Accession No. NC_000017.11, corresponding to nucleotides 7549058-7557881 of human chromosome 17. Exemplary nucleotide and amino acid sequences of TNFSF12 can be found, for example, at GenBank Accession No. NM_003809.3 (Homo sapiens TNF superfamily member 12 (TNFSF12), transcript variant 1). Amino acid sequence of human TNFSF12 is provided below:

    TABLE-US-00008 (SEQIDNO:7) MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSR ASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRS APKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSS SPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLA LRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLK AAPFLTYFGLFQVH

    [0101] Further examples of TNFSF12 sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (043508). Additional information on TNFSF12 can be found, for example, at the NCBI web site that refers to gene 8742. The term TNFSF12 as used herein also refers to variations of the TNFSF12 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_003809.3.

    FGF20

    [0102] Another protective protein of the present disclosure is Fibroblast Growth Factor 20 (FGF20).

    [0103] The terms Fibroblast Growth Factor 20 gene, or FGF20 gene, also known as RHDA2, refers to the gene that encodes a FGF20 protein. FGF20 is primarily expressed in normal brain, particularly the cerebellum. The rat homolog is preferentially expressed in the brain and able to enhance the survival of midbrain dopaminergic neurons in vitro. FGF20 is a member of the of the fibroblast growth factor (FGF) family that possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including cell growth, morphogenesis, tissue repair, tumor growth, invasion and embryonic development (Koga et al. Biochemical and Biophysical Research Communications 261(3): 756-65). Gene polymorphisms of FGF20 has been implicated in Parkinson's disease (Zhao et al. Neurol Sci 37(7):1119-26 (2016); Zhu et al. Neurol Sci 35(12) (2014)).

    [0104] The nucleotide sequence of the genomic region of human chromosome harboring the FGF20 gene may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 8 harboring the FGF20 gene may also be found at, for example, GenBank Accession No. NC_000008.11, corresponding to nucleotides 16992181-17002345 of human chromosome 8. Exemplary nucleotide and amino acid sequences of FGF20 can be found, for example, at GenBank Accession No. NM_019851.3 (Homo sapiens fibroblast growth factor 20 (FGF20)). Amino acid sequence of human FGF20 is provided below:

    TABLE-US-00009 (SEQIDNO:8) MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERS ARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSL FGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFRE QFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFT HFLPRPVDPERVPELYKDLLMYT

    [0105] Further examples of FGF20 sequences can be found in publicly available databases, for example, GenBank, OMIM, and UniProt (Q9NP95). Additional information on FGF20 can be found, for example, at the NCBI web site that refers to gene 26281. The term FGF20 as used herein also refers to variations of the FGF20 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_019851.3.

    Testican-2

    [0106] Another protective protein that can be used as a marker in the methods and compositions described herein is Testican-2.

    [0107] Human Testican-2 protein is encoded by the SPOCK2 gene, also known as TICN2 or KIAA0275. Testican-2 binds with glycosaminoglycans to form part of the extracellular matrix. The protein contains thyroglobulin type-1, follistatin-like, and calcium-binding domains, and has glycosaminoglycan attachment sites in the acidic C-terminal region. SPOCK (SPARC/osteonectin CWCV and Kazal-like domains) encodes a secreted proteoglycan with three known homologs, SPOCK1, -2, and -3. SPOCK was initially characterized as a progenitor form of a seminal plasma GAG-bearing peptide and was later cloned and identified as a chondroitin/heparan sulfate proteoglycan (HSPG). The SPOCK1 and -2 proteoglycans inhibit neuronal cell attachment and neurite extension. Moreover, polymorphism in SPOCK2 was recently identified as a genetic trait linked to susceptibility to bronchopulmonary dysplasia, a chronic respiratory disease common among premature infants (Hadchouel et al., Am J Respir Crit Care Med., 2011, 184(10):1164-70), and functions as a protective barrier against virus infection of lung epithelial cells (Ahn et al., J Virol., 2019, 93(20): e00662-19).

    [0108] The nucleotide sequence of the genomic region of human chromosome harboring the Testican-2 gene (SPOCK2) may be found in, for example, the Genome Reference Consortium Human Build 38 available at GenBank. The nucleotide sequence of the genomic region of human chromosome 10 harboring the Testican-2 gene may also be found at, for example, GenBank Accession No. NC_000010.11, corresponding to nucleotides 72059034-72095313 of human chromosome 10. Exemplary nucleotide and amino acid sequences of Testican-2 can be found, for example, at GenBank Accession No. NM_001244950.2 (Homo sapiens SPARC/osteonectin, cwcv and kazal like domains proteoglycan 2 (SPOCK2), transcript variant 3). Amino acid sequence of human Testican-2 (isoform 2 precursor) is provided below:

    TABLE-US-00010 (SEQIDNO:11) MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSS ISQYSGKIKHWNRFRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVK CSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCHM AQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQAA TSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPA SGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCI RPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERIQIQEAAKKK PGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHGSPDC DDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDGGYI W

    [0109] Testican-2 sequences can also be found in publicly available databases, for example, GenBank, OMIM, and UniProt (Q92563). Additional information on Testican-2 (SPOCK2) can be found, for example, at the NCBI web site that refers to gene 9806. The term Testican-2 as used herein also refers to variations of the SPOCK2 gene including variants provided in the clinical variant database, for example, at the NCBI clinical variants web site that refers to the term NM_001244950.2.

    [0110] The entire contents of each of the foregoing GenBank Accession numbers and the Gene database numbers are incorporated herein by reference as of the date of filing this application.

    III. Methods and Compositions for Determining Risk of RD and ESRD Based on Protective Proteins

    [0111] The instant disclosure is based, at least in part, on the discovery that levels of certain protective proteins can be used to identify a human subject who is at risk of progressive kidney disease or progressing to end-stage kidney disease. The low level of a protective protein identified herein, relative to a person who does not have progressive kidney failure, indicates who will be protected from progressing to end-stage kidney disease and who will not. Another embodiment described herein is the treatment of a human patient identified as being at risk for ESKD, where, e.g., administration of the protective protein, or a combination thereof, decreases the risk of the patient from progressive kidney disease.

    [0112] Examples of protective proteins that may be used in the methods and compositions as described herein are provided herein. As described herein, the term protective proteins is intended to include the protective proteins, as well as functional fragments thereof. A functional fragment would retain, for example, the ability ascribed to corresponding full length (or non-fragment) equivalent.

    [0113] The expression level of one or more protective proteins may be determined in a biological sample derived from a subject. A sample derived from a subject is one that originates and is obtained from a subject. Such a sample may be further processed after it is obtained from the subject. For example, protein may be isolated from a sample. In one embodiment, the protein isolated from the sample is also a sample derived from a subject. A biological sample useful for determining the level of one or more protective protein may be obtained from essentially any source, as protein expression has been reported in cells, tissues, and fluids throughout the body. However, in one aspect of the disclosure, levels of one or more protective proteins indicative of a subject having renal decline and/or ESKD, or a risk of having renal decline and/or developing ESKD, may be detected in a sample obtained from a subject non-invasively.

    [0114] In certain embodiments, the biological sample used for determining the level of one or more protective proteins is a sample containing circulating protein biomarkers. Extracellular protein biomarkers freely circulate in a wide range of biological material, including bodily fluids, such as fluids from the circulatory system, e.g., a blood sample or a lymph sample, or from another bodily fluid such as cerebrospinal fluid (CSF), urine or saliva. Accordingly, in some embodiments, the biological sample used for determining the level of one or more protective proteins is a bodily fluid, for example, blood, fractions thereof, serum, plasma, urine, saliva, tears, sweat, semen, vaginal secretions, lymph, bronchial secretions, CSF, etc. In some embodiments, the sample is a sample that is obtained non-invasively. In one particular embodiment, the sample is a urine sample. In another embodiment, the sample is a plasma sample. In another embodiment, the sample is a serum sample.

    [0115] In some embodiments, the biological sample used for determining the level of one or more protective proteins may contain cells. In other embodiments, the biological sample may be free or substantially free of cells (e.g., a serum sample). In some embodiments, a sample containing circulating protein biomarkers, is a blood-derived sample. Exemplary blood-derived sample types include, e.g., a blood sample, a plasma sample, a serum sample, etc. In other embodiments, a sample containing circulating protein biomarkers is a lymph sample. Circulating protein biomarkers are also found in urine and saliva, and biological samples derived from these sources are likewise suitable for determining the level of one or more protective proteins.

    Compositions for Determining Protective Protein Levels

    [0116] Also disclosed herein are arrays (e.g., protein arrays) or compositions comprising antibodies, or antigen-binding fragments thereof, specific for any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and Testican-2, for performing the methods described herein. Such arrays may include a support or a substrate for attaching any one or more of the antibodies, or antigen-binding fragments thereof, specific for any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and Testican-2. Such supports and substrates are known in the art and include covalent and noncovalent interactions. For example, diffusion of applied proteins (e.g., antibodies, or antigen-binding fragments thereof) into a porous surface such a hydrogel allows noncovalent binding of unmodified protein within hydrogel structures. Covalent coupling methods provide a stable linkage and may be applied to a range of proteins. Biological capture methods utilizing a tag (e.g., hexahistidine (SEQ ID NO: 10)/Ni-NTA or biotin/avidin) on a protein (e.g., a biomarker) and a partner reagent immobilized on the surface of the substrate provide a stable linkage and bind the protein (e.g., a biomarker) specifically and in reproducible orientation.

    [0117] In one embodiment, the antibodies, or antigen-binding fragments thereof, specific for any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and Testican-2 described herein are coated or spotted onto the support or substrate such as chemically derivatized glass, or a glass plate coated with a protein binding agent such as, but not limited to, nitrocellulose.

    [0118] In another embodiment the antibodies, or antigen-binding fragments thereof, specific for any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and Testican-2 are provided in the form of an array, such as a microarray. Protein microarrays are known in the art and reviewed for example by Hall et al. (2007) Mech Ageing Dev 128:161-167 and Stoevesandt et al (2009) Expert Rev Proteomics 6:145-157, the disclosures of which are incorporated herein by reference. Microarrays may be prepared by immobilizing purified antigens on a substrate such as a treated microscope slide using a contact spotter or a non-contact microarrayer. Microarrays may also be produced through in situ cell-free synthesis directly from corresponding DNA arrays. A microarray may be included in test panels for performing methods disclosed herein. The production of the microarrays is in certain circumstances performed with commercially available printing buffers designed to maintain the three-dimensional shape of the antigens. In one embodiment, the substrate for the microarray is a nitrocellulose-coated glass slide.

    [0119] The assays are performed by methods known in the art in which the one or more antibodies, or antigen-binding fragments thereof, specific for any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and Testican-2 are contacted with a biological sample under conditions that allow the formation of an immunocomplex of an antibody and any one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and Testican-2 for detecting the immunocomplex. The presence and amount of the immunocomplex may be detected by methods known in the art, including label-based and label-free detection. For example, label-based detection methods include addition of a secondary antibody that is coupled to an indicator reagent comprising a signal generating compound. The secondary antibody may be an anti-human IgG antibody. Indicator reagents include chromogenic agents, catalysts such as enzyme conjugates, fluorescent compounds such as fluorescein and rhodamine, chemiluminescent compounds such as dioxetanes, acridiniums, phenanthridiniums, ruthenium, and luminol, radioactive elements, direct visual labels, as well as cofactors, inhibitors and magnetic particles. Examples of enzyme conjugates include alkaline phosphatase, horseradish peroxidase and beta-galactosidase. Methods of label-free detection include surface plasmon resonance, carbon nanotubes and nanowires, and interferometry. Label-based and label-free detection methods are known in the art and disclosed, for example, by Hall et al. (2007) and by Ray et al. (2010) Proteomics 10:731-748. Detection may be accomplished by scanning methods known in the art and appropriate for the label used, and associated analytical software.

    [0120] As described herein, protective proteins indicative of renal decline and/or ESKD and/or protective proteins indicative of an increased risk of renal decline and/or an increased risk of progression to ESKD are disclosed. It is thus contemplated that protective proteins levels can be assayed from a sample from a subject, such as a test subject (e.g., a subject who is suspected of having renal decline and/or ESKD, or a subject who is at increased risk of having renal decline and/or ESKD) in order to determine whether the test subject has renal decline and/or ESKD, or whether the test subject is at an increased risk of renal decline and/or an increased risk of progression to ESKD. In certain embodiments, protective proteins were identified by comparing the levels of certain proteins (e.g., circulating proteins) in, for example, samples from subjects who developed renal decline and/or ESKD, or in samples from subjects with diabetes (T1D, T2D) who were at risk for renal decline and rapid progression to ESKD, and compared to levels of certain proteins (e.g., circulating proteins) in, for example, samples from subjects who did not develop renal decline and/or ESKD, or in samples from subjects with diabetes (T1D, T2D) who were determined to have stable kidney function (i.e., were non-progressors), or in samples from healthy control subjects, or in samples of a standard control level or reference level. In other embodiments, protective proteins were identified by comparing the levels of certain proteins (e.g., circulating proteins) in, for example, samples from subjects who developed renal decline and/or ESKD, or in samples from subjects with diabetes (T1D, T2D) who were at risk for renal decline and rapid progression to ESKD, and compared to known baseline concentration of proteins (e.g., circulating proteins or plasma proteins), known or measured, for example, by a proteomics platform (e.g., SOMAscan platform, and/or OLINK platform). A number of differentially present protein biomarkers were identified in this manner, and were determined to be indicative of a subject having renal decline and/or ESKD, at indicative of an increased risk of renal decline and/or progression to ESKD, which include, but are not limited to, FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and/or Testican-2.

    [0121] The protective proteins identified herein can be used to determine whether a subject, for example a subject with T1D or T2D, has or is at risk of developing renal decline and/or ESKD, and whose risk of developing renal decline and/or ESKD was previously unknown. This may be accomplished by determining the level of one or more of FGF20, TNFSF12, ANGPT1, SPARC, CCL5, APP, PF4, DNAJC19, and/or Testican-2, or combinations thereof, in a biological sample derived from the subject. A difference in the level of one or more of these protective proteins as compared to that in a biological sample derived from a normal subject (i.e., a subject known to not have renal decline and/or ESKD; or a normoalbuminuric control level, or a healthy control level, or a standard control level) may be predictive regarding whether the subject has a risk of developing renal decline and/or ESKD.

    [0122] The level of one or more protective proteins in a biological sample may be determined by any suitable method. Any reliable method for measuring or detecting the level or amount of protein in a sample may be used. Accordingly, practicing the methods disclosed herein may utilize routine techniques in the field of molecular biology. Basic texts disclosing the general methods of use in this disclosure include Sambrook and Russell, Molecular Cloning, A Laboratory Manual (3rd ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994)).

    [0123] The present disclosure relates to a method (e.g., in vitro method) of measuring or detecting the amount of certain protein levels found in a cell, tissue, or sample (e.g., a plasma sample or a serum sample) of a subject, as a means to detect the presence, to assess the risk of developing, diagnosing, prognosing, and/or monitoring the progression of and/or monitoring the efficacy of a treatment for renal decline and/or ESKD. Thus, in certain embodiments, the first steps of practicing the methods of this disclosure (e.g., in vitro methods of using certain identified biomarkers for diagnosis, prognosis, and/or monitoring of renal decline and/or ESKD) are to obtain a cell, tissue or sample (e.g. a urine sample or a plasma sample or a serum sample) from a test subject and extract protein from the sample.

    [0124] Samples may be prepared according to methods known in the art. Cell, tissue or blood samples (e.g., a plasma sample or a serum sample) from a subject is suitable for the present disclosure and may be obtained using well-known methods and as described herein. In certain embodiments of the disclosure, a plasma sample is a preferred sample type. In other embodiments of the disclosure, a serum sample is a preferred sample type.

    [0125] In some embodiments, a biological sample (e.g., a cell, a tissue, a plasma sample or a serum sample) is obtained from a subject to be tested or monitored for renal decline and/or ESKD as described herein. Biological samples of the same type should be taken from both a test subject (e.g., a subject suspected to have renal decline and/or ESKD and/or a subject at a risk of developing renal decline and/or ESKD) and a control subject (e.g., a subject not suffering from renal decline and/or ESKD; e.g., a sample from a normoalbuminuric control subject, or from a healthy control subject, or of a known/standard control level)). Collection of a biological sample from a subject, such as a test subject, may be performed in accordance with the standard protocol hospitals or clinics generally follow. An appropriate amount of biological sample (e.g., a cell, a tissue or plasma sample) is collected and may be stored according to standard procedures prior to further preparation.

    [0126] The analysis of certain protective proteins, as described herein, found in a biological sample of a subject (e.g., test subject) according to the method disclosed herein may be performed in certain embodiments, using, e.g., a cell, a tissue, a urine sample, a plasma sample or a serum sample. The methods for preparing biological samples for protein extraction are well known among those of skill in the art. For example, a cell population or a tissue sample of a subject (e.g., test subject) should be first treated to disrupt cellular membrane so as to release protein contained within the cells.

    [0127] For the purpose of detecting the presence of certain protective proteins disclosed herein or assessing whether a test subject has or is at risk of developing renal decline and/or ESKD, a biological sample may be collected from the subject and the level of certain protective proteins disclosed herein may be measured and then compared to the normal level of these same certain protective proteins (e.g., compared to the level of the certain protective proteins disclosed herein in same type of biological sample in the subject before the onset of renal decline and/or ESKD, and/or compared to the level of the certain protective proteins disclosed herein in same type of biological sample from a healthy control subject (e.g., a subject who does not have T1D or T2D), and/or compared to a known control standard of baseline levels of the certain protective proteins disclosed herein). If a level of one or more certain protective proteins disclosed herein is statistically significantly lower when compared to the normal level of the one or more certain protective proteins disclosed herein, the test subject is deemed to have renal decline and/or ESKD or have an increased risk of developing renal decline and/or ESKD. For the purpose of monitoring disease progression or assessing therapeutic effectiveness in renal decline and/or ESKD patients, a biological sample from a test subject may be taken at different time points, such that the level of the certain protective proteins disclosed herein can be measured over time (i.e., serial testing) to provide information indicating the state of disease. For instance, when the level of the certain protective proteins disclosed herein from a test subject shows a general trend of increasing or stabilizing to a normal level over time, the test subject is deemed to be improving or stabilizing in the severity of renal decline and/or ESRD or the therapy the patient has been receiving is deemed effective. A lack of an increase or stabilization in the level of the certain protective proteins disclosed herein from a test subject or a continuing trend of decreasing levels of the certain protective proteins disclosed herein from a test subject would indicate a worsening of the condition and ineffectiveness of the therapy given to the patient. Generally, a comparatively lower level of the certain protective proteins disclosed herein seen in a test subject indicates that the test subject has renal decline and/or ESKD and/or that the test subject's renal decline and/or ESKD condition is worsening or that renal decline and/or ESKD is progressing.

    [0128] A protein of any particular identity, such as a protective protein(s) as disclosed herein, can be detected using a variety of immunological assays. In some embodiments, a sandwich assay can be performed by capturing the protective protein(s) from a test sample with an antibody (or antibodies) having specific binding affinity for the protective protein(s). The protective protein(s) can subsequently be detected using, e.g., a labeled antibody having specific binding affinity for the protective protein(s). One common method of detection is the use of autoradiography by using a radiolabeled detection agent (e.g., a radiolabeled anti-protective protein specific antibody) that is labeled with radioisotopes (e.g., .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P, .sup.99mTc, or the like). The choice of radioactive isotope depends on research preferences due to ease of synthesis, stability, and half-lives of the selected isotopes. Other labels that can be used for labeling of detection agents (e.g., for labeling of anti-biomarker specific antibody) include compounds (e.g., biotin and digoxigenin), which bind to anti-ligands or antibodies labeled with fluorophores, chemiluminescent agents, fluorophores, and enzymes (e.g., HRP). Such immunological assays can be carried out using microfluidic devices such as microarray protein chips. A protein of interest (e.g., a protective protein(s) as disclosed herein) can also be detected by gel electrophoresis (such as 2-dimensional gel electrophoresis) and western blot analysis using specific antibodies (e.g., anti-protective proteins specific antibodies). In some embodiments, standard ELISA techniques can be used to detect a given protein (e.g., a protective protein as disclosed herein), using an appropriate antibody (or antibodies), e.g., an anti-protective protein specific antibody. In other embodiments, standard western blot analysis techniques can be used to detect a given protein (e.g., a protective protein as disclosed herein), using the appropriate antibodies. Alternatively, standard immunohistochemical (IHC) techniques can be used to detect a given protective protein, using an appropriate antibody (or antibodies), e.g., an anti-protective protein specific antibody. Both monoclonal and polyclonal antibodies (including an antibody fragment with desired binding specificity) can be used for specific detection of the protective protein(s). Such antibodies and their binding fragments with specific binding affinity to a particular protein (e.g., a protective protein(s) as disclosed herein) can be generated by known techniques.

    [0129] In some embodiments, a protective protein as disclosed herein can be detected (e.g., can be detected in a detection assay) with an antibody that binds to the protective protein, such as an anti-protective protein specific antibody, or an antigen-binding fragment thereof. In certain embodiments, an anti-protective protein specific antibody is used as a detection agent, such as a detection antibody that binds to a protective protein(s) as disclosed herein and detects the protective protein(s) (e.g., from a biological sample), such as detects the protective protein(s) in a detection assay (e.g., in western blot analysis, immunohistochemistry analysis, autoradiography analysis, and/or ELISA). In certain embodiments, an anti-protective protein specific antibody is used as a capture agent that binds to the protective protein and detects the protective protein (e.g., from a biological sample), such as detects the protective protein in a detection assay (e.g., in western blot analysis, immunohistochemistry analysis, autoradiography analysis, and/or ELISA). In some embodiments, an anti-protective protein specific antibody, or an antigen-binding fragment thereof is labeled for ease of detection. In some embodiments, anti-protective protein specific antibody, or an antigen-binding fragment thereof, is radiolabeled (e.g., labeled with a radioisotope, such as labeled with .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P, .sup.99mTc, or the like), enzymatically labelled (e.g., labeled with an enzyme, such as with horseradish peroxidase (HRP)), fluorescent labeled (e.g., labeled with a fluorophore), labeled with a chemiluminescent agent and/or labeled with a compound (e.g., with biotin and digoxigenin).

    [0130] Other methods may also be employed for measuring or detecting the level of protective proteins as disclosed herein in practicing the present disclosure. For instance, a variety of methods have been developed based on the mass spectrometry technology to rapidly and accurately quantify target proteins even in a large number of samples. These methods involve highly sophisticated equipment such as the triple quadrupole (triple Q) instrument using the multiple reaction monitoring (MRM) technique, matrix assisted laser desorption/ionization time-of-flight tandem mass spectrometer (MALDI TOF/TOF), an ion trap instrument using selective ion monitoring SIM) mode, and the electrospray ionization (ESI) based QTOP mass spectrometer. See, e.g., Pan et al., J Proteome Res 2009 February; 8(2):787-797.

    [0131] In other embodiments, the expression of a protective protein as disclosed herein is evaluated by assessing the protective protein as disclosed herein. In some embodiments, an anti-protective protein specific antibody, or fragment thereof, can be used to assess the protective protein. Such methods may involve using IHC, western blot analyses, ELISA, immunoprecipitation, autoradiography, or an antibody array. In particular embodiments, the protective protein is assessed using IHC. The use of IHC may allow for quantitation and characterization of the protective protein. IHC may also allow an immunoreactive score for the sample in which the expression of the protective protein is to be determined. The term immunoreactive score (IRS) refers to a number that is calculated based on a scale reflecting the percentage of positive cells (on a scale of 1-4, where 0=0%, 1=<10%, 2=10%-50%, 3=50%-80%, and 4=>80%) multiplied by the intensity of staining (on a scale of 1-3, where 1=weak, 2=moderate, and 3=strong). IRS may range from 0-12.

    [0132] In certain other embodiments, the SOMAscanAptamer-based proteomic platform may be used to determine levels of the protective proteins as disclosed herein. This platform technology is based on the recognition that unique single-stranded sequences of DNA and RNA, referred to as aptamers, are capable of recognizing folded protein epitopes with high affinity and specificity. This property was further advanced with the use of the SOMAscan platform to assay concentrations of proteins (uses one aptamer per protein). This platform features high throughput capabilities (over 1000 proteins in one sample), with reproducibility and sensitivity.

    [0133] In certain other embodiments, the OLINK-Proximity Extension Assay based proteomic platform may be used to determine levels of the protective protein(s) as disclosed herein. The OLINK Proximity Extension Assay is a molecular technique that merges an antibody-based immunoassay with the powerful properties of PCR and quantitative real-time PCR (qPCR), resulting in a multi-plexable and highly specific method (e.g., uses two antibodies per protein) numerous protective proteins can be quantified simultaneously using only 1 ?L of plasma/serum. These assays were thoroughly validated and grouped as panels designed to focus on specific diseases or biological processes and were optimized for the expected dynamic range of the target protein concentrations in clinical samples.

    [0134] As described herein, the estimated Glomerular Filtration Rate (eGFR) refers to a means for estimating kidney function. In some embodiments, the method described herein comprises measuring an estimated glomerular function rate (eGFR) slope of the human subject and determining whether the eGFR slope of the human subject indicates that the human subject has or is at risk of developing renal decline. In some embodiments, eGFR is determined based on a measurement of serum creatinine levels. In other embodiments, eGFR is determined based on a measurement of serum cystatin C levels. In other embodiments, eGFR is determined using ordinary least squares assuming linear regression with at least 3 serum creatinine values available and measured at least 6 months apart. In other embodiments, eGFR is determined using ordinary least squares assuming linear regression with at least 3 serum creatinine values available and measured at least 1 year apart. In yet other embodiments, eGFR is determined using ordinary least squares assuming linear regression with at least 3 serum creatinine values available and measured at least 2 or more years apart. In other embodiments, eGFR is estimated by visual inspection.

    [0135] In some embodiments, an eGFR slope of at least <?3 ml/min/year (i.e., eGFR loss ?3.0 ml/min/year) indicates that the human subject has or is at risk of developing renal decline. In other embodiments, an eGFR slope of at least <?5 ml/min/year indicates that the human subject has or is at risk of developing renal decline. In yet other embodiments, an eGFR slope of at least <?10 ml/min/year indicates that the human subject has or is at risk of developing renal decline. In yet another embodiment, an eGFR slope of at least <?15 ml/min/year indicates that the human subject has or is at risk of developing renal decline. In other embodiments, a ?40% sustained decline in eGFR from baseline (confirmed for at least 3 months) indicates that the human subject has or is at risk of developing renal decline.

    [0136] In yet another embodiment, eGFR may be determined using the CKD-EPI creatinine equation. In some embodiments, the estimation of GFR slopes may depend on the subject's race, sex and serum creatinine levels. For example, in one embodiment, the eGFR slope for a female of African descent with a serum creatinine concentration (?mol/dL) of ?62 (?0.7) is determined using the following expression: GFR=166?(Scr/0.7).sup.?0.329?(0.993).sup.Age. In another embodiment, the eGFR slope for a female of African descent with a serum creatinine concentration (?mol/dL) of >62 (>0.7) is determined using the following expression: GFR=166?(Scr/0.7).sup.?1.209?(0.993).sup.Age. In another embodiment, the eGFR slope for a male of African descent with a serum creatinine concentration (?mol/dL) of ?80(?0.9) is determined using the following expression: GFR=163?(Scr/0.9).sup.?0.411?(0.993).sup.Age. In another embodiment, the eGFR slope for a male of African descent with a serum creatinine concentration (?mol/dL) of >80 (>0.9) is determined using the following expression: GFR=163?(Scr/0.9).sup.?1.209?(0.993).sup.Age. In another embodiment, the eGFR slope for a female of non-African decent with a serum creatinine concentration (?mol/dL) of ?62 (?0.7) is determined using the following expression: GFR=144?(Scr/0.7).sup.?0.329?(0.993).sup.Age. In another embodiment, the eGFR slope for a female of non-African decent with a serum creatinine concentration (?mol/dL) of >62 (>0.7) is determined using the following expression: GFR=144?(Scr/0.7).sup.?1.209?(0.993).sup.Age. In another embodiment, the eGFR slope for a male of non-African decent with a serum creatinine concentration (?mol/dL) of ?80 (?0.9) is determined using the following expression: GFR=141?(Scr/0.9).sup.?0411?(0.993).sup.Age. In another embodiment, the eGFR slope for a male of African descent with a serum creatinine concentration (?mol/dL) of >80 (>0.9) is determined using the following expression: GFR=141?(Scr/0.9).sup.?1.209?(0.993).sup.Age.

    [0137] Additional methods for determining an estimated Glomerular Filtration Rate are known among those of skill in the art.

    [0138] A method described herein may further comprise combining electronic health records (EHR) and biomarkers (e.g., one or more of SPARC, CCL5, APP, PF4, DNAJC19, ANGPT1, TNFSF12, FGF20, and Testican-2) by using a machine-learned, prognostic risk-score assay as an in vitro diagnostic for enabling accurate risk prediction of progressive kidney decline.

    [0139] In some embodiments, the machine-learned, prognostic risk-score assay is KIDNEYINTELX?. To this end, a random forest model can be trained, and performance (e.g., area under the curve (AUC), positive and negative predictive values (PPV/NPV), and net reclassification index (NRI)) can be compared to a clinical model and KDIGO categories for predicting a composite outcome of estimated glomerular filtration rate (eGFR) decline of ?5 ml/min/year, ?40% sustained decline, or kidney failure within 5 years. In some embodiments, an observational cohort study of patients with prevalent diabetic kidney disease (DKD)/banked plasma from two HER-linked biobanks can be used. KIDNEYINTELX? can provide improved prediction of kidney outcomes over KDIGO (Kidney Disease: Improving Global Outcomes) guidelines and clinical models in individuals with early stages of DKD. In some embodiments, a machine learning model, as described in PCT Application No. PCT/US2021/018030 (publication no. WO/2021/163619; the methods and compositions of which are incorporated by reference herein) is used in the methods described herein.

    [0140] The 8 protective protein biomarkers can be measured in a proprietary, analytically validated multiplex format using the Mesoscale platform (MesoScale Diagnostics, Gaithersburg, Maryland, USA), which employs electrochemiluminescence detection methods combined with patterned arrays to allow for multiplexing of assays. Each sample can be run in duplicate, along with quality control samples with known low, moderate, and high concentrations of each biomarker on each plate. Assay precision can be assessed using a panel of reference samples that span the measurement range. Levey-Jennings plots can be employed and Westguard rules can be followed the for re-run of samples. The laboratory personnel performing the biomarker assays may be blinded to all clinical information.

    [0141] eGFR can be determined using the CKD-EPI creatinine equation, as described, for example, in Levey et al. (Ann Intern Med 150(9): 604-61221 (2009)). Linear mixed models can be employed with an unstructured variance-covariance matrix and random intercept/slope can be used for each individual to estimate eGFR slope, as described, for example, in Leffondre et al. (Nephrol Dial Transplant 30(8): 1237-1243 (2015)). The primary composite outcome, progressive decline in kidney function, can include the following: RKFD defined as an eGFR slope decline of ?5 ml/min/1.73 m.sup.2/year; a sustained (confirmed at least 3 months later) decline in eGFR of ?40% from baseline; or kidney failure defined by sustained eGFR<15 ml/min/1.73 m.sup.2 confirmed at least 30 days later; or receipt of long-term maintenance dialysis or receipt of a kidney transplant (KDIGO, Kidney Int Suppl 3: 1-163 (2012); Levey et al. Am J Kidney Dis 64(6): 821-835(2014)). Additionally, nephrologists (SC/GNN) can be employed to independently adjudicate all outcomes, examine each individual patient over their longitudinal course, and account for eGFR changes (ensuring annualized decline of ?5 ml/min or ?40% sustained decrease), corresponding ICD/CPT codes and medications to ensure that outcomes represented true decline rather than a context dependent temporary change (e.g., due to medications/hospitalizations). Follow up time can be censored after loss to follow-up, after the date that the non-slope components of the composite kidney endpoint are met, or 5 years after baseline.

    [0142] The datasets can be randomized into a derivation (60%) and validation sets (40%). The validation dataset can be completely blinded and sequestered from the total derivation dataset. Using only the derivation set, supervised random forest algorithms on the combined biomarker and all structured EHR features can be evaluated without a priori feature selection and a candidate feature set can be identified. The derivation set can then be randomly split into secondary training and test sets for model optimization with 70%-30% spitting and a 10-fold cross-validation for AUC. Both raw values and ratios of the biomarkers can be considered. Missing uACR values can be imputed to 10 mg/g (Nelson et al. JAMA (2019)), missing blood pressure (BP) values can be imputed using multiple predictors (age, sex, race and antihypertensive medications) (De Silva et al. BMC Med Res Methodol 17(1): 114 (2017)) and median value can be used for other features where missingness was <30%.

    [0143] Further iterations of the model can be conducted by tuning the individual hyperparameters. A hyperparameter is a parameter which is used to control the learning process (e.g., number of RF trees) as opposed to parameters whose weights are learned during the training (e.g., weight of a variable). Tuning hyperparameters refers to iteration of model architecture after setting parameter weights to achieve the ideal performance. Hyperparameters optimization can be performed using grid search approach. K-fold cross validation based AUC can be evaluated for all possible combinations of hyperparameters. Combination of hyperparameters which optimize the AUC for model building can be selected. The following hyperparameters can be considered for optimization: number of variables randomly selected as candidates for splitting a node; forest average number of unique cases (data points) in a terminal node; maximum depth to which a tree should be grown.

    [0144] Additionally, the code for hyperparameter optimization can be deposited in a github repository (https://github.com/girish-nadkarni/KidneyIntelX_hyperparameter_tuning) for improving reproducibility and transparency. The final model can be selected based on AUC performance.

    [0145] Risk probabilities for the composite kidney endpoint can be generated using the final model in the derivation set, scaled to align with a continuous score from 5-100 by increments of 5, and this score can be applied to the validation set. Risk cut-offs can be chosen in the derivation set to encompass the top 15% as the high risk (scores 90-100), bottom 45% as the low risk (scores 5-45), and the intervening 40% as the intermediate risk group (scores 50-85). Primary performance criteria can be AUC, positive predictive value for high risk group and negative predictive values for low risk group (PPV and NPV, respectively) at the pre-determined cut-offs. The selected model and associated cut-offs can then be validated by an independent biostatistician (MK) in the sequestered validation cohort.

    [0146] In addition to these traditional test statistics, calibration can be assessed by examination of the slope of observed vs. expected outcome plots of the KIDNEYINTELX score vs. only the observed outcomes. Also, Kaplan Meier curves can be constructed for time-dependent outcomes of 40% decline and kidney failure with hazard ratios using the Cox proportional hazards method. The discrimination of the KIDNEYINTELX model can be compared to a recently validated comprehensive clinical model which includes age, sex, race, eGFR, cardiovascular disease, smoking, hypertension, BMI, UACR, insulin, diabetes medications, and HbA1c and is developed to predict 40% eGFR decline in eGFR in T2D (Nelson et al. JAMA (2019)). Utility metrics (PPV, NPV) can be compared to both the comprehensive clinical model and KDIGO risk strata.

    [0147] Finally, the net reclassification index (NRI) for events and non-events compared to KDIGO risk strata can be calculated (Pencina et al. Stat Med 27(2): 157-172 (2008); Pencina et al. Stat Med 30(1): 11-21 (2010)). All a-priori levels of significance can be <0.05. All hypothesis tests can be two-sided. 95% confidence intervals can be calculated by bootstrapping. All analyses can be performed with R software (www.rproject.org), the dplyr package, the randomForestSRC, and the CARET package (Hadley et al. (2020) dplyr: A Grammar of Data Manipulation. R Package version 0.7.6. Available from cran.r-project.org/web/packages/dplyr/index.html); Hemant Ishwaran UBK (2020) randomForestSRC: Fast Unified Random Forests for Survival, Regression, and Classification (RF-SRC). Available from cran.rproject.org/web/packages/randomForestSRC/index).

    [0148] Utilizing patients with T2D from two biobanks with plasma samples and linked EHR data, a risk score can be developed and validated combining clinical data and plasma biomarkers via a random forest algorithm to predict a composite kidney outcome, progressive decline in kidney function, consisting of RKFD, sustained 40% decline in eGFR, and kidney failure over 5 years. KIDNEYINTELX can be demonstrated to outperform models using only standard clinical variables, including KDIGO risk categories (KDIGO, Kidney Int Suppl 3: 1-163 (2012)). Marked improvements can be seen in discrimination over clinical models, as measured by AUC, NRI, and improvements in PPV compared to KDIGO risk categories. Furthermore, KIDNEYINTELX can accurately identify over 40% more patients experiencing events than the KDIGO risk strata. Finally, KIDNEYINTELX can provide good risk stratification for the accepted FDA endpoint of sustained 40% decline in eGFR or kidney failure with a 15-fold difference in risk between the high-risk and low-risk strata for this clinical and objective endpoint.

    [0149] DKD is an increasingly complex and common problem challenging modern healthcare systems. In real world practice, the prediction of DKD progression is challenging, particularly in early disease with preserved kidney function and therefore, implementation of improved prognostic tests is paramount. Integrated risk score has near-term clinical implications, especially when linked to clinical decision support (CDS) and embedded care pathways. The current standard for clinical risk stratification (KDIGO risk strata) (KDIGO KDIGO, Kidney Int Suppl 3: 1-163 (2012)) has three risk strata that overlap with the population of DKD patients that can be included in the KIDNEYINTELX study. A risk score with three risk strata (low, intermediate, and high) can be created by incorporating KDIGO classification components (eGFR and uACR), as well as the addition of other clinical variables, and three blood-based biomarkers. In this way, the ability to accurately risk-stratify patients with DKD can be augmented, thereby enabling improved patient management.

    [0150] Care for low-risk patients with DKD can be continued with their existing PCP's or diabetologists and require less intensity treatments, unless repeat testing, changes in clinical status or local arrangements regarding referral to specialist care indicate otherwise. For those with high-risk scores, oversight may include more referrals to nephrology (Smart et al. The Cochrane database of systematic reviews (6): CD007333 (2014); Smart and Titus, Am J Med 124(11): 1073-1080 e1072 (2011)), increased monitoring intervals, improved awareness of kidney health, referral to dieticians, reinforcement of usage of antagonists of the renin angiotensin aldosterone system, and increased motivation to start recently approved medications, including SGLT2 inhibitors and GLP-1 receptor agonists to slow progression (Kristensen et al. Lancet Diabetes Endocrinol 7(10): 776-785 (2019); Sarafidis et al. Nephrol Dial Transplant 34(2): 208-230 (2019)). Adoption of these new therapies is lagging, especially in patients considered to be lowrisk by standard criteria, where cost of treatment and presence of adverse events are limiting factors. Earlier engagement with nephrologists may also allow for more time to advise and educate patients about homebased dialysis and pre-emptive or early kidney transplant as patient-centered kidney replacement options if more aggressive treatment does not ultimately prevent progression of DKD. The use of a risk score as part of the enrollment process in future RCTs may enrich the trial participants for greater likelihood of events and thus reduce the chances for type 2 error, or minimize the sample size needed to detect a statistically significant difference with treatment vs. control. Interventions that prevent or slow DKD progression and foster patient-centered kidney replacement modalities support the goals of the US Department of Health and Human Services' Advancing American Kidney Health initiative (Mehrotra, Clin J Am Soc Nephrol 14(12): 1788 (2019)).

    [0151] KIDNEYINTELX included inputs from biomarkers examined in several settings, including patients with DKD. Soluble TNFR1 and 2 and plasma KIM-1 have demonstrated reliable independent prognostic signals for kidney function decline and ESKD (Niewczas et al. J Am Soc Nephrol 23(3): 507-515 (2012); Coca et al. J Am Soc Nephrol 28(9): 2786-2793 (2017); Nadkarni et al. Kidney Int 93(6): 1409-1416 (2018); Tummalapalli et al. Curr Opin Nephrol Hypertens 25(6): 480-486 (2016); Gohda et al. J Am Soc Nephrol 23(3): 516-524 (2012); Krolewski et al. Diabetes care 37(1): 226-234 (2014); Bhatraju et al. J Am Soc Nephrol 29(11): 2713-2721 (2018)). In a previous study, it was found that inclusion of biomarkers to clinical data derived from EHR at a single-center had better predictive performance than clinical models alone (Chauhan et al. Kidney360 (2020)). However, that study included few patients with prevalent CKD (approximately ?rd had CKD in the cohort with T2D and ?th had CKD in the APOL1 high-risk cohort). However, in the method described hereinabove, by incorporating biomarker concentrations and the EHR data into the machine learning algorithm, a multidimensional representation of risk for patient with DKD can be provided and improved prognostic estimates for future progression can be generated (Tangri et al. JAMA 315(2): 164-174 (2016); Tangri et al. JAMA 305(15): 1553-1559 (2011)). Other composite tests that incorporate multiple plasma biomarkers and limited clinical data features have been shown to accurately predicted incident CKD in individuals with T2D, although prediction of progressive decline in kidney function is an ongoing challenge (Peters et al. J Clin Med 9(10) (2020); Peters et al. J Diabetes Complicat 33(12) (2019)). However, the goal of KIDNEYINTELX test is to determine which patients with established DKD are at highest risk of progressive decline in kidney function of kidney failure and those that have CKD that is unlikely to progress over time.

    [0152] Thus, a machine-learned model combining plasma biomarkers and EHR data can significantly improve prediction of progressive decline in kidney function over standard clinical models in patients with T2 DKD from large academic medical centers.

    [0153] A machine-learned, prognostic risk-score assay for use with the current methods can be used, as described, for example, in U.S. Patent Application No. 62/976,767, U.S. Patent Application No. 62/976,761, and U.S. Patent Application No. 63/016,868, each of which is incorporated herein by reference in its entirety.

    IV. Methods of Treatment or Prevention

    [0154] Methods and compositions for treating or preventing renal decline and/or ESKD (also referred to herein as ESRD) in a subject in need thereof are also featured in the disclosure. In one embodiment, the present disclosure provides methods of treating a subject having renal decline and/or ESKD, a subject suspected of having renal decline and/or ESKD, or a subject who is at a risk of developing renal decline and/or ESKD. In other embodiments, a subject having a disorder associated with renal decline and/or ESKD may be treated using the methods described herein without having been identified by the predictive methods of the present disclosure. In certain embodiments, methods of treatment disclosed herein improves kidney function (also referred to herein as renal function) in such subjects.

    [0155] In some embodiments, methods of treatment described herein comprises administering to the subject a therapy of the present disclosure. A therapy of the present disclosure may comprise a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of one or more protective proteins described hereinabove. For example, a therapy of the present disclosure may comprise a therapeutically effective amount of one or more protective proteins (e.g., a therapeutically effective amount of recombinant SPARC, recombinant CCL5, recombinant APP, recombinant PF4, recombinant DNAJC19, recombinant ANGPT1, recombinant TNFSF12, recombinant FGF20, and/or recombinant Testican-2). Alternatively, a therapy of the present disclosure may comprise a therapeutically effective amount of an analog of one or more protective proteins (e.g., a therapeutically effective amount of a SPARC analog, a CCL5 analog, an APP analog, a PF4 analog, a DNAJC19 analog, an ANGPT1 analog, a TNFSF12 analog, an FGF20 analog, and/or a Testican-2 analog). An analog of a protective protein may be a mutated polypeptide (e.g., a mutated SPARC polypeptide, a mutated CCL5 polypeptide, a mutated APP polypeptide, a mutated PF4 polypeptide, a mutated DNAJC19 polypeptide, a mutated ANGPT1 polypeptide, a mutated TNFSF12 polypeptide, a mutated FGF20 polypeptide, and/or a mutated Testican-2 polypeptide). Alternatively, an analog of a protective protein may be a fusion protein, such as a chimeric protein containing the protective protein (e.g., a SPARC polypeptide, a CCL5 polypeptide, an APP polypeptide, a PF4 polypeptide, a DNAJC19 polypeptide, an ANGPT1 polypeptide, a TNFSF12 polypeptide, an FGF20 polypeptide, and/or a Testican-2 polypeptide) and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration. Alternatively, an analog of a protective protein may be a mimetic (e.g., a non-peptide mimetic) of one or more protective proteins (e.g., a mimetic of SPARC, CCL5, APP, PF4, DNAJC19, ANGPT1, TNFSF12, FGF20, and/or Testican-2). In other instances, an analog of a protective protein may be an agonist of one or more protective proteins (e.g., a SPARC agonist, a CCL5 agonist, an APP agonist, a PF4 agonist, a DNAJC19 agonist, an ANGPT1 agonist, a TNFSF12 agonist, an FGF20 agonist, and/or a Testican-2 agonist). An agonist for use in the present disclosure may be an agonistic antibody, such as an antibody directed to the receptor of the protective protein (e.g., an agnostic SPARC receptor antibody, an agnostic CCL5 receptor antibody, an agnostic APP receptor antibody, an agnostic PF4 receptor antibody, an agnostic DNAJC19 receptor antibody, an agnostic ANGPT1 receptor antibody, an agnostic TNFSF12 receptor antibody, an agnostic FGF20 receptor antibody, and/or an agnostic Testican-2 receptor antibody. In yet other embodiments, a therapy of the present disclosure may comprise a therapeutically effective amount of a nucleic acid molecule encoding one or more protein proteins (e.g., a DNA or RNA molecule encoding one or more of SPARC, CCL5, APP, PF4, DNAJC19, ANGPT1, TNFSF12, FGF20, and/or Testican-2).

    ANGPT1

    [0156] In some embodiments, a method of treatment described herein comprises therapeutic use of ANGPT1, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of ANGPT1. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant ANGPT1 (e.g., of human or mouse origin), an ANGPT1 analog (e.g., a mutated ANGPT1 polypeptide, or an ANGPT1 fusion protein, such as a chimeric protein containing ANGPT1 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), an ANGPT1 mimetic (e.g., a non-peptide mimetic of ANGPT1), an ANGPT1 agonist (e.g., an agonistic ANGPT1 receptor antibody) and/or a nucleic acid molecule encoding ANGPT1.

    [0157] Such therapeutic use of ANGPT1 may comprise the therapeutic use, as described, for example, in WO2018067991A1. WO2018067991A1 describes a method of modulating T cell dysfunction used for treating condition e.g., cancer and chronic infection, by contacting dysfunctional T cell with a modulating agent or agents that promotes the expression, activity and/or function of an angiopoetin or angiopoietin-like protein, such as ANGPT1.

    [0158] Alternatively, therapeutic use of ANGPT1 may comprise the therapeutic use, as described, for example, in US20090304680A1. US20090304680A1 describes a pharmaceutical composition for the treatment, prevention or diagnosis of Kawasaki Disease in an individual, the composition comprising a molecule comprising ANGPT1 or a modulator thereof.

    TNFSF12

    [0159] In some embodiments, a method of treatment described herein comprises therapeutic use of TNFSF12 or TWEAK, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of TNFSF12. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant TNFSF12 (e.g., of human or mouse origin), a TNFSF12 analog (e.g., a mutated TNFSF12 polypeptide, or a TNFSF12 fusion protein, such as a chimeric protein containing TNFSF12 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a TNFSF12 mimetic (e.g., a non-peptide mimetic of TNFSF12), a TNFSF12 agonist (e.g., an agonistic TNFSF12 receptor antibody) and/or a nucleic acid molecule encoding TNFSF12.

    [0160] Such therapeutic use of TNFSF12 may comprise the therapeutic use, as described, for example, in WO2010088534A1. As described in WO2010088534A1, TNFSF12 is capable of expanding populations of human and rodent pancreatic cells and inducing the appearance of endocrine lineage committed progenitor cells in the pancreas. Accordingly, agonists of the TNFSF12 receptor (TNFSF12-R) can be used in methods for regenerating pancreatic tissue and expanding populations of pancreatic cells in vivo and in vitro. These methods can be used to treat diseases or conditions where enhancement of pancreatic progenitor cells for cell replacement therapy is desirable, including, e.g., diabetes and conditions that result in loss of all or part of the pancreas. For use in such methods, the TNFSF12-R agonist can be TNFSF12 (e.g., TNFSF12 polypeptide of human or mouse origin), a TNFSF12 analog (e.g., a mutated TNFSF12 polypeptide, or a TNFSF12 fusion protein, such as a chimeric protein containing TNFSF12 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a TNFSF12 mimetic (e.g., a non-peptide mimetic of TNFSF12), and an agonistic TNFSF12-R antibody.

    [0161] Alternatively, therapeutic use of TNFSF12 may comprise the therapeutic use, as described, for example, in WO2001085193A2. WO2001085193A2 describes use of synergistically effective amount of a TNFSF12 agonist and an angiogenic factor in a method for enhancing angiogenic activity to promote neovascularization. Such TNFSF12 agonists include soluble recombinant TNFSF12 protein and TNFSF12 agonists taught in WO98/05783, WO98/35061 and WO99/19490.

    FGF20

    [0162] In some embodiments, a method of treatment described herein comprises therapeutic use of FGF20, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of FGF20. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant FGF20 (e.g., of human or mouse origin), a FGF20 analog (e.g., a mutated FGF20 polypeptide, or a FGF20 fusion protein, such as a chimeric protein containing FGF20 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a FGF20 mimetic (e.g., a non-peptide mimetic of FGF20), a FGF20 agonist (e.g., an agonistic FGF20 receptor antibody) and/or a nucleic acid molecule encoding FGF20.

    [0163] Such therapeutic use of FGF20 may comprise the therapeutic use, as described, for example, in WO2005019427A2. WO2005019427A2 describes a method of treating a hyperphosphatemic condition by administering a therapeutically effective amount of an isolated FGF20 polypeptide (e.g., a FGF20 polypeptide with a mutation that confers increased stability to the FGF20 polypeptide). Also described in WO2005019427A2 is a method of treating a hyperphosphatemic condition by administering a therapeutically effective amount of a reagent that increases the level of FGF20 polypeptide. Also described in WO2005019427A2 is a method of treating a condition involving deposition of calcium and phosphate in the arteries or soft tissues of a subject by administering to the subject a therapeutically effective amount of FGF20 or a reagent that increases the level of FGF20 polypeptide.

    [0164] Alternatively, therapeutic use of FGF20 may comprise the therapeutic use, as described, for example, in WO2020160468A1. WO2020160468A1 describes a method of treating a patient diagnosed as having a neurocognitive disorder (NCD) by providing to the patient one or more agents that collectively increase expression and/or activity of two or more proteins selected from a group that includes FGF20.

    SPARC

    [0165] In some embodiments, a method of treatment described herein comprises therapeutic use of SPARC, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of SPARC. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant SPARC (e.g., of human or mouse origin), a SPARC analog (e.g., a mutated SPARC polypeptide, or a SPARC fusion protein, such as a chimeric protein containing SPARC polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a SPARC mimetic (e.g., a non-peptide mimetic of SPARC), a SPARC agonist (e.g., an agonistic SPARC receptor antibody) and/or a nucleic acid molecule encoding SPARC.

    [0166] Such therapeutic use of SPARC may comprise the therapeutic use, as described, for example, in WO2008128169A1. WO2008128169A1 describes compositions for treating a mammalian tumor comprising a therapeutically effective amount of SPARC polypeptide and therapeutically effective amount of a hydrophobic chemotherapeutic agent (e.g., a microtubule inhibitor, such as a taxane) in absence or presence of an angiogenesis inhibitor. The SPARC polypepide used in the compositions of WO2008128169A1 is either exogenous wild-type SPARC or exogenous mutant SPARC (having a mutation corresponding to a deletion of the third glutamine in the mature form of the human SPARC protein).

    [0167] Therapeutic use of SPARC may also comprise the therapeutic use, as described, for example, in WO2013170365A1. WO2013170365A1 discloses a method for sensitization of cancer cells through the administration of SPARC polypeptide and GRP78. SPARC polypeptide used in the methods of WO2013170365A1 refers to full length 303 amino acid SPARC protein sequence and to any fragment or variant thereof, known in the art, that retains chemo-sensitzing activity, including a number of SPARC polypeptides described by Rahman et al. (PLOS ONE 10.1371/journal.pone.0026390 Published: 1 Nov. 2011), and SPARC fragments that were tested in WO/2008/000079.

    [0168] Alternatively, therapeutic use of SPARC may comprise the therapeutic use, as described, for example, in Chlenski et al. (Mol Cancer 9:138 (2010)). Chlenski et al. describes SPARC peptides corresponding to the follistatin domain of the protein (FS-E), especially, peptide FSEC that corresponds to the C-terminal loops of FS-E, to have potent anti-angiogenic and anti-tumorigenic effects in neuroblastoma.

    CCL5

    [0169] In some embodiments, a method of treatment described herein comprises therapeutic use of CCL5, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of CCL5. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant CCL5 (e.g., of human or mouse origin), a CCL5 analog (e.g., a mutated CCL5 polypeptide, or a CCL5 fusion protein, such as a chimeric protein containing CCL5 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a CCL5 mimetic (e.g., a non-peptide mimetic of CCL5), a CCL5 agonist (e.g., an agonistic CCL5 receptor antibody) and/or a nucleic acid molecule encoding CCL5.

    [0170] Such therapeutic use of CCL5 may comprise the therapeutic use, as described, for example, in Bhat et al. (Front Immunol, 11: 1849 (2020)) and/or Xie et al. (PNAS 118 (9) e2017282118 (2021)). Bhat et al. describes strong CCL5 production following arenavirus lymphocytic choriomeningitis virus (LCMV) treatment. Xie et al. shows widespread expression of chemokine CCL5 following Ciliary neurotrophic factor (CNTF) gene therapy.

    [0171] Alternatively, therapeutic use of CCL5 may comprise the therapeutic use, as described, for example, in WO2020068261A1. WO2020068261A1 describes immunomodulatory fusion proteins comprising a collagen-binding domain operably linked to an immunomodulatory domain, wherein the immunomodulatory domain comprises one or more chemokines, such as CCL5, and methods of using the same, for example, to treat cancer.

    [0172] In other instances, therapeutic use of CCL5 may comprise the therapeutic use, as described, for example, in WO2020146857A1. WO2020146857A1 describes a ProteAse Released chemoKines protein (PARK) comprising a prochemokine moiety comprising a propeptide moiety fused to a chemokine moiety, wherein the chemokine moiety comprises a N-terminus and a C-terminus, and wherein the chemokine moiety comprises a chemokine amino acid sequence having at least 90% similarity to CCL5; and a targeting moiety linked to the prochemokine moiety, wherein the targeting moiety has a binding specificity to a tumor, fibrosis or Alzheimer's Disease associated antigen or receptor.

    APP

    [0173] In some embodiments, a method of treatment described herein comprises therapeutic use of APP, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of APP. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant APP (e.g., of human or mouse origin), an APP analog (e.g., a mutated APP polypeptide, or an APP fusion protein, such as a chimeric protein containing APP polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), an APP mimetic (e.g., a non-peptide mimetic of APP), an APP agonist (e.g., an agonistic APP receptor antibody) and/or a nucleic acid molecule encoding APP.

    [0174] Such therapeutic use of APP may comprise the therapeutic use, as described, for example, in WO2020201471A1. WO2020201471A1 describes a compound for use in the treatment or prevention of a liver disease, wherein the compound is a amyloid beta related protein, the amyloid beta related protein being selected from the group consisting of amyloid beta protein, a amyloid beta peptide derived therefrom, amyloid precursor protein (APP), a compound involved in the generation of an amyloid beta peptide from APP, or a compound inhibiting the degradation of the amyloid beta protein or of amyloid peptides derived therefrom. Amyloid precursor protein or APP refers to an integral membrane protein expressed in many tissues and concentrated in the synapses of neurons. APP is known as the precursor molecule whose proteolysis generates beta amyloid (Ab). In particular, the amyloid beta peptide derived from the amyloid beta protein is selected from the group consisting of amyloid beta 40, amyloid beta 42 and amyloid beta 38. Further, the compound involved in the generation of an amyloid beta peptide from APP can be an enzyme selected from alpha-, beta- (BACE1), gamma-secretases, preferably presenilin.

    [0175] Alternatively, therapeutic use of APP may comprise the therapeutic use, as described, for example, in WO2020160468A1. WO2020160468A1 describes compositions and methods for treating a patient having or at risk of developing a neurocognitive disorder, such as Alzheimer's disease, Parkinson's disease, and/or a frontotemporal lobar dementia, by providing to the patient one or more agents that collectively increase expression and/or activity of two or more proteins selected from a group that comprises APP. APP and Amyloid-beta A4 protein include wild-type forms of the APP gene or protein, as well as variants (e.g., splice variants, truncations, concatemers, and fusion constructs, among others) of wild-type APP proteins and nucleic acids encoding the same.

    PF4

    [0176] In some embodiments, a method of treatment described herein comprises therapeutic use of PF4, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of PF4. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant PF4 (e.g., of human or mouse origin), a PF4 analog (e.g., a mutated PF4 polypeptide, or a PF4 fusion protein, such as a chimeric protein containing PF4 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a PF4 mimetic (e.g., a non-peptide mimetic of PF4), a PF4 agonist (e.g., an agonistic PF4 receptor antibody) and/or a nucleic acid molecule encoding PF4.

    [0177] Such therapeutic use of PF4 may comprise the therapeutic use, as described, for example, in WO2009117710A2. WO2009117710A2 describes a method for treating an MIF-mediated disorder by administering to a subject an active agent that inhibits (i) MIF binding to CXCR2 and CXCR4 and/or (ii) MIF-activation of CXCR2 and CXCR4; (iii) the ability of MIF to form a homomultimer; or a combination thereof, wherein the active agent can be recombinant PF4.

    [0178] Alternatively, therapeutic use of PF4 may comprise the therapeutic use, as described, for example, in WO1994013321A1. WO1994013321A1 describes process for suppressing myeloid cells by administering a synergistic combination of chemokines which suppress myeloid cells, wherein the synergistic combination includes at least one chemokine selected from a group consisting of PF4. PF4 used in methods and compositions of WO1994013321A1 is natural human PF4.

    DNAJC19

    [0179] In some embodiments, a method of treatment described herein comprises therapeutic use of DNAJC19, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that increases the expression and/or function of DNAJC19. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant DNAJC19 (e.g., of human or mouse origin), a DNAJC19 analog (e.g., a mutated DNAJC19 polypeptide, or a DNAJC19 fusion protein, such as a chimeric protein containing DNAJC19 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a DNAJC19 mimetic (e.g., a non-peptide mimetic of DNAJC19), a DNAJC19 agonist (e.g., an agonistic DNAJC19 receptor antibody) and/or a nucleic acid molecule encoding DNAJC19.

    [0180] Such therapeutic use of DNAJC19 may comprise the therapeutic use, as described, for example, in WO2016170348A2. WO2016170348A2 describes small activating RNA for modulating the expression of a target gene for therapeutic purpose, wherein the target gene can be DNAJC19.

    [0181] Alternatively, therapeutic use of DNAJC19 may comprise the therapeutic use, as described, for example, in WO2017191274A2. WO2017191274A2 describes RNA comprising coding sequence, useful for preparing composition used as medicament used in gene therapy in disease, disorder or condition, e.g. metabolic or endocrine disorders, cancer, infectious diseases or immunodeficiencies, wherein the encoded peptide or protein comprises a therapeutic protein or a fragment or variant thereof, selected from a group that includes, without limitation DNAJC19.

    Testican-2

    [0182] In some embodiments, a method of treatment described herein comprises therapeutic use of Testican-2, such as administering to a subject a therapeutically effective amount of a protein or nucleic acid molecule that is or increases the expression and/or function of Testican-2. For example, a method of treatment described herein may comprise administering to a subject a therapeutically effective amount of recombinant Testican-2, a Testican-2 analog (e.g., a mutated Testican-2 polypeptide, or a Testican-2 fusion protein, such as a chimeric protein containing Testican-2 polypeptide and one or more polypeptide portions that enhance in vivo stability, in vivo half-life, and/or uptake/administration), a Testican-2 mimetic (e.g., a non-peptide mimetic of Testican-2), a Testican-2 agonist (e.g., an agonistic Testican-2 receptor antibody) and/or a nucleic acid molecule encoding Testican-2.

    [0183] In certain embodiments, the methods and compositions disclosed herein are used to identify a human subject who is at risk of developing progressive renal decline (the subject may already have renal decline in which case the risk is assessed with respect to even further progression) where a therapy to improve kidney function (i.e., slow progression of kidney disease) is administered to the human subject who is identified as being at risk. Examples of therapy include, but are not limited to losing weight, an agent to control high blood pressure, and/or an agent to control high cholesterol levels. Such agents may be used to treat problems that may cause progressive kidney disease and the complications that can happen as a result of it, e.g., high blood pressure. The methods disclosed herein also include, in certain embodiments, administering an additional agent to the subject, for example an anti-fibrosis agent. Exemplary agents include, but are not limited to angiotensin-converting enzyme inhibitors (ACEI) and angiotensin II receptor type 1 blockers (ARB), renin inhibitors (aliskiren, enalkiren, zalkiren), mineralocorticoid receptor blockers (spironolacton, eplerenone), vasopeptidase inhibitors (e.g. AVE7688, omapatrilat). In certain embodiments, a statin, e.g., atorvastatin or simvastatin, is administered to lower cholesterol levels of the human subject.

    [0184] Further, nucleic acid molecules (e.g., DNA and/or mRNA nucleic acid molecules) useful in the therapeutic methods described herein may be synthetic. The term synthetic means the nucleic acid molecule is isolated and not identical in sequence (the entire sequence) and/or chemical structure to a naturally-occurring nucleic acid molecule, such as an endogenou s precursor mRNA molecule. While in some embodiments, nucleic acids of the invention do not have an entire sequence that is identical to a sequence of a naturally-occurring nucleic acid, such molecules may encompass all or part of a naturally-occurring sequence. It is contemplated, however, that a synthetic nucleic acid administered to a cell may subsequently be modified or altered in the cell such that its structure or sequence is the same as non-synthetic or naturally occurring nucleic acid, such as a mature mRNA sequence. For example, a synthetic nucleic acid may have a sequence that differs from the sequence of a precursor mRNA, but that sequence may be altered once in a cell to be the same as an endogenous, processed mRNA. The term isolated means that the nucleic acid molecules of the disclosure are initially separated from different (in terms of sequence or structure) and unwanted nucleic acid molecules such that a population of isolated nucleic acids is at least about 90% homogenous, and may be at least about 95, 96, 97, 98, 99, or 100% homogenous with respect to other polynucleotide molecules. In many embodiments of the disclosure, a nucleic acid is isolated by virtue of it having been synthesized in vitro separate from endogenous nucleic acids in a cell. It will be understood, however, that isolated nucleic acids may be subsequently mixed or pooled together.

    [0185] A nucleic acid may be made by any technique known to one of ordinary skill in the art, such as for example, chemical synthesis, enzymatic production or biological production.

    [0186] Nucleic acid synthesis is performed according to standard methods. See, for example, Itakura and Riggs (1980). Additionally, U.S. Pat. Nos. 4,704,362, 5,221,619, and 5,583,013 each describe various methods of preparing synthetic nucleic acids. Non-limiting examples of a synthetic nucleic acid (e.g., a synthetic oligonucleotide), include a nucleic acid made by in vitro chemically synthesis using phosphotriester, phosphite or phosphoramidite chemistry and solid phase techniques such as described in EP 266,032, incorporated herein by reference, or via deoxynucleoside H-phosphonate intermediates as described by Froehler et al., 1986 and U.S. Pat. No. 5,705,629, each incorporated herein by reference. In the methods of the present invention, one or more oligonucleotide may be used. Various different mechanisms of oligonucleotide synthesis have been disclosed in for example, U.S. Pat. Nos. 4,659,774, 4,816,571, 5,141,813, 5,264,566, 4,959,463, 5,428,148, 5,554,744, 5,574,146, 5,602,244, each of which is incorporated herein by reference.

    [0187] A non-limiting example of an enzymatically produced nucleic acid include one produced by enzymes in amplification reactions such as PCR (see for example, U.S. Pat. Nos. 4,683,202 and 4,682,195, each incorporated herein by reference), or the synthesis of an oligonucleotide described in U.S. Pat. No. 5,645,897, incorporated herein by reference.

    [0188] Oligonucleotide synthesis is well known to those of skill in the art. Various different mechanisms of oligonucleotide synthesis have been disclosed in for example, U.S. Pat. Nos. 4,659,774, 4,816,571, 5,141,813, 5,264,566, 4,959,463, 5,428,148, 5,554,744, 5,574,146, 5,602,244, each of which is incorporated herein by reference.

    [0189] Recombinant methods for producing nucleic acids in a cell are well known to those of skill in the art. These include the use of vectors, plasmids, cosmids, and other vehicles for delivery a nucleic acid to a cell, which may be the target cell or simply a host cell (to produce large quantities of the desired RNA molecule). Alternatively, such vehicles can be used in the context of a cell free system so long as the reagents for generating the RNA molecule are present. Such methods include those described in Sambrook, 2003, Sambrook, 2001 and Sambrook, 1989, which are hereby incorporated by reference.

    [0190] In certain embodiments, the nucleic acid molecules of the present disclosure are not synthetic. In some embodiments, the nucleic acid molecule has a chemical structure of a naturally occurring nucleic acid and a sequence of a naturally occurring nucleic acid. In addition to the use of recombinant technology, such non-synthetic nucleic acids may be generated chemically, such as by employing technology used for creating oligonucleotides.

    [0191] Administration or delivery of a therapeutic agent (e.g., a protective protein) according to the present disclosure may be via any route so long as the target tissue is available via that route. For example, administration may be by intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous injection, or by direct injection into target tissue (e.g., cardiac tissue). Pharmaceutical compositions comprising polypeptides or polynucleotides or expression constructs comprising polypeptide or polynucleotide sequences may also be administered by catheter systems or systems that isolate coronary circulation for delivering therapeutic agents to the heart. Various catheter systems for delivering therapeutic agents to the heart and coronary vasculature are known in the art. Some non-limiting examples of catheter-based delivery methods or coronary isolation methods suitable for use in the present invention are disclosed in U.S. Pat. Nos. 6,416,510; 6,716,196; 6,953,466, WO 2005/082440, WO 2006/089340, U.S. Patent Publication No. 2007/0203445, U.S. Patent Publication No. 2006/0148742, and U.S. Patent Publication No. 2007/0060907, which are all hereby incorporated by reference in their entireties.

    [0192] The a therapeutic agent (e.g., a protective protein) may also be administered parenterally or intraperitoneally. By way of illustration, solutions of the conjugates as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations generally contain a preservative to prevent the growth of microorganisms.

    [0193] The a therapeutic agent (e.g., a protective protein) suitable for injectable use or catheter delivery include, for example, sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. Generally, these preparations are sterile and fluid to the extent that easy injectability exists. Preparations should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms, such as bacteria and fungi. Appropriate solvents or dispersion media may contain, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial an antifungal agent(s), for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by their use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.

    [0194] The disclosure is further illustrated by the following examples, which should not be construed as limiting.

    EXAMPLES

    [0195] Described herein are studies that identify biomarkers useful for diagnosing, prognosing, and identifying subjects with, or suspected of having, or potentially developing progressive renal decline and/or ESKD. The following examples are included for purpose of illustration only and are not intended to be limiting.

    [0196] Over the last several decades, considerable research efforts have been directed toward understanding the mechanisms of diabetic kidney disease (DKD) in humans with type 1 diabetes (T1D) as well as in type 2 diabetes (T2D). In that research, the major focus was on factors and markers that were associated with high risk of the development of various manifestations of DKD (Parving et al., Diabetic Nephropathy. In: Brenner BM, ed. Brenner and Rector's The Kidney. 7th ed. Philadelphia. (Elsevier, 2004); JAMA 290: 2159-2167 (2003); Lancet 352: 837-853 (1998); Nowak et al., Kidney International 93: 1198-1206 (2018); Niewczas et al., Nat Med 25: 805-813 (2019); Ahluwalia et al., Editorial: Novel Biomarkers for Type 2 Diabetes. Front Endocrinol (Lausanne) 10: 649 (2019)). Recent attention has focused on the search for factors and biomarkers associated with protection against DKD. It has been postulated that subjects who remained without late complications despite long duration of diabetes, so-called survivors with long diabetes duration, could be enriched for such protective factors/biomarkers. This approach has already provided findings that resulted not only in the development of a new hypothesis about DKD, but also in the identification of pyruvate kinase M2 (PKM2) as a new therapeutic target to prevent DKD (Qi et al., Nat Med 23: 753-762 (2017)).

    Materials and Methods

    [0197] The subjects for the study described herein were selected from among participants of the Joslin Kidney Study (JKS). The Joslin Diabetes Center Committee on Human Studies approved the informed consent, recruitment and examination protocols for the JKS, a longitudinal observational study that investigates the determinants and natural history of kidney function decline in both types of diabetes.

    Joslin Kidney Study (JKS)

    [0198] Briefly, the JKS comprises two components, type 1 diabetes (T1D) and type 2 diabetes (T2D). Subjects in the T1D component were recruited consecutively from among 3,500 adults 18-64 years old with T1D who attended the Joslin Clinic between 1991 and 2009. According to the median values of ACR obtained during the 2-year period preceding enrollment (baseline examination), subjects were classified into three sub-groups: those with Macro-Albuminuria (ACR?300 ?g/mg), Micro-Albuminuria (30?ACR<300 ?g/mg), and Normo-Albuminuria (ACR<30 ?g/mg). The aim was to recruit into the JKS all of those with Macro- and Micro-Albuminuria and a similar number of subjects with Normo-Albuminuria. In total, 1884 subjects were enrolled: 526 with Macro-Albuminuria, 563 with Micro-albuminuria and 795 with Normo-Albuminuria.

    [0199] Subjects in the T2D cohort were recruited consecutively from among 4500 adults 35-64 years old with T2D who attended the Joslin Clinic between 2003 and 2009. According to the median values of ACR obtained during the 2-year period preceding enrollment (baseline examination), subjects were classified into three sub-groups as described above for T1D. The aim was to recruit into the JKS all those with Macro- and Micro-Albuminuria and a similar number of subjects with Normo-Albuminuria. In total, 1,476 subjects were enrolled: 261 with Macro-Albuminuria, 482 with Micro-Albuminuria and 733 with Normo-Albuminuria.

    [0200] All subjects enrolled into the JKS had biannual examinations either during routine clinic visits or were invited for a special visit or were examined at their homes. These examinations were conducted until they developed end-stage kidney disease (ESKD), died, were lost to follow-up or until the end of follow-up in 2015. Biospecimens obtained at examinations were stored in ?85? C. Serum creatinine was used to determine kidney function at baseline and its changes during follow-up visits. Serum creatinine measurements were calibrated over time using protocols described by Skupien et al. (Kidney international 82: 589-597 (2012)). Estimates of glomerular filtration rate (GFR) were obtained using the Chronic Kidney Disease Epidemiology Collaboration formula, as described by Levey et al. (Ann Intern Med 150: 604-612 (2009)).

    [0201] To classify patterns of trajectories of kidney function changes during follow-up, the first step was to determine whether they were linear or non-linear. Although most estimated glomerular filtration rate (eGFR) trajectories appeared linear on inspection, this impression was validated statistically by fitting both linear and spline models to each patient's kidney function trajectory. An approach described by Jones and Molitoris (Anal Biochem 141: 287-290 (1984)) and used by Shah and Levey (J Am Soc Nephrol 2: 1186-1191 (1992)) was applied to examine an individual's serial kidney function changes during follow-up. Participants in the study had 5 or more eGFR determinations over 7-15 years of follow-up. The method represents each participant's kidney function trajectory as a simple linear model and as a spline model with linear segments connected at an individually determined point. The linear and spline models were compared, and the linear model was rejected at a nominal significance of 0.05 and degrees of freedom determined by the number of spline segments (n?1). The majority had linear slopes. To determine the slope of eGFR decline, the linear component of each individual's trajectory was extracted to generate distribution of slopes of overall eGFR change during follow-up. Details of this approach are described below and also described in Skupien et al. (Kidney international 82: 589-597 (2012)).

    [0202] All subjects included in the JKS were queried every two years against rosters of the United States Renal Data System (USRDS) and the National Death Index (NDI) to ascertain patients who developed ESKD or died. The last inquiries were conducted in 2015. The USRDS maintains a roster of US patients receiving renal replacement therapy, which includes dates of dialysis and transplantation.

    Exploratory, Replication and Validation Cohorts

    [0203] The current study comprises three JKS cohorts; the exploratory cohort of 214 subjects with T1D and the replication cohort of 144 subjects with T2D, who previously participated in our study to determine cut-point values of serum TNF-R1 concentrations for the prediction of development of ESKD in T1D and T2D (Yamanouchi et al., Kidney International 92: 258-266 (2017)). In contrast to the previous study which included subjects with Chronic Kidney Disease (CKD) Stages 3 and 4, the present study included subjects in the JKS who had CKD Stage 3 at baseline examination. The validation cohort consists of 294 subjects with T1D who had CKD Stages 1 and 2 at baseline and was used to examine the importance of three exemplar protective proteins observed in late diabetic kidney disease (DKD) cohorts in subjects with an early stage of DKD. The primary goal was to search for protective proteins against progressive renal decline and progression to ESKD not only in T1D patients with impaired kidney function but also in any diabetic patients at any stages of DKD. Therefore, to demonstrate the robustness of the findings, three very different cohorts with different baseline characteristics were selected; the T1D exploratory (T1D patients with late stage of DKD), the T2D replication (T2D patients with late stage of DKD) and the T1D validation (T1D patients with early stage of DKD) cohorts.

    [0204] Subjects with T1D and T2D had Macro- (ACR?300 ?g/mg) and Micro-albuminuria (ACR?30 ?g/mg). These subjects were followed for 7-15 years to determine the rate of eGFR decline (eGFR slopes) and to ascertain onset of ESKD. All clinical data and plasma specimens from these subjects were available for the current study. Detailed descriptions of these cohorts, measurements of clinical characteristics, determinations of eGFR slopes from serial measurements of serum creatinine, and ascertainment of onset of ESKD are described, for example, in Niewczas et al. (Nat Med 25: 805-813 (2019)) and Yamanouchi et al. (Kidney International 92: 258-266 (2017)). In all 3 cohorts, eGFR loss <3.0 ml/min/year were selected as the threshold to define those with slow (non-progressors) or fast (progressors) progressive renal decline. The rationale for such a threshold was well documented and used in previous publications (Perkins et al., J Am Soc Nephrol 18: 1353-1361 (2007); Krolewski et al., Diabetes Care 37: 226-234 (2014)) and corresponds to the 2.5.sup.th percentile of the distribution of annual kidney function loss in a general population (Lindeman et al., J Am Geriatr Soc 33: 278-285 (1985)).

    Healthy Non-Diabetic Parents of T1D Subjects

    [0205] During the Joslin Kidney Study, living parents of subjects with T1D were also examined. The group of non-diabetic parents of T1D subjects was derived from genetic study on determinants of DKD in T1D. Parents had baseline examinations performed according to the same protocols as all participants of the JKS. Biospecimens obtained at examinations were stored in ?85? C. For the purpose of this study, 79 white non-diabetic parents aged 50-69 years at baseline examination were selected to be used as non-diabetic controls. Forty parents had children who remained without kidney complications despite long duration of diabetes and 39 parents had children who had advanced DKD (impaired kidney function or ESKD). The clinical phenotype of the T1D offspring of the non-diabetic parents is either normo-albuminuria (n=40), or ESKD or proteinuria (n=39). Plasma specimens obtained at baseline examination were subjected to the SOMAscan analysis.

    The SOMAscan Proteomic Analysis

    [0206] The SOMAscan proteomic platform uses single-stranded DNA aptamers that measure 1129 protein concentrations in only 50 ?l plasma, serum or equally small amounts of a variety of other biological matrices. A complete list of the proteins is provided in Table 1. The SOMAscan platform is facilitated by a new generation of the Slow Off-rate Modified Aptamer (SOMAMER) reagents that benefit from the aptamer technology developed over the past 20 years (Tuerk et al., Science 249: 505-510 (1990); Ellington et al., Nature 346: 818-822 (1990)). The SOMAmer reagents are selected against proteins in their native folded conformations and bind to folded proteins and thus three-dimensional shape epitopes rather than linear peptide sequences. The SOMAscan platform offers a remarkably dynamic range, and this large dynamic range results from the detection range of each SOMAMER reagent in combination with three serial dilutions of the sample of interest. The dilutions are separated into three pools: the 40% (the most concentrated sample to detect the least abundant proteinsfM to pM in 100% sample), 1% (mid-range) and 0.005% (the least concentrated sample designs to detect the most abundant proteins??M in 100% sample). The assay readout is reported in relative fluorescent units (RFU) and is directly proportional to the target protein amount in the original sample. The details of the SOMAscan proteomics platform are described elsewhere (Gold et al., PLoS One 5: e15004 (2010); Hathout et al., Proc Natl Acad Sci USA 112: 7153-7158 (2015)).

    [0207] Proteomic profiling was performed using the SOMAscan platform based at the SomaLogic laboratory (Boulder, CO). The Human Plasma SOMAscan 1.1 k kit with a set of calibration and normalization samples was used following the manufacturer's recommended protocol. Data standardization was performed according to the SOMAscan platform data quality-control protocols. To standardize SOMAscan assay results, raw SOMAscan assay data was first normalized to remove hybridization variation within a run (hybridization normalization) followed by median signal normalization across all samples to remove other assay biases within the run and finally calibrated to remove assay differences between runs. The acceptance criteria for hybridization and median signal normalization scale factors are expected to be in the range of 0.4-2.5. The median of the calibration scale factors is expected to be within ?0.2 from 1.0 and a minimum of 95% of individual SOMAmer reagents in the total array must be within ?0.4 from the median. SOMAscan data from all samples passed quality control criteria and were fit for analysis.

    Technical Validation of SOMAmer Specificity by LC-MS/MS

    [0208] To systematically assess SOMAscan platform specificity, protocols using SOMAmer were developed for affinity pull-down of intact proteins followed by digestion to peptides and analysis by untargeted mass spectrometry. The FGF20 SOMAmer reagent was thawed, vortexed and spun down for 2 minutes (min), heated to 100? C. for 5 min in PCR machine, and then slowly cooled in 25? C. water bath. The FGF20 SOMAmer was diluted to 50 mM AB Buffer (40 mM HEPES, 100 mM NaCl, 5 mM KCl, 5 mM MgCl2, 0.05% Tween-20 at pH 7.5), and then cooled in a water bath to 25? C. for 20 min. Streptavidin Agarose beads were diluted from 50 mM to 7.5%, and then spun at 1000?g for 2 min. The 7.5% streptavidin agarose beads were washed with AB buffer, vortexed and centrifuged for 2 min at 1000?g. The liquid was vacuumed out and the washing was repeated once more for a total of two times. SOMAmers were added to the beads and incubated for 20 min with shaking at 25? C. The tubes were spun for 2 min at 1000?g and the liquid was removed by vacuum. The beads were washed twice with 0-W buffer, and then washed twice with AB Buffer. AB Buffer, plasma and serum samples, and recombinant proteins were added to the appropriate tubes, along with 30 ?l of SOMAmers bound beads. These tubes were shaken for 1.5 hours at room temperature. After the incubation was completed, the tubes were spun down for 1 minute and the liquid was removed. The samples were washed once with 1-B blocker, shaken for 5 min at 800 rpm, and the liquid was removed. The samples were washed 6 times with AB buffer, and then frozen at ?80? C. Four times the sample volume of acetone at ?20? C. was added to each tube. The tubes were quickly vortexed and incubated20? C. for 1 hour. The tubes were centrifuge for 10 min at 13,000?g, and the supernatant was vacuumed out.

    [0209] An equal volume of 0.5 M ammonium carbonate pH 10.5 was added to each set of washed beads. Another equal volume of reduction/alkylation cocktail consisting of 2% (v/v) iodoethanol and 0.5% (v/v) triethylphosphine in 97.5% acetonitrile was then added to each sample. The solutions were capped and incubated for 1 hour at 37? C., after which they were speed-vacuumed to dryness. The resulting pellets were then redissolved in a trypsin solution (Pierce Trypsin Protease MS-Grade, in 100 mM Tris-HCl, pH 8.0). The digestion was carried out at 37? C. overnight, after which the solutions were desalted using ?C18 ZipTips (Millipore). The digested samples were analyzed with a Thermo Q-Exactive mass spectrometer using a Thermo EASY-nLC HPLC system. The separation was carried out with a 75 ?m?15 cm Thermo EASY-Spray C18 column. MS data were collected in data dependent acquisition mode with a full high resolution MS scan followed by MS/MS scans of the top 10 most intense precursor ions (within a mass range of 350-2000 m/z).

    TABLE-US-00011 TABLE 1 A complete list of all proteins (n = 1,129) measured on the SOMAscan platform. Entrez Gene SomaID Target Target Full Name UniProt Symbol SL000002 VEGF Vascular endothelial growth factor A P15692 VEGFA SL000003 Angiogenin Angiogenin P03950 ANG SL000004 bFGF Fibroblast growth factor 2 P09038 FGF2 SL000006 PAI-1 Plasminogen activator inhibitor 1 P05121 SERPINE1 SL000007 ER Estrogen receptor P03372 ESR1 SL000009 ERBB2 Receptor tyrosine-protein kinase erbB-2 P04626 ERBB2 SL000017 VWF von Willebrand factor P04275 VWF SL000019 Apo A-I Apolipoprotein A-I P02647 APOA1 SL000020 Apo B Apolipoprotein B P04114 APOB SL000021 Insulin Insulin P01308 INS SL000022 D-dimer D-dimer P02671 FGA FGB FGG P02675 P02679 SL000024 TF Tissue Factor P13726 F3 SL000027 COX-2 Prostaglandin G/H synthase 2 P35354 PTGS2 SL000038 MCP-1 C-C motif chemokine 2 P13500 CCL2 SL000039 IL-8 Interleukin-8 P10145 CXCL8 SL000045 IGFBP-3 Insulin-like growth factor-binding P17936 IGFBP3 protein 3 SL000047 IGF-I Insulin-like growth factor I P05019 IGF1 SL000048 Protein C Vitamin K-dependent protein C P04070 PROC SL000049 Protein S Vitamin K-dependent protein S P07225 PROS1 SL000051 CRP C-reactive protein P02741 CRP SL000053 tPA Tissue-type plasminogen activator P00750 PLAT SL000055 Cadherin E Cadherin-1 P12830 CDH1 SL000057 Thymidine Thymidine kinase, cytosolic P04183 TK1 kinase SL000062 PSA Prostate-specific antigen P07288 KLK3 SL000064 Kallikrein 7 Kallikrein-7 P49862 KLK7 SL000070 Glypican 3 Glypican-3 P51654 GPC3 SL000076 p27Kip1 Cyclin-dependent kinase inhibitor 1B P46527 CDKN1B SL000087 IL-6 Interleukin-6 P05231 IL6 SL000088 TGF-b2 Transforming growth factor beta-2 P61812 TGFB2 SL000089 TGF-b3 Transforming growth factor beta-3 P10600 TGFB3 SL000104 Bc1-2 Apoptosis regulator Bcl-2 P10415 BCL2 SL000124 MMP-2 72 kDa type IV collagenase P08253 MMP2 SL000125 IL-1a Interleukin-1 alpha P01583 IL1A SL000130 Cyclin B1 G2/mitotic-specific cyclin-B1 P14635 CCNB1 SL000131 PCNA Proliferating cell nuclear antigen P12004 PCNA SL000133 MIP-3a C-C motif chemokine 20 P78556 CCL20 SL000134 Met Hepatocyte growth factor receptor P08581 MET SL000136 AREG Amphiregulin P15514 AREG SL000138 HB-EGF Heparin-binding EGF-like growth factor Q99075 HBEGF SL000139 EPI Epiregulin O14944 EREG SL000142 TS Thymidylate synthase P04818 TYMS SL000158 PSMA Glutamate carboxypeptidase 2 Q04609 FOLH1 SL000164 Myoglobin Myoglobin P02144 MB SL000247 6-Phospho- 6-phosphogluconate dehydrogenase, P52209 PGD gluconate de decarboxylate SL000248 a1-Antichymo- Alpha-1-antichymotrypsin P01011 SERPINA3 trypsin SL000249 a1- Alpha-1-antitrypsin P01009 SERPINA1 Antitrypsin SL000250 a2- Alpha-2-antiplasmin P08697 SERPINF2 Antiplasmin SL000251 a2-HS- Alpha-2-HS-glycoprotein P02765 AHSG Glycoprotein SL000252 a2-Macro- Alpha-2-macroglobulin P01023 A2M globulin SL000254 Albumin Serum albumin P02768 ALB SL000268 Angiostatin Angiostatin P00747 PLG SL000271 Angiotensinogen Angiotensinogen P01019 AGT SL000272 Antithrombin Antithrombin-III P01008 SERPINC1 III SL000276 Apo E Apolipoprotein E P02649 APOE SL000277 Apo E2 Apolipoprotein E (isoform E2) P02649 APOE SL000280 GOT1 Aspartate aminotransferase, cytoplasmic P17174 GOT1 SL000283 b2-Micro- Beta-2-microglobulin P61769 B2M globulin SL000299 b-ECGF Fibroblast growth factor 1 P05230 FGF1 SL000300 b-Endorphin Beta-endorphin P01189 POMC SL000305 b-NGF beta-nerve growth factor P01138 NGF SL000306 BNP-32 Brain natriuretic peptide 32 P16860 NPPB SL000308 C1-Esterase Plasma protease C1 inhibitor P05155 SERPING1 Inhibitor SL000309 C1q Complement C1q subcomponent P02745 CIQA C1QB P02746 P02747 SL000310 C1r Complement Clr subcomponent P00736 C1R SL000311 C1s Complement Cls subcomponent P09871 C1S SL000312 C3 Complement C3 P01024 C3 SL000313 C3a C3a anaphylatoxin P01024 C3 SL000314 C3b Complement C3b P01024 C3 SL000316 C4 Complement C4 P0C0L4 C4A C4B P0C0L5 SL000318 C4b Complement C4b P0C0L4 C4A C4B P0C0L5 SL000319 C5 Complement C5 P01031 C5 SL000320 C5a C5a anaphylatoxin P01031 C5 SL000321 C5b, 6 Complement C5b-C6 complex P01031 C5 C6 Complex P13671 SL000322 C6 Complement component C6 P13671 C6 SL000323 C7 Complement component C7 P10643 C7 SL000324 C8 Complement component C8 P07357 C8A C8B C8G P07358 P07360 SL000325 C9 Complement component C9 P02748 C9 SL000337 Calpain I Calpain I P07384 CAPN1 CAPNS P04632 SL000338 Calpastatin Calpastatin P20810 CAST SL000339 carbonic Carbonic anhydrase 2 P00918 CA2 anhydrase II SL000342 Catalase Catalase P04040 CAT SL000343 Cathepsin B Cathepsin B P07858 CTSB SL000344 Cathepsin D Cathepsin D P07339 CTSD SL000345 Cathepsin G Cathepsin G P08311 CTSG SL000346 Cathepsin H Cathepsin H P09668 CTSH SL000347 CBG Corticosteroid-binding globulin P08185 SERPINA6 SL000357 Coagulation Coagulation factor IX P00740 F9 Factor IX SL000358 Coagulation Coagulation Factor VII P08709 F7 Factor VI SL000360 Coagulation Coagulation Factor X P00742 F10 Factor X SL000377 CK-BB Creatine kinase B-type P12277 CKB SL000382 CK-MB Creatine kinase M-type:Creatine kinase P12277 CKB CKM B-type P06732 SL000383 CK-MM Creatine kinase M-type P06732 CKM SL000384 CTLA-4 Cytotoxic T-lymphocyte protein 4 P16410 CTLA4 SL000396 Cytochrome c Cytochrome c P99999 CYCS SL000398 Cytochrome Cytochrome P450 3A4 P08684 CYP3A4 P450 3A4 SL000401 Elastase Neutrophil elastase P08246 ELANE SL000403 Endostatin Endostatin P39060 COL18A1 SL000406 Eotaxin Eotaxin P51671 CCL11 SL000408 Epo Erythropoietin P01588 EPO SL000409 ERK-1 Mitogen-activated protein kinase 3 P27361 MAPK3 SL000414 Factor B Complement factor B P00751 CFB SL000415 Factor H Complement factor H P08603 CFH SL000420 Ferritin Ferritin P02794 FTH1 FTL P02792 SL000424 Fibrinogen Fibrinogen P02671 FGA FGB FGG P02675 P02679 SL000426 Fibronectin Fibronectin P02751 FN1 SL000427 Fractalkine/ Fractalkine P78423 CX3CL1 CX3CL-1 SL000428 FSH Follicle stimulating hormone P01215, CGA FSHB P01225 SL000433 Glucagon Glucagon P01275 GCG SL000437 Haptoglobin, Haptoglobin P00738 HP Mixed Ty SL000440 Hemopexin Hemopexin P02790 HPX SL000441 HGF Hepatocyte growth factor P14210 HGF SL000445 HIV-2 Rev Protein Rev_HV2BE P18093 Human-virus SL000449 HSP 40 DnaJ homolog subfamily B member 1 P25685 DNAJB1 SL000450 HSP 60 60 kDa heat shock protein, P10809 HSPD1 mitochondrial SL000451 HSP 70 Heat shock 70 kDa protein 1A/1B P08107 HSPA1A SL000456 iC3b Complement C3b, inactivated P01024 C3 SL000458 IFN-g R1 Interferon gamma receptor 1 P15260 IFNGR1 SL000460 IgD Immunoglobulin D P01880 IGHD IGK@ SL000461 IgE Immunoglobulin E P01854 IGHE IGK@ I SL000462 IGFBP-1 Insulin-like growth factor-binding P08833 IGFBP1 protein 1 SL000466 IGFBP-2 Insulin-like growth factor-binding P18065 IGFBP2 protein 2 SL000467 IgG Immunoglobulin G P01857 IGHG1 IGHG2 SL000468 IgM Immunoglobulin M P01871 IGHM IGJ IG SL000470 IL-11 Interleukin-11 P20809 IL11 SL000474 IL-16 Interleukin-16 Q14005 IL16 SL000478 IL-2 Interleukin-2 P60568 IL2 SL000479 IL-3 Interleukin-3 P08700 IL3 SL000480 IL-4 Interleukin-4 P05112 IL4 SL000481 IL-5 Interleukin-5 P05113 IL5 SL000483 IL-7 Interleukin-7 P13232 IL7 SL000493 LDH-H 1 L-lactate dehydrogenase B chain P07195 LDHB SL000496 Lactoferrin Lactotransferrin P02788 LTF SL000497 Laminin Laminin P25391 LAMA1 LAMB1 P07942 P11047 SL000498 Leptin Leptin P41159 LEP SL000506 Luteinizing Luteinizing hormone P01215 CGA LHB hormone P01229 SL000507 Lymphotoxin Lymphotoxin alpha1:beta2 P01374 LTA LTB a1/b2 Q06643 SL000508 Lymphotoxin Lymphotoxin alpha2:beta1 P01374 LTA LTB a2/b1 Q06643 SL000509 Lymphotoxin Tumor necrosis factor receptor P36941 LTBR b R superfamily me SL000510 Lysozyme Lysozyme C P61626 LYZ SL000515 MCP-2 C-C motif chemokine 8 P80075 CCL8 SL000516 MCP-3 C-C motif chemokine 7 P80098 CCL7 SL000517 MCP-4 C-C motif chemokine 13 Q99616 CCL13 SL000519 MIP-1a C-C motif chemokine 3 P10147 CCL3 SL000521 MMP-1 Interstitial collagenase P03956 MMP1 SL000522 MMP-12 Macrophage metalloelastase P39900 MMP12 SL000523 MMP-13 Collagenase 3 P45452 MMP13 SL000524 MMP-3 Stromelysin-1 P08254 MMP3 SL000525 MMP-7 Matrilysin P09237 MMP7 SL000526 MMP-8 Neutrophil collagenase P22894 MMP8 SL000527 MMP-9 Matrix metalloproteinase-9 P14780 MMP9 SL000528 NADPH- NADPH--cytochrome P450 reductase P16435 POR P450 Oxidoreduc SL000530 OSM Oncostatin-M P13725 OSM SL000532 ON SPARC P09486 SPARC SL000535 PDGF-AA Platelet-derived growth factor subunit A P04085 PDGFA SL000537 PDGF-BB Platelet-derived growth factor subunit B P01127 PDGFB SL000539 PHI Glucose-6-phosphate isomerase P06744 GPI SL000540 Plasmin Plasmin P00747 PLG SL000541 Plasminogen Plasminogen P00747 PLG SL000542 gpIIbIIIa Integrin alpha-IIb:beta-3 complex P08514 ITGA2B ITGB P05106 SL000545 Prekallikrein Plasma kallikrein P03952 KLKB1 SL000546 PRL Prolactin P01236 PRL SL000550 PCI Plasma serine protease inhibitor P05154 SERPINA5 SL000551 PKC-A Protein kinase C alpha type P17252 PRKCA SL000553 PKC-B-II Protein kinase C beta type P05771 PRKCB SL000554 PKC-D Protein kinase C delta type Q05655 PRKCD SL000556 PKC-G Protein kinase C gamma type P05129 PRKCG SL000557 PKC-Z Protein kinase C zeta type Q05513 PRKCZ SL000558 Prothrombin Prothrombin P00734 F2 SL000560 P-Selectin P-Selectin P16109 SELP SL000563 RANTES C-C motif chemokine 5 P13501 CCL5 SL000565 Renin Renin P00797 REN SL000566 RBP Retinol-binding protein 4 P02753 RBP4 SL000570 Secretin Secretin P09683 SCT SL000572 SAA Serum amyloid A-1 protein P0DJI8 SAA1 SL000573 SAP Serum amyloid P-component P02743 APCS SL000581 SOD Superoxide dismutase [CuZn] P00441 SOD1 SL000582 Survivin Baculoviral IAP repeat-containing O15392 BIRC5 protein 5 SL000584 TGF-b1 Transforming growth factor beta-1 P01137 TGFB1 SL000586 Thrombin Thrombin P00734 F2 SL000587 Thyroglobulin Thyroglobulin P01266 TG SL000588 TMA Thyroid peroxidase P07202 TPO SL000589 TSH Thyroid Stimulating Hormone P01215 CGA TSHB P01222 SL000590 Thyroxine- Thyroxine-Binding Globulin P05543 SERPINA7 Binding Globulin SL000591 TIMP-1 Metalloproteinase inhibitor 1 P01033 TIMP1 SL000592 TIMP-2 Metalloproteinase inhibitor 2 P16035 TIMP2 SL000597 TNF-b Lymphotoxin-alpha P01374 LTA SL000601 Transferrin Serotransferrin P02787 TF SL000603 Trypsin Trypsin-1 P07477 PRSS1 SL000605 Ubiquitin + 1 Ubiquitin + 1, truncated mutation for UbB P62979 RPS27A SL000613 uPA Urokinase-type plasminogen activator P00749 PLAU SL000615 Vasoactive Vasoactive Intestinal Peptide P01282 VIP Intestinal SL000617 ALT Alanine aminotransferase 1 P24298 GPT SL000622 Coagulation Coagulation Factor V P12259 F5 Factor V SL000633 Fas ligand, Tumor necrosis factor ligand P48023 FASLG soluble superfamily member 6, soluble form SL000638 Cadherin-2 Cadherin-2 P19022 CDH2 SL000640 Nidogen Nidogen-1 P14543 NID1 SL000645 MMP-10 Stromelysin-2 P09238 MMP10 SL000655 Keratin 18 Keratin, type I cytoskeletal 18 P05783 KRT18 SL000658 GAS1 Growth arrest-specific protein 1 P54826 GAS1 SL000668 CD36 Platelet glycoprotein 4 P16671 CD36 ANTIGEN SL000670 GSTA3 Glutathione S-transferase A3 Q16772 GSTA3 SL000674 FST Follistatin P19883 FST SL000678 Granulysin Granulysin P22749 GNLY SL000695 Lipocalin 2 Neutrophil gelatinase-associated P80188 LCN2 lipocalin SL000836 Hemoglobin Hemoglobin P69905, HBA1 HBB P68871 SL001691 FGF7 Fibroblast growth factor 7 P21781 FGF7 SL001713 IL-17 Interleukin-17A Q16552 IL17A SL001716 IL-12 Interleukin-12 P29459, IL12A IL12B P29460 SL001717 IL-10 Interleukin-10 P22301 IL10 SL001718 IL-13 Interleukin-13 P35225 IL13 SL001720 VCAM-1 Vascular cell adhesion protein 1 P19320 VCAM1 SL001721 PECAM-1 Platelet endothelial cell adhesion P16284 PECAM1 molecule SL001726 GM-CSF Granulocyte-macrophage colony- P04141 CSF2 stimulating factor SL001729 G-CSF Granulocyte colony-stimulating factor P09919 CSF3 SL001737 STRATIFIN 14-3-3 protein sigma P31947 SFN SL001753 Sialoadhesin Sialoadhesin Q9BZZ2 SIGLEC1 SL001761 Troponin I Troponin I, cardiac muscle P19429 TNNI3 SL001766 HCG Human Chorionic Gonadotropin P01215, CGA CGB P01233 SL001774 FABP Fatty acid-binding protein, heart P05413 FABP3 SL001777 Cystatin C Cystatin-C P01034 CST3 SL001795 IL-1b Interleukin-1 beta P01584 IL1B SL001796 Myeloper- Myeloperoxidase P05164 MPO oxidase SL001797 Kallikrein 6 Kallikrein-6 Q92876 KLK6 SL001800 TNF sR-II Tumor necrosis factor receptor P20333 TNFRSF1B superfamily member 1B SL001802 IFN-g Interferon gamma P01579 IFNG SL001815 Mn SOD Superoxide dismutase [Mn], P04179 SOD2 mitochondrial SL001888 SLPI Antileukoproteinase P03973 SLPI SL001890 GA733-1 Tumor-associated calcium signal P09758 TACSTD2 protein transducer 2 SL001896 Clusterin Clusterin P10909 CLU SL001897 SPINT2 Kunitz-type protease inhibitor 2 O43291 SPINT2 SL001902 BCAM Basal Cell Adhesion Molecule P50895 BCAM SL001905 Mesothelin Mesothelin Q13421 MSLN SL001938 Activin A Inhibin beta A chain P08476 INHBA SL001943 IL-6 sRa Interleukin-6 receptor subunit alpha P08887 IL6R SL001945 sE-Selectin E-Selectin P16581 SELE SL001947 MIA Melanoma-derived growth regulatory Q16674 MIA protein SL001973 Mammaglobin 2 Mammaglobin-B O75556 SCGB2A1 SL001992 TNF sR-I Tumor necrosis factor receptor P19438 TNFRSF1A superfamily member 1A SL001995 Angiopoietin-1 Angiopoietin-1 Q15389 ANGPT1 SL001996 Angiopoietin-2 Angiopoietin-2 O15123 ANGPT2 SL001997 IL-1 sRI Interleukin-1 receptor type 1 P14778 IL1R1 SL001998 TFPI Tissue factor pathway inhibitor P10646 TFPI SL001999 MDM2 E3 ubiquitin-protein ligase Mdm2 Q00987 MDM2 SL002036 FGFR4 Fibroblast growth factor receptor 4 P22455 FGFR4 SL002075 IFN-aA Interferon alpha-2 P01563 IFNA2 SL002077 Alkaline Alkaline phosphatase, tissue-nonspecific P05186 ALPL phosphatase, isozyme bone SL002078 TGF-b R II TGF-beta receptor type-2 P37173 TGFBR2 SL002081 Cadherin-5 Cadherin-5 P33151 CDH5 SL002086 Ficolin-3 Ficolin-3 O75636 FCN3 SL002093 Histone Histone H2A.z P0C0S5 H2AFZ H2A.z SL002505 ANP Atrial natriuretic factor P01160 NPPA SL002506 suPAR Urokinase plasminogen activator surface Q03405 PLAUR receptor SL002508 IL-18 BPa Interleukin-18-binding protein O95998 IL18BP SL002517 TNF-a Tumor necrosis factor P01375 TNF SL002519 ERBB3 Receptor tyrosine-protein kinase erbB-3 P21860 ERBB3 SL002522 Rb Retinoblastoma-associated protein P06400 RB1 SL002524 sCD4 T-cell surface glycoprotein CD4 P01730 CD4 SL002525 C2 Complement C2 P06681 C2 SL002528 NPS-PLA2 Phospholipase A2, membrane associated P14555 PLA2G2A SL002539 OPG Tumor necrosis factor receptor O00300 TNFRSF11B superfamily me SL002541 sRANKL Tumor necrosis factor ligand O14788 TNFSF11 superfamily member 11 SL002542 K-ras GTPase KRas P01116 KRAS SL002561 PTHrP Parathyroid hormone-related protein P12272 PTHLH SL002621 Midkine Midkine P21741 MDK SL002640 PlGF Placenta growth factor P49763 PGF SL002644 ERBB1 Epidermal growth factor receptor P00533 EGFR SL002646 MMP-14 Matrix metalloproteinase-14 P50281 MMP14 SL002650 M2-PK Pyruvate kinase PKM P14618 PKM2 SL002654 Epithelial Ephrin type-A receptor 2 P29317 EPHA2 cell kinas SL002655 CTGF Connective tissue growth factor P29279 CTGF SL002662 Coagulation Coagulation Factor XI P03951 F11 Factor XI SL002684 CSF-1 Macrophage colony-stimulating factor 1 P09603 CSF1 SL002695 Glutamate Cytosolic non-specific dipeptidase Q96KP4 CNDP2 carboxy- peptidase SL002702 PIM1 Serine/threonine-protein kinase pim-1 P11309 PIM1 SL002704 PTN Pleiotrophin P21246 PTN SL002705 Thrombo- Thrombospondin-1 P07996 THBS1 spondin-1 SL002706 CD23 Low affinity immunoglobulin epsilon Fc P06734 FCER2 receptor SL002755 PAPP-A Pappalysin-1 Q13219 PAPPA SL002756 hnRNP K Heterogeneous nuclear P61978 HNRNPK ribonucleoprotein K SL002763 Kallikrein 11 Kallikrein-11 Q9UBX7 KLK11 SL002783 Cardiotrophin-1 Cardiotrophin-1 Q16619 CTF1 SL002792 BARK1 beta-adrenergic receptor kinase 1 P25098 ADRBK1 SL002803 PGP9.5 Ubiquitin carboxyl-terminal hydrolase P09936 UCHL1 isozyme SL002823 sL-Selectin L-Selectin P14151 SELL SL002922 sICAM-1 Intercellular adhesion molecule 1 P05362 ICAM1 SL003041 PF-4 Platelet factor 4 P02776 PF4 SL003043 TIMP-3 Metalloproteinase inhibitor 3 P35625 TIMP3 SL003060 bFGF-R Fibroblast growth factor receptor 1 P11362 FGFR1 SL003080 MIF Macrophage migration inhibitory factor P14174 MIF SL003104 Eotaxin-2 C-C motif chemokine 24 O00175 CCL24 SL003166 ALCAM CD166 antigen Q13740 ALCAM SL003167 BLC C-X-C motif chemokine 13 O43927 CXCL13 SL003168 CTACK C-C motif chemokine 27 Q9Y4X3 CCL27 SL003169 ENA-78 C-X-C motif chemokine 5 P42830 CXCL5 SL003171 FGF-4 Fibroblast growth factor 4 P08620 FGF4 SL003172 GCP-2 C-X-C motif chemokine 6 P80162 CXCL6 SL003173 Gro-a Growth-regulated alpha protein P09341 CXCL1 SL003176 I-309 C-C motif chemokine 1 P22362 CCL1 SL003177 sICAM-2 Intercellular adhesion molecule 2 P13598 ICAM2 SL003178 sICAM-3 Intercellular adhesion molecule 3 P32942 ICAM3 SL003179 Integrin Integrin alpha-I:beta-1 complex P56199 ITGA1 ITGB1 a1b1 P05556 SL003182 Integrin Integrin alpha-V:beta-5 complex P06756 ITGAV ITGB5 aVb5 P18084 SL003183 IP-10 C-X-C motif chemokine 10 P02778 CXCL10 SL003184 sLeptin R Leptin receptor P48357 LEPR SL003186 Lymphotactin Lymphotactin P47992 XCL1 SL003187 MDC C-C motif chemokine 22 O00626 CCL22 SL003189 MIP-3b C-C motif chemokine 19 Q99731 CCL19 SL003190 MIP-5 C-C motif chemokine 15 Q16663 CCL15 SL003191 NAP-2 Neutrophil-activating peptide 2 P02775 PPBP SL003192 Properdin Properdin P27918 CFP SL003193 6Ckine C-C motif chemokine 21 O00585 CCL21 SL003196 TARC C-C motif chemokine 17 Q92583 CCL17 SL003197 TECK C-C motif chemokine 25 O15444 CCL25 SL003198 Tenascin Tenascin P24821 TNC SL003199 sTie-1 Tyrosine-protein kinase receptor Tie-1, P35590 TIE1 soluble SL003200 sTie-2 Angiopoietin-1 receptor, soluble Q02763 TEK SL003201 VEGF sR2 Vascular endothelial growth factor P35968 KDR receptor 2 SL003220 C3adesArg C3a anaphylatoxin des Arginine P01024 C3 SL003280 HMG-1 High mobility group protein B1 P09429 HMGB1 SL003300 HCC-4 C-C motif chemokine 16 O15467 CCL16 SL003301 Ck-b-8-1 Ck-beta-8-1 P55773 CCL23 SL003302 MPIF-1 C-C motif chemokine 23 P55773 CCL23 SL003303 CCL28 C-C motif chemokine 28 Q9NRJ3 CCL28 SL003304 IGF-I sR Insulin-like growth factor 1 receptor P08069 IGF1R SL003305 IL-2 sRa Interleukin-2 receptor subunit alpha P01589 IL2RA SL003307 IL-2 sRg Cytokine receptor common subunit P31785 IL2RG gamma SL003308 IL-4 sR Interleukin-4 receptor subunit alpha P24394 IL4R SL003309 LBP Lipopolysaccharide-binding protein P18428 LBP SL003310 VEGF121 Vascular endothelial growth factor A, P15692 VEGFA isoform SL003322 VEGF sR3 Vascular endothelial growth factor P35916 FLT4 receptor 3 SL003323 PARC C-C motif chemokine 18 P55774 CCL18 SL003324 Coagulation Coagulation factor Xa P00742 F10 Factor Xa SL003326 I-TAC C-X-C motif chemokine 11 O14625 CXCL11 SL003327 Factor D Complement factor D P00746 CFD SL003328 Factor I Complement factor I P05156 CFI SL003329 HCC-1 C-C motif chemokine 14 Q16627 CCL14 SL003331 MMP-16 Matrix metalloproteinase-16 P51512 MMP16 SL003332 MMP-17 Matrix metalloproteinase-17 Q9ULZ9 MMP17 SL003334 EMAP-2 Endothelial monocyte-activating Q12904 AIMP1 polypeptide 2 SL003341 Fibrinogen Fibrinogen gamma chain P02679 FGG g-chain di SL003362 C3d Complement C3d fragment P01024 C3 SL003440 PAFAH Platelet-activating factor acetylhydrolase Q13093 PLA2G7 SL003461 ACTH Corticotropin P01189 POMC SL003520 calreticulin Calreticulin P27797 CALR SL003522 ERP29 Endoplasmic reticulum resident protein P30040 ERP29 29 SL003524 Protein Protein disulfide-isomerase A3 P30101 PDIA3 disulfide iso SL003542 NG36 Histone-lysine N-methyltransferase Q96KQ7 EHMT2 EHMT2 SL003643 Glutathione Glutathione S-transferase P P09211 GSTP1 S-transfe SL003647 annexin VI Annexin A6 P08133 ANXA6 SL003648 Rab GDP Rab GDP dissociation inhibitor beta P50395 GDI2 dissociation SL003653 phospho- Phosphoglycerate kinase 1 P00558 PGK1 glycerate kina SL003655 Transketolase Transketolase P29401 TKT SL003657 Calcineurin Calcineurin Q08209 PPP3CA PPP3 P63098 SL003658 Aflatoxin B1 Aflatoxin B1 aldehyde reductase O43488 AKR7A2 aldehyde member 2 SL003674 BCL2-like Bcl-2-like protein 1 Q07817 BCL2L1 1 protein SL003679 IGF-II Cation-independent mannose-6- P11717 IGF2R receptor phosphate recept SL003680 sRAGE Advanced glycosylation end product- Q15109 AGER specific r SL003685 PBEF Nicotinamide phosphoribosyltransferase P43490 NAMPT SL003687 Nucleoside Nucleoside diphosphate kinase A P15531 NME1 diphosphate kinase A SL003690 RANK Tumor necrosis factor receptor Q9Y6Q6 TNFRSF11A superfamily member 11A SL003703 BFL1 Bcl-2-related protein A1 Q16548 BCL2A1 SL003710 Caspase-2 Caspase-2 P42575 CASP2 SL003711 Caspase-3 Caspase-3 P42574 CASP3 SL003717 Caspase-10 Caspase-10 Q92851 CASP10 SL003726 Chk2 Serine/threonine-protein kinase Chk2 O96017 CHEK2 SL003728 cIAP-2 Baculoviral IAP repeat-containing Q13489 BIRC3 protein 3 SL003733 SMAC Diablo homolog, mitochondrial Q9NR28 DIABLO SL003735 4-1BB Tumor necrosis factor ligand P41273 TNFSF9 ligand superfamily member 9 SL003738 B7 T-lymphocyte activation antigen CD80 P33681 CD80 SL003739 DcR3 Tumor necrosis factor receptor O95407 TNFRSF6B superfamily me SL003744 Galectin-3 Galectin-3 P17931 LGALS3 SL003753 DLC8 Dynein light chain 1, cytoplasmic P63167 DYNLL1 SL003761 pTEN Phosphatidylinositol 3,4,5-trisphosphate P60484 PTEN 3-ph SL003764 NCAM-120 Neural cell adhesion molecule 1, 120 P13591 NCAM1 kDa isoform SL003770 SARP-2 Secreted frizzled-related protein 1 Q8N474 SFRP1 SL003785 GAPDH, Glyceraldehyde-3-phosphate P04406 GAPDH liver dehydrogenase SL003793 MEK1 Dual specificity mitogen-activated Q02750 MAP2K1 protein kinase SL003800 Kallikrein 4 Kallikrein-4 Q9Y5K2 KLK4 SL003803 ERBB4 Receptor tyrosine-protein kinase erbB-4 Q15303 ERBB4 SL003849 FGF9 Fibroblast growth factor 9 P31371 FGF9 SL003862 CD40 CD40 ligand P29965 CD40LG ligand, soluble SL003863 kallikrein 5 Kallikrein-5 Q9Y337 KLK5 SL003872 gp130, Interleukin-6 receptor subunit beta P40189 IL6ST soluble SL003915 kallikrein 8 Kallikrein-8 O60259 KLK8 SL003916 kallikrein 12 Kallikrein-12 Q9UKR0 KLK12 SL003918 kallikrein 13 Kallikrein-13 Q9UKR3 KLK13 SL003919 kallikrein 14 Kallikrein-14 Q9P0G3 KLK14 SL003930 HPG- 15-hydroxyprostaglandin dehydrogenase P15428 HPGD [NAD(+)] SL003951 BDNF Brain-derived neurotrophic factor P23560 BDNF SL003970 PTH Parathyroid hormone P01270 PTH SL003974 Activated Activated Protein C P04070 PROC Protein C SL003990 FGFR-2 Fibroblast growth factor receptor 2 P21802 FGFR2 SL003993 BMP-6 Bone morphogenetic protein 6 P22004 BMP6 SL003994 BMP-1 Bone morphogenetic protein 1 P13497 BMP1 SL004008 Proteinase-3 Myeloblastin P24158 PRTN3 SL004009 RAC1 Ras-related C3 botulinum toxin substrate P63000 RAC1 1 SL004010 SCF sR Mast/stem cell growth factor receptor P10721 KIT Kit SL004015 TAFI Carboxypeptidase B2 Q96IY4 CPB2 SL004016 CXCL16, C-X-C motif chemokine 16 Q9H2A7 CXCL16 soluble SL004060 Endothelin- Endothelin-converting enzyme 1 P42892 ECE1 converting SL004063 FGFR-3 Fibroblast growth factor receptor 3 P22607 FGFR3 SL004064 GIB Phospholipase A2 P04054 PLA2G1B SL004066 GIIE Group IIE secretory phospholipase A2 Q9NZK7 PLA2G2E SL004067 GX Group 10 secretory phospholipase A2 O15496 PLA2G10 SL004068 Granzyme B Granzyme B P10144 GZMB SL004070 Ubiquitin Ubiquitin P62979 RPS27A SL004078 BMP-7 Bone morphogenetic protein 7 P18075 BMP7 SL004080 BMPR1A Bone morphogenetic protein receptor P36894 BMPR1A type-1A SL004081 Bone Decorin P07585 DCN proteoglycan II SL004118 TrATPase Tartrate-resistant acid phosphatase type P13686 ACP5 5 SL004119 discoidin Epithelial discoidin domain-containing Q08345 DDR1 domain receptor 1 receptor 1 SL004120 Discoidin Discoidin domain-containing receptor 2 Q16832 DDR2 domain receptor 2 SL004125 IR Insulin receptor P06213 INSR SL004126 4-1BB Tumor necrosis factor receptor Q07011 TNFRSF9 superfamily member 9 SL004128 Activin RIB Activin receptor type-1B P36896 ACVR1B SL004131 B7-2 T-lymphocyte activation antigen CD86 P42081 CD86 SL004133 BMP RII Bone morphogenetic protein receptor Q13873 BMPR2 type-2 SL004134 CD27 CD27 antigen P26842 CD27 SL004136 Dtk Tyrosine-protein kinase receptor TYRO3 Q06418 TYRO3 SL004137 EphA1 Ephrin type-A receptor 1 P21709 EPHA1 SL004140 Ephrin-A4 Ephrin-A4 P52798 EFNA4 SL004141 Ephrin-A5 Ephrin-A5 P52803 EFNA5 SL004142 Ephrin-B3 Ephrin-B3 Q15768 EFNB3 SL004143 GFRa-2 GDNF family receptor alpha-2 O00451 GFRA2 SL004144 GFRa-3 GDNF family receptor alpha-3 O60609 GFRA3 SL004145 HVEM Tumor necrosis factor receptor Q92956 TNFRSF14 superfamily member 14 SL004146 IL-1 R4 Interleukin-1 receptor-like 1 Q01638 IL1RL1 SL004147 IL-10 Rb Interleukin-10 receptor subunit beta Q08334 IL10RB SL004148 IL-12 Rb1 Interleukin-12 receptor subunit beta-1 P42701 IL12RB1 SL004149 IL-13 Ra1 Interleukin-13 receptor subunit alpha-1 P78552 IL13RA1 SL004151 IL-15 Ra Interleukin-15 receptor subunit alpha Q13261 IL15RA SL004152 IL-18 Ra Interleukin-18 receptor 1 Q13478 IL18R1 SL004153 M-CSF R Macrophage colony-stimulating factor 1 P07333 CSF1R receptor SL004154 NCAM-L1 Neural cell adhesion molecule L1 P32004 L1CAM SL004155 PDGF Rb Platelet-derived growth factor receptor P09619 PDGFRB beta SL004156 TRAIL R1 Tumor necrosis factor receptor O00220 TNFRSF10A superfamily member 10A SL004160 TrkB BDNF/NT-3 growth factors receptor Q16620 NTRK2 SL004180 CD30 Tumor necrosis factor receptor P28908 TNFRSF8 superfamily member 8 SL004182 GV Calcium-dependent phospholipase A2 P39877 PLA2G5 SL004183 P-Cadherin Cadherin-3 P22223 CDH3 SL004208 annexin I Annexin A1 P04083 ANXA1 SL004209 annexin II Annexin A2 P07355 ANXA2 SL004230 tau Microtubule-associated protein tau P10636 MAPT SL004253 17-beta- Estradiol 17-beta-dehydrogenase 1 P14061 HSD17B1 HSD 1 SL004258 Adiponectin Adiponectin Q15848 ADIPOQ SL004260 resistin Resistin Q9HD89 RETN SL004271 GFAP Glial fibrillary acidic protein P14136 GFAP SL004296 Myokinase, Adenylate kinase isoenzyme 1 P00568 AK1 human SL004298 granzyme A Granzyme A P12544 GZMA SL004299 Livin B Baculoviral IAP repeat-containing Q96CA5 BIRC7 protein 7 I SL004301 Ku70 X-ray repair cross-complementing P12956 XRCC6 protein 6 SL004304 STX1a Syntaxin-1A Q16623 STX1A SL004305 Topoisomerase I DNA topoisomerase 1 P11387 TOP1 SL004306 UBC9 SUMO-conjugating enzyme UBC9 P63279 UBE2I SL004326 TNFSF18 Tumor necrosis factor ligand Q9UNG2 TNFSF18 superfamily member 18 SL004327 BAFF Tumor necrosis factor ligand Q9Y275 TNFSF13B superfamily member 13B SL004329 BMP-14 Growth/differentiation factor 5 P43026 GDF5 SL004330 CD22 B-cell receptor CD22 P20273 CD22 SL004331 CNTF Ciliary Neurotrophic Factor P26441 CNTF SL004332 EG-VEGF Prokineticin-1 P58294 PROK1 SL004333 FGF-10 Fibroblast growth factor 10 O15520 FGF10 SL004334 FGF-16 Fibroblast growth factor 16 O43320 FGF16 SL004335 FGF-17 Fibroblast growth factor 17 O60258 FGF17 SL004336 FGF-18 Fibroblast growth factor 18 O76093 FGF18 SL004337 FGF-19 Fibroblast growth factor 19 O95750 FGF19 SL004338 FGF-20 Fibroblast growth factor 20 Q9NP95 FGF20 SL004339 FGF-5 Fibroblast growth factor 5 P12034 FGF5 SL004340 FGF-6 Fibroblast growth factor 6 P10767 FGF6 SL004342 FGF-8B Fibroblast growth factor 8 isoform B P55075 FGF8 SL004343 Flt3 ligand Fms-related tyrosine kinase 3 ligand P49771 FLT3LG SL004345 GDF-11 Growth/differentiation factor 11 O95390 GDF11 SL004346 IL-20 Interleukin-20 Q9NYY1 IL20 SL004347 IL-22 Interleukin-22 Q9GZX6 IL22 SL004348 IFN-lambda 1 Interferon lambda-1 Q8IU54 IFNL1 SL004349 IFN-lambda 2 Interferon lambda-2 Q8IZJ0 IFNL2 SL004350 IL-17B Interleukin-17B Q9UHF5 IL17B SL004351 IL-17E Interleukin-25 Q9H293 IL25 SL004352 IL-17F Interleukin-17F Q96PD4 IL17F SL004353 IL-17D Interleukin-17D Q8TAD2 IL17D SL004354 IL-19 Interleukin-19 Q9UHD0 IL19 SL004355 LD78-beta C-C motif chemokine 3-like 1 P16619 CCL3L1 SL004356 LAG-1 C-C motif chemokine 4-like Q8NHW4 CCL4L1 SL004359 Neurotrophin-3 Neurotrophin-3 P20783 NTF3 SL004360 Neurotrophin-5 Neurotrophin-4 P34130 NTF4 SL004362 SCGF-beta Stem Cell Growth Factor-beta Q9Y240 CLEC11A SL004363 SCGF- Stem Cell Growth Factor-alpha Q9Y240 CLEC11A alpha SL004364 TACI Tumor necrosis factor receptor O14836 TNFRSF13B superfamily member 13B SL004365 TWEAK Tumor necrosis factor ligand O43508 TNFSF12 superfamily member 12 SL004366 TWEAKR Tumor necrosis factor receptor Q9NP84 TNFRSF12A superfamily member 12A SL004367 DKK1 Dickkopf-related protein 1 O94907 DKK1 SL004400 Coagulation Coagulation factor IXab P00740 F9 Factor IX SL004415 ACE2 Angiotensin-converting enzyme 2 Q9BYF1 ACE2 SL004438 Cystatin M Cystatin-M Q15828 CST6 SL004457 Protease Glia-derived nexin P07093 SERPINE2 nexin I SL004458 Elafin Elafin P19957 PI3 SL004466 Heparin Heparin cofactor 2 P05546 SERPIND1 cofactor II SL004469 amyloid Amyloid beta A4 protein P05067 APP precursor pro SL004477 calgranulin B Protein S100-A9 P06702 S100A9 SL004482 Endoglin Endoglin P17813 ENG SL004484 SP-D Pulmonary surfactant-associated protein P35247 SFTPD D SL004486 VEGF-C Vascular endothelial growth factor C P49767 VEGFC SL004492 TLR2 Toll-like receptor 2 O60603 TLR2 SL004511 BPI Bactericidal permeability-increasing P17213 BPI protein SL004515 PGRP-S Peptidoglycan recognition protein 1 O75594 PGLYRP1 SL004516 MBL Mannose-binding protein C P11226 MBL2 SL004536 LEAP-1 Hepcidin P81172 HAMP SL004556 DAF Complement decay-accelerating factor P08174 CD55 SL004579 Macrophage Macrophage mannose receptor 1 P22897 MRC1 mannose re SL004580 Macrophage Macrophage scavenger receptor types I P21757 MSR1 scavenger and II SL004588 IL-1 R AcP Interleukin-1 Receptor accessory protein Q9NPH3 IL1RAP SL004589 Azurocidin Azurocidin P20160 AZU1 SL004591 G-CSF-R Granulocyte colony-stimulating factor Q99062 CSF3R receptor SL004594 Troponin I, Troponin I, fast skeletal muscle P48788 TNNI2 skeletal, SL004605 40S 40S ribosomal protein SA P08865 RPSA ribosomal protein SL004610 LRP8 Low-density lipoprotein receptor-related Q14114 LRP8 protein 8 SL004625 ADAMTS-4 A disintegrin and metalloproteinase with O75173 ADAMTS4 thrombospondin motifs 4 SL004626 ADAMTS-5 A disintegrin and metalloproteinase with Q9UNA0 ADAMTS5 thro SL004635 CD30 Tumor necrosis factor ligand P32971 TNFSF8 Ligand superfamily member 8 SL004636 Flt-3 Receptor-type tyrosine-protein kinase P36888 FLT3 FLT3 SL004637 MSP R Macrophage-stimulating protein receptor Q04912 MST1R SL004639 TrkC NT-3 growth factor receptor Q16288 NTRK3 SL004642 ADAM 9 Disintegrin and metalloproteinase Q13443 ADAM9 domain-containing protein 9 SL004643 Angiopoietin-4 Angiopoietin-4 Q9Y264 ANGPT4 SL004644 EDA Ectodysplasin-A, secreted form Q92838 EDA SL004645 HAI-1 Kunitz-type protease inhibitor 1 O43278 SPINT1 SL004646 Layilin Layilin Q6UX15 LAYN SL004648 LIGHT Tumor necrosis factor ligand O43557 TNFSF14 superfamily member 14 SL004649 OX40 Tumor necrosis factor ligand P23510 TNFSF4 Ligand superfamily member 4 SL004650 sFRP-3 Secreted frizzled-related protein 3 Q92765 FRZB SL004652 WIF-1 Wnt inhibitory factor 1 Q9Y5W5 WIF1 SL004654 Granzyme H Granzyme H P20718 GZMH SL004660 BSP Bone sialoprotein 2 P21815 IBSP SL004661 Aggrecan Aggrecan core protein P16112 ACAN SL004668 Apo E3 Apolipoprotein E (isoform E3) P02649 APOE SL004669 Apo E4 Apolipoprotein E (isoform E4) P02649 APOE SL004670 Artemin Artemin Q5T4W7 ARTN SL004671 BAFF Tumor necrosis factor receptor Q96RJ3 TNFRSF13C Receptor superfamily member 13C SL004672 BCMA Tumor necrosis factor receptor Q02223 TNFRSF17 superfamily member 17 SL004673 Cathepsin S Cathepsin S P25774 CTSS SL004676 IGFBP-5 Insulin-like growth factor-binding P24593 IGFBP5 protein 5 SL004683 Noggin Noggin Q13253 NOG SL004685 Persephin Persephin O60542 PSPN SL004686 TNFSF15 Tumor necrosis factor ligand O95150 TNFSF15 superfamily member 15 SL004687 TSLP Thymic stromal lymphopoietin Q969D9 TSLP SL004689 WISP-1 WNT1-inducible-signaling pathway O95388 WISP1 protein 1 SL004692 CLF-1/CLC Cytokine receptor-like factor O75462 CRLF1 CLCF1 Complex 1:Cardiotrophin Q9UBD9 SL004697 HPV E7 Protein E7_HPV16 P03129 Human-virus Type 16 SL004698 HPV E7 Protein E7_HPV18 P06788 Human-virus Type18 SL004704 COMMD7 COMM domain-containing protein 7 Q86VX2 COMMD7 SL004708 CTAP-III Connective tissue-activating peptide III P02775 PPBP SL004712 SDF-1 Stromal cell-derived factor 1 P48061 CXCL12 SL004714 LIF sR Leukemia inhibitory factor receptor P42702 LIFR SL004716 JNK2 Mitogen-activated protein kinase 9 P45984 MAPK9 SL004718 Karyopherin- Importin subunit alpha-1 P52292 KPNA2 a2 SL004720 Calcineurin Calcineurin subunit B type 1 P63098 PPP3R1 Ba SL004723 HDAC8 Histone deacetylase 8 Q9BY41 HDAC8 SL004724 MOZ Histone acetyltransferase KAT6A Q92794 KAT6A SL004725 Hat1 Histone acetyltransferase type B O14929 HAT1 catalytic subunit SL004726 CD97 CD97 antigen P48960 CD97 SL004737 Tropomyosin Tropomyosin alpha-1 chain P09493 TPM1 1 alpha chain SL004739 ITI heavy Inter-alpha-trypsin inhibitor heavy chain Q14624 ITIH4 chain H4 H4 SL004742 Afamin Afamin P43652 AFM SL004750 DEAD-box ATP-dependent RNA helicase DDX19B Q9UMR2 DDX19B protein 19B SL004751 HO-2 Heme oxygenase 2 P30519 HMOX2 SL004752 DRR1 Protein FAM107A O95990 FAM107A SL004757 DRG-1 Vacuolar protein sorting-associated Q9NP79 VTA1 protein V SL004759 eIF-5 Eukaryotic translation initiation factor 5 P55010 EIF5 SL004760 PAFAH Platelet-activating factor acetylhydrolase P68402 PAFAH1B2 beta subunit IB SL004765 MAPKAPK3 MAP kinase-activated protein kinase 3 Q16644 MAPKAPK3 SL004768 AIF1 Allograft inflammatory factor 1 P55008 AIF1 SL004771 Aurora Aurora kinase A O14965 AURKA kinase A SL004781 CSK Tyrosine-protein kinase CSK P41240 CSK SL004782 TSG-6 Tumor necrosis factor-inducible gene 6 P98066 TNFAIP6 protein SL004791 DR3 Tumor necrosis factor receptor Q93038 TNFRSF25 superfamily member 25 SL004795 ERAB 3-hydroxyacyl-CoA dehydrogenase Q99714 HSD17B10 type-2 SL004804 Nectin-like Cell adhesion molecule 3 Q8N126 CADM3 protein 1 SL004805 Nectin-like Cell adhesion molecule 1 Q9BY67 CADM1 protein 2 SL004812 Triosephosphate Triosephosphate isomerase P60174 TPI1 isomese SL004814 Coactosin- Coactosin-like protein Q14019 COTL1 like protein SL004820 Phosphoglycerate Phosphoglycerate mutase 1 P18669 PGAM1 mutase 1 SL004823 Cyclophilin A Peptidyl-prolyl cis-trans isomerase A P62937 PPIA SL004837 Activin AB Inhibin beta A chain:Inhibin beta B P08476 INHBA INHBB chain heterodimer P09529 SL004844 EphA5 Ephrin type-A receptor 5 P54756 EPHA5 SL004845 EphB4 Ephrin type-B receptor 4 P54760 EPHB4 SL004849 IL-1 sR9 X-linked interleukin-1 receptor Q9NP60 IL1RAPL2 accessory protein-like 2 SL004850 IL-17 sR Interleukin-17 receptor A Q96F46 IL17RA SL004851 ALK-1 Serine/threonine-protein kinase receptor P37023 ACVRL1 R3 SL004852 B7-H1 Programmed cell death 1 ligand 1 Q9NZQ7 CD274 SL004853 B7-H2 ICOS ligand O75144 ICOSLG SL004855 contactin-1 Contactin-1 Q12860 CNTN1 SL004856 Desmoglein-1 Desmoglein-1 Q02413 DSG1 SL004857 Desmoglein-2 Desmoglein-2 Q14126 DSG2 SL004858 GFRa-1 GDNF family receptor alpha-1 P56159 GFRA1 SL004859 GITR Tumor necrosis factor receptor Q9Y5U5 TNFRSF18 superfamily member 18 SL004860 HTRA2 Serine protease HTRA2, mitochondrial O43464 HTRA2 SL004861 IL-18 Rb Interleukin-18 receptor accessory protein O95256 IL18RAP SL004862 PD-L2 Programmed cell death 1 ligand 2 Q9BQ51 PDCD1LG2 SL004863 TAJ Tumor necrosis factor receptor Q9NS68 TNFRSF19 superfamily member 19 SL004864 Cadherin-12 Cadherin-12 P55289 CDH12 SL004865 Cadherin-6 Cadherin-6 P55285 CDH6 SL004866 Carbonic Carbonic anhydrase 1 P00915 CA1 anhydrase I SL004867 Carbonic Carbonic anhydrase 3 P07451 CA3 anhydrase II SL004868 Carbonic Carbonic anhydrase 7 P43166 CA7 anhydrase VI SL004869 Carbonic Carbonic anhydrase 13 Q8N1Q1 CA13 anhydrase XI SL004871 DR6 Tumor necrosis factor receptor O75509 TNFRSF21 superfamily member 21 SL004872 EDAR Tumor necrosis factor receptor Q9UNE0 EDAR superfamily member EDAR SL004875 IL-1Rrp2 Interleukin-1 receptor-like 2 Q9HB29 IL1RL2 SL004876 Kallistatin Kallistatin P29622 SERPINA4 SL004891 hnRNP Heterogeneous nuclear P22626 HNRNPA2B1 A2/B1 ribonucleoproteins A2/B SL004899 HSP70 Heat shock cognate 71 kDa protein P11142 HSPA8 protein 8 SL004901 Protein Protein disulfide-isomerase P07237 P4HB disulfide- isomerase SL004908 Tropomyosin 2 Tropomyosin beta chain P07951 TPM2 SL004914 PPase Inorganic pyrophosphatase Q15181 PPA1 SL004915 NCC27 Chloride intracellular channel protein 1 O00299 CLIC1 SL004919 Peroxiredoxin-1 Peroxiredoxin-1 Q06830 PRDX1 SL004920 Cofilin-1 Cofilin-1 P23528 CFL1 SL004921 NDP kinase B Nucleoside diphosphate kinase B P22392 NME2 SL004925 AGR2 Anterior gradient protein 2 homolog O95994 AGR2 SL004932 Peroxiredoxin-5 Peroxiredoxin-5, mitochondrial P30044 PRDX5 SL004938 CaMKK Calcium/calmodulin-dependent protein Q8N5S9 CAMKK1 alpha kinase k SL004939 PTP-1B Tyrosine-protein phosphatase non- P18031 PTPN1 receptor type 1B SL004940 PTP-1C Tyrosine-protein phosphatase non- P29350 PTPN6 receptor type 1C SL005034 RAN GTP-binding nuclear protein Ran P62826 RAN SL005059 TGF-b R III Transforming growth factor beta Q03167 TGFBR3 receptor type SL005084 Periostin Periostin Q15063 POSTN SL005087 IGFBP-7 Insulin-like growth factor-binding Q16270 IGFBP7 protein 7 SL005102 SHBG Sex hormone-binding globulin P04278 SHBG SL005115 Spondin-1 Spondin-1 Q9HCB6 SPON1 SL005152 TIG2 Retinoic acid receptor responder protein Q99969 RARRES2 2 SL005153 CNTFR Ciliary neurotrophic factor receptor P26992 CNTFR alpha subunit SL005155 Cripto Teratocarcinoma-derived growth factor 1 P13385 TDGF1 SL005156 DAN Neuroblastoma suppressor of P41271 NBL1 tumorigenicity 1 SL005157 DC-SIGN CD209 antigen Q9NNX6 CD209 SL005158 DC-SIGNR C-type lectin domain family 4 member Q9H2X3 CLEC4M M SL005159 EPO-R Erythropoietin receptor P19235 EPOR SL005160 ESAM Endothelial cell-selective adhesion Q96AP7 ESAM molecule SL005161 FGF-12 Fibroblast growth factor 12 P61328 FGF12 SL005164 Galectin-2 Galectin-2 P05162 LGALS2 SL005165 Galectin-4 Galectin-4 P56470 LGALS4 SL005167 Galectin-8 Galectin-8 O00214 LGALS8 SL005168 Growth Growth hormone receptor P10912 GHR hormone receptor SL005169 sICAM-5 Intercellular adhesion molecule 5 Q9UMF0 ICAM5 SL005170 ICOS Inducible T-cell costimulator Q9Y6W8 ICOS SL005171 IGFBP-4 Insulin-like growth factor-binding P22692 IGFBP4 protein 4 SL005172 IGFBP-6 Insulin-like growth factor-binding P24592 IGFBP6 protein 6 SL005174 IL-17B R interleukin-17 receptor B Q9NRM6 IL17RB SL005178 IL-1F7 Interleukin-37 Q9NZH6 IL37 SL005181 IL-20 Ra Interleukin-20 receptor subunit alpha Q9UHF4 IL20RA SL005183 IL-22BP Interleukin-22 receptor subunit alpha-2 Q969J5 IL22RA2 SL005184 IL-23 Interleukin-23 P29460, IL12B IL23A Q9NPF7 SL005185 IL-23 R Interleukin-23 receptor Q5VWK5 IL23R SL005187 IL-3 Ra Interleukin-3 receptor subunit alpha P26951 IL3RA SL005188 IL-5 Ra Interleukin-5 receptor subunit alpha Q01344 IL5RA SL005189 IL-7 Ra Interleukin-7 receptor subunit alpha P16871 IL7R SL005190 ILT-2 Leukocyte immunoglobulin-like receptor Q8NHL6 LILRB1 subfamily B member 1 SL005191 ILT-4 Leukocyte immunoglobulin-like receptor Q8N423 LILRB2 subfamily B member 2 SL005193 JAM-B Junctional adhesion molecule B P57087 JAM2 SL005194 JAM-C Junctional adhesion molecule C Q9BX67 JAM3 SL005195 LAG-3 Lymphocyte activation gene 3 protein P18627 LAG3 SL005196 LSAMP Limbic system-associated membrane Q13449 LSAMP protein SL005197 LIMP II Lysosome membrane protein 2 Q14108 SCARB2 SL005199 MICA MHC class I polypeptide-related Q29983 MICA sequence A SL005200 MICB MHC class I polypeptide-related Q29980 MICB sequence B SL005201 MIS Muellerian-inhibiting factor P03971 AMH SL005202 MSP Hepatocyte growth factor-like protein P26927 MST1 SL005204 NKG2D NKG2-D type II integral membrane P26718 KLRK1 protein SL005205 NKp30 Natural cytotoxicity triggering receptor 3 O14931 NCR3 SL005206 NKp44 Natural cytotoxicity triggering receptor 2 O95944 NCR2 SL005207 NKp46 Natural cytotoxicity triggering receptor 1 O76036 NCR1 SL005208 Nogo Reticulon-4 receptor Q9BZR6 RTN4R Receptor SL005209 Notch-3 Neurogenic locus notch homolog protein Q9UM47 NOTCH3 3 SL005210 Nr-CAM Neuronal cell adhesion molecule Q92823 NRCAM SL005212 Prolactin Prolactin receptor P16471 PRLR Receptor SL005213 RELT Tumor necrosis factor receptor Q969Z4 RELT superfamily member 19L SL005214 Semaphorin- Semaphorin-6A Q9H2E6 SEMA6A 6A SL005215 Siglec-3 Myeloid cell surface antigen CD33 P20138 CD33 SL005217 Siglec-6 Sialic acid-binding Ig-like lectin 6 O43699 SIGLEC6 SL005218 Siglec-7 Sialic acid-binding Ig-like lectin 7 Q9Y286 SIGLEC7 SL005219 Siglec-9 Sialic acid-binding Ig-like lectin 9 Q9Y336 SIGLEC9 SL005220 Sonic Sonic hedgehog protein Q15465 SHH Hedgehog SL005221 SREC-I Scavenger receptor class F member 1 Q14162 SCARF1 SL005222 SREC-II Scavenger receptor class F member 2 Q96GP6 SCARF2 SL005223 TCCR Interleukin-27 receptor subunit alpha Q6UWB1 IL27RA SL005224 Thrombopoietin Thrombopoietin Receptor P40238 MPL Receptor SL005225 TrkA High affinity nerve growth factor P04629 NTRK1 receptor SL005226 TSLP R Cytokine receptor-like factor 2 Q9HC73 CRLF2 SL005227 ULBP-1 NKG2D ligand 1 Q9BZM6 ULBP1 SL005228 ULBP-2 NKG2D ligand 2 Q9BZM5 ULBP2 SL005229 ULBP-3 NKG2D ligand 3 Q9BZM4 ULBP3 SL005230 UNC5H3 Netrin receptor UNC5C O95185 UNC5C SL005231 UNC5H4 Netrin receptor UNC5D Q6UXZ4 UNC5D SL005233 XEDAR Tumor necrosis factor receptor Q9HAV5 EDA2R superfamily member 27 SL005234 GDF-9 Growth/differentiation factor 9 O60383 GDF9 SL005235 NANOG Homeobox protein NANOG Q9H9S0 NANOG SL005236 NovH Protein NOV homolog P48745 NOV SL005250 Chymase Chymase P23946 CMA1 SL005256 Histone Histone H1.2 P16403 HIST1H1C H1.2 SL005258 PLK-1 Serine/threonine-protein kinase PLK1 P53350 PLK1 SL005261 TCPTP Tyrosine-protein phosphatase non- P17706 PTPN2 receptor type 2 SL005263 RAP alpha-2-macroglobulin receptor- P30533 LRPAP1 associated protein SL005308 PSME3 Proteasome activator complex subunit 3 P61289 PSME3 SL005352 FABPE Fatty acid-binding protein, epidermal Q01469 FABP5 SL005358 prostatic Phosphatidylethanolamine-binding P30086 PEBP1 binding pro protein 1 SL005361 Apo D Apolipoprotein D P05090 APOD SL005372 Sorting Sorting nexin-4 O95219 SNX4 nexin 4 SL005392 Arylsulfatase A Arylsulfatase A P15289 ARSA SL005437 MEPE Matrix extracellular Q9NQ76 MEPE phosphoglycoprotein SL005488 SPARCL1 SPARC-like protein 1 Q14515 SPARCL1 SL005491 OBCAM Opioid-binding protein/cell adhesion Q14982 OPCML molecule SL005493 paraoxonase 1 Serum paraoxonase/arylesterase 1 P27169 PON1 SL005508 Carbonic Carbonic anhydrase 9 Q16790 CA9 anhydrase 9 SL005572 Gelsolin Gelsolin P06396 GSN SL005574 Aminoacylase-1 Aminoacylase-1 Q03154 ACY1 SL005575 Fucosyltrans- Galactoside 3(4)-L-fucosyltransferase P21217 FUT3 ferase 3 SL005588 FER Tyrosine-protein kinase Fer P16591 FER SL005629 NAGK N-acetyl-D-glucosamine kinase Q9UJ70 NAGK SL005630 PSA6 Proteasome subunit alpha type-6 P60900 PSMA6 SL005675 ATP ATP synthase subunit beta, P06576 ATP5B synthase mitochondrial beta cha SL005679 TCTP Translationally-controlled tumor protein P13693 TPT1 SL005685 EF-1-beta Elongation factor 1-beta P24534 EEF1B2 SL005687 eIF-5A-1 Eukaryotic translation initiation factor P63241 EIF5A 5A-1 SL005694 Peroxiredoxin-6 Peroxiredoxin-6 P30041 PRDX6 SL005703 Notch 1 Neurogenic locus notch homolog protein P46531 NOTCH1 1 SL005725 GRB2- GRB2-related adapter protein 2 O75791 GRAP2 related adapter SL005730 cGMP- cGMP-dependent 3,5-cyclic O00408 PDE2A stimulated phosphodiesterase PDE SL005764 sCD163 Scavenger receptor cysteine-rich type 1 Q86VB7 CD163 protein M130 SL005789 Stanniocalcin-1 Stanniocalcin-1 P52823 STC1 SL005793 Cyclophilin F Peptidyl-prolyl cis-trans isomerase F, P30405 PPIF mitochondrial SL005797 PIGR Polymeric immunoglobulin receptor P01833 PIGR SL005846 Moesin Moesin P26038 MSN SL006029 Chitotriosidase-1 Chitotriosidase-1 Q13231 CHIT1 SL006088 Sphingosine Sphingosine kinase 1 Q9NYA1 SPHK1 kinase 1 SL006091 NCK1 Cytoplasmic protein NCK1 P16333 NCK1 SL006108 CD5L CD5 antigen-like O43866 CD5L SL006114 ROR1 Tyrosine-protein kinase transmembrane Q01973 ROR1 receptor ROR1 SL006119 TFF3 Trefoil factor 3 Q07654 TFF3 SL006132 Lamin-B1 Lamin-B1 P20700 LMNB1 SL006189 KIF23 Kinesin-like protein KIF23 Q02241 KIF23 SL006197 DnaJ Mitochondrial import inner membrane Q96DA6 DNAJC19 homolog translocase subunit TIM14 SL006268 NSF1C NSFL1 cofactor p47 Q9UNZ2 NSFL1C SL006372 YES Tyrosine-protein kinase Yes P07947 YES1 SL006374 BMX Cytoplasmic tyrosine-protein kinase P51813 BMX BMX SL006378 Esterase D S-formylglutathione hydrolase P10768 ESD SL006397 NRP1 Neuropilin-1 O14786 NRP1 SL006406 PLXC1 Plexin-C1 O60486 PLXNC1 SL006448 HRG Histidine-rich glycoprotein P04196 HRG SL006460 GP1BA Platelet glycoprotein Ib alpha chain P07359 GP1BA SL006476 NMT1 Glycylpeptide N- P30419 NMT1 tetradecanoyltransferase 1 SL006480 TRY3 Trypsin-3 P35030 PRSS3 SL006512 HGFA Hepatocyte growth factor activator Q04756 HGFAC SL006522 LG3BP Galectin-3-binding protein Q08380 LGALS3BP SL006523 MFGM Lactadherin Q08431 MFGE8 SL006528 SEPR Seprase Q12884 FAP SL006542 FCN2 Ficolin-2 Q15485 FCN2 SL006544 BGH3 Transforming growth factor-beta- Q15582 TGFBI induced protein ig-h3 SL006550 ECM1 Extracellular matrix protein 1 Q16610 ECM1 SL006610 ATS13 A disintegrin and metalloproteinase with Q76LX8 ADAMTS13 thro SL006629 SIRT2 NAD-dependent protein deacetylase Q8IXJ6 SIRT2 sirtuin-2 SL006675 CKAP2 Cytoskeleton-associated protein 2 Q8WWK9 CKAP2 SL006694 CNDP1 Beta-Ala-His dipeptidase Q96KN2 CNDP1 SL006698 transcription Ligand-dependent nuclear receptor Q8N3X6 LCORL factor corepressor SL006705 PFD5 Prefoldin subunit 5 Q99471 PFDN5 SL006713 Collectin Collectin-11 Q9BWP8 COLEC11 Kidney 1 SL006777 FETUB Fetuin-B Q9UGM5 FETUB SL006803 ANGL3 Angiopoietin-related protein 3 Q9Y5C1 ANGPTL3 SL006805 MRCKB Serine/threonine-protein kinase MRCK Q9Y5S2 CDC42BPB beta SL006830 complement Complement factor H-related protein 5 Q9BXR6 CFHR5 factor H-r SL006892 ABL1 Tyrosine-protein kinase ABL1 P00519 ABL1 SL006910 Cathepsin V Cathepsin L2 O60911 CTSV SL006911 CHK1 Serine/threonine-protein kinase Chk1 O14757 CHEK1 SL006912 FGR Tyrosine-protein kinase Fgr P09769 FGR SL006913 FYN Tyrosine-protein kinase Fyn P06241 FYN SL006914 Glucocorticoid Glucocorticoid receptor P04150 NR3C1 receptor SL006915 IL-27 Interleukin-27 Q8NEV9 IL27 EBI3 Q14213 SL006916 LCK Tyrosine-protein kinase Lck P06239 LCK SL006917 LYN Tyrosine-protein kinase Lyn P07948 LYN SL006918 MK01 Mitogen-activated protein kinase 1 P28482 MAPK1 SL006919 RSK-like Ribosomal protein S6 kinase alpha-5 O75582 RPS6KA5 protein kinase SL006920 MAPK14 Mitogen-activated protein kinase 14 Q16539 MAPK14 SL006921 PDK1 [Pyruvate dehydrogenase (acetyl- Q15118 PDK1 transferring) SL006922 RAD51 DNA repair protein RAD51 homolog 1 Q06609 RAD51 SL006923 TBP TATA-box-binding protein P20226 TBP SL006924 ART Agouti-related protein O00253 AGRP SL006970 DLL1 Delta-like protein 1 O00548 DLL1 SL006992 MATN3 Matrilin-3 O15232 MATN3 SL006993 MK13 Mitogen-activated protein kinase 13 O15264 MAPK13 SL006998 PDPK1 3-phosphoinositide-dependent protein O15530 PDPK1 kinase 1 SL007003 DHH Desert hedgehog protein N-product O43323 DHH SL007022 HNRPQ Heterogeneous nuclear O60506 SYNCRIP ribonucleoprotein Q SL007024 GREM1 Gremlin-1 O60565 GREM1 SL007025 JAK2 Tyrosine-protein kinase JAK2 O60674 JAK2 SL007049 CYTF Cystatin-F O76096 CST7 SL007056 BMP10 Bone morphogenetic protein 10 O95393 BMP10 SL007059 LY86 Lymphocyte antigen 86 O95711 LY86 SL007100 LKHA4 Leukotriene A-4 hydrolase P09960 LTA4H SL007121 CATE Cathepsin E P14091 CTSE SL007122 IDE Insulin-degrading enzyme P14735 IDE SL007145 NR1D1 Nuclear receptor subfamily 1 group D P20393 NR1D1 member 1 SL007153 PERL Lactoperoxidase P22079 LPO SL007173 GRN Granulins P28799 GRN SL007179 EPHB2 Ephrin type-B receptor 2 P29323 EPHB2 SL007181 TYK2 Non-receptor tyrosine-protein kinase P29597 TYK2 TYK2 SL007195 CD70 CD70 antigen P32970 CD70 SL007206 TSP2 Thrombospondin-2 P35442 THBS2 SL007207 TSP4 Thrombospondin-4 P35443 THBS4 SL007228 KPCI Protein kinase C iota type P41743 PRKCI SL007237 MP2K4 Dual specificity mitogen-activated P45985 MAP2K4 protein kinase SL007250 PK3CG Phosphatidylinositol 4,5-bisphosphate 3- P48736 PIK3CG kinase SL007261 AMPM2 Methionine aminopeptidase 2 P50579 METAP2 SL007266 PSD7 26S proteasome non-ATPase regulatory P51665 PSMD7 subunit SL007280 CATC Dipeptidyl peptidase 1 P53634 CTSC SL007281 MK12 Mitogen-activated protein kinase 12 P53778 MAPK12 SL007284 CRIS3 Cysteine-rich secretory protein 3 P54108 CRISP3 SL007295 CAD15 Cadherin-15 P55291 CDH15 SL007324 CSK21 Casein kinase II subunit alpha P68400 CSNK2A1 SL007327 OLR1 Oxidized low-density lipoprotein P78380 OLR1 receptor 1 SL007328 JAG1 Protein jagged-1 P78504 JAG1 SL007336 SET Protein SET Q01105 SET SL007356 NOTC2 Neurogenic locus notch homolog protein Q04721 NOTCH2 2 SL007358 KPCT Protein kinase C theta type Q04759 PRKCQ SL007373 PPID Peptidyl-prolyl cis-trans isomerase D Q08752 PPID SL007385 IL24 Interleukin-24 Q13007 IL24 SL007403 DMP1 Dentin matrix acidic phosphoprotein 1 Q13316 DMP1 SL007423 IL-11 RA Interleukin-11 receptor subunit alpha Q14626 IL11RA SL007429 GPNMB Transmembrane glycoprotein NMB Q14956 GPNMB SL007453 MK11 Mitogen-activated protein kinase 11 Q15759 MAPK11 SL007464 AMHR2 Anti-Muellerian hormone type-2 Q16671 AMHR2 receptor SL007471 COLEC12 Collectin-12 Q5KU26 COLEC12 SL007502 ST4S6 Carbohydrate sulfotransferase 15 Q7LFX5 CHST15 SL007531 BMPER BMP-binding endothelial regulator Q8N8U9 BMPER protein SL007547 TIMD3 Hepatitis A virus cellular receptor 2 Q8TDQ0 HAVCR2 SL007560 STAB2 Stabilin-2 Q8WWQ8 STAB2 SL007620 IL-12 RB2 Interleukin-12 receptor subunit beta-2 Q99665 IL12RB2 SL007640 CLC7A C-type lectin domain family 7 member Q9BXN2 CLEC7A A SL007642 ANGL4 Angiopoietin-related protein 4 Q9BY76 ANGPTL4 SL007651 FGF23 Fibroblast growth factor 23 Q9GZV9 FGF23 SL007673 NET4 Netrin-4 Q9HB63 NTN4 SL007674 LY9 T-lymphocyte surface antigen Ly-9 Q9HBG7 LY9 SL007680 ROBO2 Roundabout homolog 2 Q9HCK4 ROBO2 SL007729 ARTS1 Endoplasmic reticulum aminopeptidase Q9NZ08 ERAP1 1 SL007747 TBK1 Serine/threonine-protein kinase TBK1 Q9UHD2 TBK1 SL007752 DAPK2 Death-associated protein kinase 2 Q9UIK4 DAPK2 SL007756 GDF2 Growth/differentiation factor 2 Q9UK05 GDF2 SL007774 JAG2 Protein jagged-2 Q9Y219 JAG2 SL007804 BGN Biglycan P21810 BGN SL007806 IL22RA1 Interleukin-22 receptor subunit alpha-1 Q8N6P7 IL22RA1 SL007869 PPIB Peptidyl-prolyl cis-trans isomerase B P23284 PPIB SL007871 Cytidylate UMP-CMP kinase P30085 CMPK1 kinase SL007888 Cystatin-S Cystatin-S P01036 CST4 SL008008 ARGI1 Arginase-1 P05089 ARG1 SL008023 HPLN1 Hyaluronan and proteoglycan link P10915 HAPLN1 protein 1 SL008039 AK1A1 Alcohol dehydrogenase [NADP(+)] P14550 AKR1A1 SL008059 RS3 40S ribosomal protein S3 P23396 RPS3 SL008063 PPAC Low molecular weight phosphotyrosine P24666 ACP1 protein SL008072 CO8A1 Collagen alpha-1(VIII) chain P27658 COL8A1 SL008085 3HIDH 3-hydroxyisobutyrate dehydrogenase, P31937 HIBADH mitochondrial SL008099 CAPG Macrophage-capping protein P40121 CAPG SL008102 MDHC Malate dehydrogenase, cytoplasmic P40925 MDH1 SL008122 DUS3 Dual specificity protein phosphatase 3 P51452 DUSP3 SL008143 UBE2N Ubiquitin-conjugating enzyme E2 N P61088 UBE2N SL008157 UB2L3 Ubiquitin-conjugating enzyme E2 L3 P68036 UBE2L3 SL008176 PSME1 Proteasome activator complex subunit 1 Q06323 PSME1 SL008177 C1QBP Complement component 1 Q Q07021 C1QBP subcomponent-binding SL008178 DERM Dermatopontin Q07507 DPT SL008190 SPTA2 Spectrin alpha chain, non-erythrocytic 1 Q13813 SPTAN1 SL008193 NID2 Nidogen-2 Q14112 NID2 SL008309 RTN4 Reticulon-4 Q9NQC3 RTN4 SL008331 PA2G4 Proliferation-associated protein 2G4 Q9UQ80 PA2G4 SL008378 4EBP2 Eukaryotic translation initiation factor Q13542 EIF4EBP2 4E-b SL008380 CATZ Cathepsin Z Q9UBR2 CTSZ SL008382 CYTD Cystatin-D P28325 CST5 SL008414 EphB6 Ephrin type-B receptor 6 O15197 EPHB6 SL008416 MRC2 C-type mannose receptor 2 Q9UBG0 MRC2 SL008421 ATS1 A disintegrin and metalloproteinase with Q9UHI8 ADAMTS1 thrombospondin motifs 1 SL008504 GNS N-acetylglucosamine-6-sulfatase P15586 GNS SL008516 CYTT Cystatin-SA P09228 CST2 SL008574 OMD Osteomodulin Q99983 OMD SL008588 SLAF5 SLAM family member 5 Q9UIB8 CD84 SL008590 Olfactomedin-4 Olfactomedin-4 Q6UX06 OLFM4 SL008609 FCG3B Low affinity immunoglobulin gamma Fc O75015 FCGR3B region r SL008611 ASAHL N-acylethanolamine-hydrolyzing acid Q02083 NAAA amidase SL008623 CNTN2 Contactin-2 Q02246 CNTN2 SL008639 IDS Iduronate 2-sulfatase P22304 IDS SL008644 BST1 ADP-ribosyl cyclase/cyclic ADP-ribose Q10588 BST1 hydrolase SL008703 CBPE Carboxypeptidase E P16870 CPE SL008709 DSC3 Desmocollin-3 Q14574 DSC3 SL008728 NRX3B Neurexin-3-beta Q9HDB5 NRXN3 SL008759 GPVI Platelet glycoprotein VI Q9HCN6 GP6 SL008773 CD109 CD109 antigen Q6YHK3 CD109 SL008808 SKP1 S-phase kinase-associated protein 1 P63208 SKP1 SL008822 EMR2 EGF-like module-containing mucin-like Q9UHX3 EMR2 hormone SL008835 ASGR1 Asialoglycoprotein receptor 1 P07306 ASGR1 SL008865 PSA2 Proteasome subunit alpha type-2 P25787 PSMA2 SL008904 LYVE1 Lymphatic vessel endothelial hyaluronic Q9Y5Y7 LYVE1 acid SL008909 LGMN Legumain Q99538 LGMN SL008916 DPP2 Dipeptidyl peptidase 2 Q9UHL4 DPP7 SL008933 PARK7 Protein DJ-1 Q99497 PARK7 SL008936 CHL1 Neural cell adhesion molecule L1-like O00533 CHL1 protein SL008945 TGM3 Protein-glutamine gamma- Q08188 TGM3 glutamyltransferase E SL008956 ARSB Arylsulfatase B P15848 ARSB SL009045 ENPP7 Ectonucleotide Q6UWV6 ENPP7 pyrophosphatase/phosphodiester SL009054 NRX1B Neurexin-1-beta P58400 NRXN1 SL009089 PGCB Brevican core protein Q96GW7 BCAN SL009202 JAML1 Junctional adhesion molecule-like Q86YT9 AMICA1 SL009207 Dynactin Dynactin subunit 2 Q13561 DCTN2 subunit 2 SL009213 Cathepsin A Lysosomal protective protein P10619 CTSA SL009216 dopa Aromatic-L-amino-acid decarboxylase P20711 DDC decarboxylase SL009324 FSTL3 Follistatin-related protein 3 O95633 FSTL3 SL009341 BASI Basigin P35613 BSG SL009400 CRDL1 Chordin-like protein 1 Q9BU40 CHRDL1 SL009412 DKK3 Dickkopf-related protein 3 Q9UBP4 DKK3 SL009431 HINT1 Histidine triad nucleotide-binding P49773 HINT1 protein 1 SL009628 ING1 Inhibitor of growth protein 1 Q9UK53 ING1 SL009629 MBD4 Methyl-CpG-binding domain protein 4 O95243 MBD4 SL009768 CBX5 Chromobox protein homolog 5 P45973 CBX5 SL009790 RUXF Small nuclear ribonucleoprotein F P62306 SNRPF SL009791 hnRNP A/B Heterogeneous nuclear Q99729 HNRNPAB ribonucleoprotein A/B SL009792 PUR8 Adenylosuccinate lyase P30566 ADSL SL009868 SSRP1 FACT complex subunit SSRP1 Q08945 SSRP1 SL009951 WNT7A Protein Wnt-7a O00755 WNT7A SL009988 ADAM12 Disintegrin and metalloproteinase O43184 ADAM12 domain-containing protein 12 SL010250 Stress- Stress-induced-phosphoprotein 1 P31948 STIP1 induced- phosph SL010288 Carbonic Carbonic anhydrase 6 P23280 CA6 anhydrase 6 SL010328 MED-1 Mediator of RNA polymerase II Q15648 MED1 transcription subunit 1 SL010348 FN1.4 Fibronectin Fragment 4 P02751 FN1 SL010349 FN1.3 Fibronectin Fragment 3 P02751 FN1 SL010368 IDUA alpha-L-iduronidase P35475 IDUA SL010369 Carbonic Carbonic anhydrase 4 P22748 CA4 Anhydrase IV SL010371 CD39 Ectonucleoside triphosphate P49961 ENTPD1 diphosphohydrolase SL010372 Enterokinase Enteropeptidase P98073 TMPRSS15 SL010373 FCAR Immunoglobulin alpha Fc receptor P24071 FCAR SL010374 METAP1 Methionine aminopeptidase 1 P53582 METAP1 SL010375 ASAH2 Neutral ceramidase Q9NR71 ASAH2 SL010376 MMEL2 Membrane metallo-endopeptidase-like 1 Q495T6 MMEL1 SL010378 RET Proto-oncogene tyrosine-protein kinase P07949 RET receptor SL010379 Semaphorin Semaphorin-3A Q14563 SEMA3A 3A SL010381 Soggy-1 Dickkopf-like protein 1 Q9UK85 DKKL1 SL010384 Testican-1 Testican-1 Q08629 SPOCK1 SL010388 Trypsin 2 Trypsin-2 P07478 PRSS2 SL010390 URB Coiled-coil domain-containing protein Q76M96 CCDC80 80 SL010391 WFKN2 WAP, Kazal, immunoglobulin, Kunitz Q8TEU8 WFIKKN2 and NTR domain-containing protein 2 SL010393 KREM2 Kremen protein 2 Q8NCW0 KREMEN2 SL010449 Carbonic Carbonic anhydrase-related protein 10 Q9NS85 CA10 Anhydrase X SL010450 CD48 CD48 antigen P09326 CD48 SL010451 CFC1 Cryptic protein P0CG37 CFC1 SL010454 Contactin-4 Contactin-4 Q8IWV2 CNTN4 SL010455 Contactin-5 Contactin-5 O94779 CNTN5 SL010456 CYTN Cystatin-SN P01037 CST1 SL010457 DLL4 Delta-like protein 4 Q9NR61 DLL4 SL010458 Endocan Endothelial cell-specific molecule 1 Q9NQ30 ESM1 SL010461 FCGR1 High affinity immunoglobulin gamma P12314 FCGR1A Fc receptor SL010462 FCN1 Ficolin-1 O00602 FCN1 SL010463 GPC2 Glypican-2 Q8N158 GPC2 SL010464 LRIG3 Leucine-rich repeats and Q6UXM1 LRIG3 immunoglobulin-like SL010465 MATN2 Matrilin-2 O00339 MATN2 SL010466 MFRP Membrane frizzled-related protein Q9BY79 MFRP SL010467 RGMA Repulsive guidance molecule A Q96B86 RGMA SL010468 RGMB RGM domain family member B Q6NW40 RGMB SL010469 RGM-C Hemojuvelin Q6ZVN8 HFE2 SL010470 Semaphorin 3E Semaphorin-3E O15041 SEMA3E SL010471 Testican-2 Testican-2 Q92563 SPOCK2 SL010488 ABL2 Abelson tyrosine-protein kinase 2 P42684 ABL2 SL010489 CAMK1 Calcium/calmodulin-dependent protein Q14012 CAMK1 kinase type 1 SL010490 CAMK1D Calcium/calmodulin-dependent protein Q8IU85 CAMKID kinase type 1D SL010491 CAMK2A Calcium/calmodulin-dependent protein Q9UQM7 CAMK2A kinase type II subunit alpha SL010492 CAMK2B Calcium/calmodulin-dependent protein Q13554 CAMK2B kinase type II subunit beta SL010493 CAMK2D Calcium/calmodulin-dependent protein Q13557 CAMK2D kinase type II subunit delta SL010494 CDK1/cyclin B Cyclin-dependent kinase 1:G2/mitotic- P06493 CDC2 CCNB1 specific P14635 SL010495 CDK2/cyclin A Cyclin-dependent kinase 2:Cyclin-A2 P24941 CDK2 CCNA2 complex P20248 SL010496 CDK5/p35 Cyclin-dependent kinase 5:Cyclin- Q00535 CDK5 CDK5R1 dependent kinase 5 activator 1 complex Q15078 SL010498 EPHA3 Ephrin type-A receptor 3 P29320 EPHA3 SL010499 HCK Tyrosine-protein kinase HCK P08631 HCK SL010500 LYNB Tyrosine-protein kinase Lyn, isoform B P07948 LYN SL010501 MP2K2 Dual specificity mitogen-activated P36507 MAP2K2 protein kinase kinase 2 SL010502 MK08 Mitogen-activated protein kinase 8 P45983 MAPK8 SL010503 MAPK2 MAP kinase-activated protein kinase 2 P49137 MAPKAPK2 SL010504 MAPK5 MAP kinase-activated protein kinase 5 Q8IW41 MAPKAPK5 SL010505 MATK Megakaryocyte-associated tyrosine- P42679 MATK protein kinase SL010508 PAK3 Serine/threonine-protein kinase PAK 3 O75914 PAK3 SL010509 PAK6 Serine/threonine-protein kinase PAK 6 Q9NQU5 PAK6 SL010510 PAK7 Serine/threonine-protein kinase PAK 7 Q9P286 PAK7 SL010512 PIK3CA/ Phosphatidylinositol 4,5-bisphosphate 3- P42336 PIK3CA PIK3 PIK3R1 kinase catalytic subunit alpha P27986 isoform:Phosphatidylinositol 3-kinase regulatory subunit alpha complex SL010513 PRKACA cAMP-dependent protein kinase P17612 PRKACA catalytic subunit A SL010514 PTK6 Protein-tyrosine kinase 6 Q13882 PTK6 SL010515 RPS6KA3 Ribosomal protein S6 kinase alpha-3 P51812 RPS6KA3 SL010516 SRCN1 Proto-oncogene tyrosine-protein kinase P12931 SRC Src SL010517 STK16 Serine/threonine-protein kinase 16 O75716 STK16 SL010518 TEC Tyrosine-protein kinase Tec P42680 TEC SL010519 ZAP70 Tyrosine-protein kinase ZAP-70 P43403 ZAP70 SL010520 AURKB Aurora kinase B Q96GD4 AURKB SL010521 BTK Tyrosine-protein kinase BTK Q06187 BTK SL010522 CDK8/cyclin Cyclin-dependent kinase 8:Cyclin-C P49336 CDK8 CCNC C complex P24863 SL010523 HIPK3 Homeodomain-interacting protein kinase Q9H422 HIPK3 3 SL010528 UFM1 Ubiquitin-fold modifier 1 P61960 UFM1 SL010529 UFC1 Ubiquitin-fold modifier-conjugating Q9Y3C8 UFC1 enzyme 1 SL010530 OCAD1 OCIA domain-containing protein 1 Q9NX40 OCIAD1 SL010610 CLC4K C-type lectin domain family 4 member Q9UJ71 CD207 K SL010612 Dkk-4 Dickkopf-related protein 4 Q9UBT3 DKK4 SL010613 IL-17 RD Interleukin-17 receptor D Q8NFM7 IL17RD SL010616 SHP-2 Tyrosine-protein phosphatase non- Q06124 PTPN11 receptor type 11 SL010617 TPSB2 Tryptase beta-2 P20231 TPSB2 SL010619 TPSG1 Tryptase gamma Q9NRR2 TPSG1 SL010830 41 Protein 4.1 P11171 EPB41 SL010927 IMB1 Importin subunit beta-1 Q14974 KPNB1 SL010928 IMDH2 Inosine-5-monophosphate P12268 IMPDH2 dehydrogenase 2 SL010973 PSA1 Proteasome subunit alpha type-1 P25786 PSMA1 SL011049 MASP3 Mannan-binding lectin serine protease 1 P48740 MASP1 SL011068 IL-17 RC Interleukin-17 receptor C Q8NAC3 IL17RC SL011069 Marapsin Serine protease 27 Q9BQR3 PRSS27 SL011071 PDGF-CC Platelet-derived growth factor C Q9NRA1 PDGFC SL011073 XPNPEP1 Xaa-Pro aminopeptidase 1 Q9NQW7 XPNPEP1 SL011100 CD226 CD226 antigen Q15762 CD226 SL011202 SNAA Alpha-soluble NSF attachment protein P54920 NAPA SL011211 IF4G2 Eukaryotic translation initiation factor 4 P78344 EIF4G2 gamma 2 SL011232 CDC37 Hsp90 co-chaperone Cdc37 Q16543 CDC37 SL011404 PDE4D CAMP-specific 3,5-cyclic Q08499 PDE4D phosphodiesterase SL011405 PDE5A cGMP-specific 3,5-cyclic O76074 PDE5A phosphodiesterase SL011406 PDE7A High affinity cAMP-specific 3,5-cyclic Q13946 PDE7A phosphate SL011448 TNR4 Tumor necrosis factor receptor P43489 TNFRSF4 superfamily me SL011498 PACAP-38 Pituitary adenylate cyclase-activating P18509 ADCYAP1 polypeptide 38 SL011499 PH Pancreatic hormone P01298 PPY SL011508 PACAP-27 Pituitary adenylate cyclase-activating P18509 ADCYAP1 polypeptide 27 SL011509 PYY Peptide YY P10082 PYY SL011510 Somatostatin- Somatostatin-28 P61278 SST 28 SL011528 RS7 40S ribosomal protein S7 P62081 RPS7 SL011529 SBDS Ribosome maturation protein SBDS Q9Y3A5 SBDS SL011530 DLRB1 Dynein light chain roadblock-type 1 Q9NP97 DYNLRB1 SL011532 ETHE1 Persulfide dioxygenase ETHE1, O95571 ETHE1 mitochondrial SL011533 SGTA Small glutamine-rich tetratricopeptide O43765 SGTA repeat SL011535 RBM39 RNA-binding protein 39 Q14498 RBM39 SL011549 ARI3A AT-rich interactive domain-containing Q99856 ARID3A protein SL011616 IF4A3 Eukaryotic initiation factor 4A-III P38919 EIF4A3 SL011628 DBNL Drebrin-like protein Q9UJU6 DBNL SL011629 AIP AH receptor-interacting protein O00170 AIP SL011630 SE6L2 Seizure 6-like protein 2 Q6UXD5 SEZ6L2 SL011631 NACA Nascent polypeptide-associated complex Q13765 NACA subunit SL011708 ARP19 CAMP-regulated phosphoprotein 19 P56211 ARPP19 SL011709 PLPP Pyridoxal phosphate phosphatase Q96GD0 PDXP SL011768 NUDC3 NudC domain-containing protein 3 Q8IVD9 NUDCD3 SL011769 AN32B Acidic leucine-rich nuclear Q92688 ANP32B phosphoprotein 32 SL011770 LCMT1 Leucine carboxyl methyltransferase 1 Q9UIC8 LCMT1 SL011772 PESC Pescadillo homolog O00541 PES1 SL011808 CPNE1 Copine-1 Q99829 CPNE1 SL011809 XTP3A dCTP pyrophosphatase 1 Q9H773 DCTPP1 SL012108 PLCG1 1-phosphatidylinositol 4,5-bisphosphate P19174 PLCG1 phosphate SL012168 LIN7B Protein lin-7 homolog B Q9HAP6 LIN7B SL012188 EP15R Epidermal growth factor receptor Q9UBC2 EPS15L1 substrate 15 SL012248 FAK1 Focal adhesion kinase 1 Q05397 PTK2 SL012457 NXPH1 Neurexophilin-1 P58417 NXPH1 SL012469 GPC5 Glypican-5 P78333 GPC5 SL012538 ARMEL Cerebral dopamine neurotrophic factor Q49AH0 CDNF SL012698 KI2L4 Killer cell immunoglobulin-like receptor Q99706 KIR2DL4 2DL4 SL012707 PCSK9 Proprotein convertase subtilisin/kexin Q8NBP7 PCSK9 type 9 SL012740 ATS15 A disintegrin and metalloproteinase with Q8TE58 ADAMTS15 thrombospondin motifs 15 SL012754 ASM3A Acid sphingomyelinase-like Q92484 SMPDL3A phosphodiesterase SL012783 WFKN1 WAP, kazal, immunoglobulin, kunitz Q96NZ8 WFIKKN1 and NTR domain-containing protein 1 SL012822 BSSP4 Brain-specific serine protease 4 Q9GZN4 PRSS22 SL013240 CRK Adapter molecule crk P46108 CRK SL013488 CLC1B C-type lectin domain family 1 member B Q9P126 CLEC1B SL013489 AMNLS Protein amnionless Q9BXJ7 AMN SL013490 BOC Brother of CDO Q9BWV1 BOC SL013548 IL-34 Interleukin-34 Q6ZMJ4 IL34 SL013570 DYRK3 Dual specificity tyrosine- 043781 DYRK3 phosphorylation-reg SL013754 RASA1 Ras GTPase-activating protein 1 P20936 RASA1 SL013928 PPIE Peptidyl-prolyl cis-trans isomerase E Q9UNP9 PPIE SL013969 KYNU Kynureninase Q16719 KYNU SL013988 CHST2 Carbohydrate sulfotransferase 2 Q9Y4C5 CHST2 SL013989 RSPO2 R-spondin-2 Q6UXX9 RSPO2 SL014008 FUT5 Alpha-(1,3)-fucosyltransferase 5 Q11128 FUT5 SL014009 HDGR2 Hepatoma-derived growth factor-related Q7Z4V5 HDGFRP2 protein SL014028 ENTP5 Ectonucleoside triphosphate O75356 ENTPD5 diphosphohydrolase SL014029 SPHK2 Sphingosine kinase 2 Q9NRA0 SPHK2 SL014048 CONA1 Collagen alpha-1(XXIII) chain Q86Y22 COL23A1 SL014069 PCSK7 Proprotein convertase subtilisin/kexin Q16549 PCSK7 type 7 SL014070 SLIK5 SLIT and NTRK-like protein 5 O94991 SLITRK5 SL014071 FLRT1 Leucine-rich repeat transmembrane Q9NZU1 FLRT1 protein FLR SL014088 FCRL3 Fc receptor-like protein 3 Q96P31 FCRL3 SL014091 SORC2 VPS10 domain-containing receptor Q96PQ0 SORCS2 SorCS2 SL014092 CDON Cell adhesion molecule-related/down- Q4KMG0 CDON regulated SL014093 ENTP3 Ectonucleoside triphosphate O75355 ENTPD3 diphosphohydrolase SL014094 GP114 Probable G-protein coupled receptor 114 Q8IZF4 GPR114 SL014096 LRRT1 Leucine-rich repeat transmembrane Q86UE6 LRRTM1 neuronal protein 1 SL014108 LRRT3 Leucine-rich repeat transmembrane Q86VH5 LRRTM3 neuronal protein 3 SL014111 KIRR3 Kin of IRRE-like protein 3 Q8IZU9 KIRREL3 SL014113 NLGNX Neuroligin-4, X-linked Q8N0W4 NLGN4X SL014129 H6ST1 Heparan-sulfate 6-O-sulfotransferase 1 O60243 HS6ST1 SL014130 CHST6 Carbohydrate sulfotransferase 6 Q9GZX3 CHST6 SL014148 ROBO3 Roundabout homolog 3 Q96MS0 ROBO3 SL014208 CRTAM Cytotoxic and regulatory T-cell 095727 CRTAM molecule SL014209 KLRF1 Killer cell lectin-like receptor subfamily Q9NZS2 KLRF1 F SL014228 SLAF6 SLAM family member 6 Q96DU3 SLAMF6 SL014268 OX2G OX-2 membrane glycoprotein P41217 CD200 SL014269 KI3L2 Killer cell immunoglobulin-like receptor P43630 KIR3DL2 3DL2 SL014270 CLM6 CMRF35-like molecule 6 Q08708 CD300C SL014288 MO2R1 Cell surface glycoprotein CD200 Q8TD46 CD200R1 receptor 1 SL014289 KI3S1 Killer cell immunoglobulin-like receptor Q14943 KIR3DS1 3DS1 SL014292 SIG14 Sialic acid-binding Ig-like lectin 14 Q08ET2 SIGLEC14 SL014294 EPHAA Ephrin type-A receptor 10 Q5JZY3 EPHA10 SL014308 FGF-8A Fibroblast growth factor 8 isoform A P55075 FGF8 SL014468 SH21A SH2 domain-containing protein 1A O60880 SH2D1A SL014469 SHC1 SHC-transforming protein 1 P29353 SHC1 SL014470 BCAR3 Breast cancer anti-estrogen resistance O75815 BCAR3 protein SL014735 IMDH1 Inosine-5-monophosphate P20839 IMPDH1 dehydrogenase 1 SL015728 GCKR Glucokinase regulatory protein Q14397 GCKR SL016128 TXD12 Thioredoxin domain-containing protein O95881 TXNDC12 12 SL016129 FAM107B Protein FAM107B Q9H098 FAM107B SL016130 BRF-1 Transcription factor IIIB 90 kDa subunit Q92994 BRF1 SL016148 C34 gp41 gp41 C34 peptide, HIV Q70626 Human-virus HIV Fragment SL016548 AMPK AMP Kinase (alpha1beta1gamma1) Q13131 PRKAA1 PRKA alb1g1 Q9Y478 P54619 SL016549 AMPK AMP Kinase (alpha2beta2gamma1) P54646 PRKAA2 PRKA a2b2g1 O43741 P54619 SL016550 CK2-A1:B Casein kinase II 2-alpha:2-beta P68400 CSNK2A1 CSN heterotetramer P67870 SL016551 CK2-A2:B Casein kinase II 2-alpha:2-beta P19784 CSNK2A2 CSN heterotetramer P67870 SL016553 PDE3A cGMP-inhibited 3,5-cyclic Q14432 PDE3A phosphodiesterase SL016554 PDE9A High affinity cGMP-specific 3,5-cyclic O76083 PDE9A phosphodiesterase SL016555 PDE11 Dual 3,5-cyclic-AMP and -GMP Q9HCR9 PDE11A phosphodiester SL016557 HMGR 3-hydroxy-3-methylglutaryl-coenzyme P04035 HMGCR A reductase SL016563 GHC2 Mitochondrial glutamate carrier 2 Q9H1K4 SLC25A18 SL016566 DRAK2 Serine/threonine-protein kinase 17B 094768 STK17B SL016567 TAK1- Mitogen-activated protein kinase kinase 043318 MAP3K7 TAB1 TAB1 kinase Q15750 SL016928 SLAF7 SLAM family member 7 Q9NQ25 SLAMF7 SL017188 GSK-3 Glycogen synthase kinase-3 alpha/beta P49840 GSK3A GSK3B alpha/beta P49841 SL017189 Kininogen, Kininogen-1 P01042 KNG1 HMW SL017610 Gro-b/g Gro-beta/gamma P19876 CXCL3 CXCL2 P19875 SL017611 14-3-3 14-3-3 protein family P31946, YWHAB P62258, YWHAE P61981 SL017612 HSP 90a/b Heat shock protein HSP 90-alpha/beta P07900 HSP90AA1 HS P08238 SL017613 FCG2A/B Low affinity immunoglobulin gamma Fc P12318 FCGR2A FCGR region r P31994 SL017614 PKB a/b/g Protein kinase B alpha/beta/gamma SL018548 alpha-1- alpha-1-antichymotrypsin complex P07288, SERPINA3 antichymotryp P01011 SL018625 TLR4:MD- Toll-like receptor 4:Lymphocyte antigen O00206 TLR4 LY96 2 complex 96 co Q9Y6Y9

    Statistical Analysis

    [0210] All statistical analyses were performed using SAS for Windows, version 9.4 (SAS Institute, Cary, NC). All data were presented as either mean and standard deviations, median (25.sup.th and 75.sup.th percentiles) or count (proportion) measures, where applicable. Correlations between circulating plasma concentrations with eGFR slopes, TNF-R1 and clinical covariates were assessed using a Spearman's rank correlation (r.sub.s). Clusters of protective proteins were identified using a hierarchical cluster analysis (Ward's method). Baseline protein RFU concentrations (n=1,129) were natural log transformed and then were categorized into quartiles of their distributions prior to association testing. The distributions of the top 3 protective proteins after natural log transformation in the combined discovery and replication cohorts, and in the validation cohort are shown in FIGS. 1A-1B. Univariate and multivariable logistic regression models were used to test associations of relevant circulating plasma proteins measured at baseline with the outcome measure (being a progressor, if eGFR loss ?3.0 ml/min/year or progression to ESKD), and expressed as odds ratios per one quartile increase in circulating plasma concentration of the relevant protein with corresponding 95% confidence intervals. The cumulative incidence rate of ESKD according to the index of protectionthe combined effect of the three exemplar protective proteins, was analyzed using PROC LIFETEST in SAS software. Comparisons between plasma protein concentrations in non-diabetics, non-progressors and progressors were examined using one-way ANOVA with Dunn's multiple comparisons test. Significance was defined as *P<0.05, **P<0.01, ***P<0.001, and ****P<0.0001.

    Example 1. Characteristics of the Exploratory and Replication Cohorts of Joslin Kidney Study

    [0211] The study disclosed herein included subjects participating in the ongoing Joslin Kidney Study. Two independent cohorts of subjects with diabetes and impaired kidney function (CKD Stage 3) were assembled; an exploratory Joslin cohort of 214 subjects with T1D and a replication Joslin cohort of 144 subjects with T2D. These cohorts were followed for 7-15 years to determine eGFR slope and ascertain time of onset of ESKD. The clinical characteristics of these cohorts are shown in Table 2. All study participants included in the Joslin T1D cohort and 92% of study participants in the T2D cohort were Caucasian. At baseline, in comparison with subjects with T1D, those with T2D were older, had shorter duration of diabetes, higher body mass index (BMI), lower hemoglobin A1c (HbA1c) and lower urinary albumin to creatinine ratio (ACR) but similarly impaired eGFR.

    [0212] During 7-15 years of follow-up, majority of subjects in both cohorts had progressive renal decline. However, eGFR slopes varied greatly among subjects, with slopes being slightly steeper in subjects with T1D than in those with T2D. The distribution of eGFR slopes in the Joslin cohorts with T1D and T2D is described in FIG. 2. The number of slow decliners (referred to as non-progressors) defined as eGFR loss <3.0 ml/min/year was 71 (33%) and 69 (48%) in the T1D exploratory and T2D replication cohorts, respectively (Table 2). These non-progressors, the focus of this research, had very shallow eGFR slopes, with the median (25.sup.th, 75.sup.th percentile) being ?1.6 ml/min/year (?2.3, ?1.0) and ?0.9 ml/min/year (?2.0, 0.4) in T1D and T2D cohorts, respectively. None of these subjects progressed to ESKD during the 7-15 years of follow-up. In contrast, a large proportion (61% of combined cohorts) of fast decliners (referred to as progressors) defined as eGFR loss ?3.0 ml/min/year progressed to ESKD within 10 years of follow-up, as described in Table 2.

    TABLE-US-00012 TABLE 2 Demographics and clinical characteristics of the Joslin Kidney Study cohorts with T1D and T2D. EXPLORATORY REPLICATION Joslin T1D Cohort Joslin T2D Cohort Characteristics (N = 214) (N = 144) P-value At baseline Male, n (%) 104 (49%) 94 (65%) 0.002 Ethnicity <0.0001 Caucasian, n (%) 214 (100%) 132 (92%) Non-Caucasian, n (%) 0 (0%) 12 (8%) Age at DM onset (years) 13 (8, 20) 44 (38, 50) <0.0001 Age at study entry (years) 44 (38, 51) 61 (56, 64) <0.0001 Duration of diabetes (years) 28 (23, 36) 15 (11, 21) <0.0001 BMI (kg/m.sup.2) 26.4 (23, 28) 33.4 (29, 37) <0.0001 Systolic BP (mm Hg) 133 (124, 147) 139 (128, 150) 0.02 Diastolic BP (mm Hg) 78 (70, 84) 74 (69, 81) 0.04 Insulin Rx, % 100% 65% <0.0001 Renoprotection Rx, % 81% 86% 0.19 HbA1c (%) 8.6 (7.7, 9.6) 7.3 (6.7, 8.3) <0.0001 ACR (mg/g creatinine) 795 (274, 1803) 255 (57, 1096) <0.0001 eGFR (ml/min/1.73 m.sup.2) 43.2 (35, 51) 48.7 (40, 57) <0.0001 During follow-up eGFR slope (ml/min/1.73 m.sup.2/year) ?4.0 (?7.8, ?2.1) ?3.1 (?6.4, ?0.9) 0.007 Non-progressors.sup.a, n (%) 71 (33%) 69 (48%) Progressors.sup.a, n (%) 143 (67%) 75 (52%) New incidence of ESKD during 10- 108 (50%) 35 (24%) <0.0001 year follow-up, n (%) Deaths unrelated to ESKD, n (%) 15 (7%) 8 (6%) 0.58 T1D, Type 1 diabetes; T2D, Type 2 diabetes; DM, Diabetes mellitus; BMI, Body mass index; BP, Blood pressure; Rx, treatment; Renoprotection, Prescription of angiotensin-converting enzyme inhibitor (ACE-I) or angiotensin II receptor blocker (ARB); HbA1c, Hemoglobin A1c; ACR, Albumin-to-creatinine ratio; eGFR, Estimated glomerular filtration rate; ESKD, End-stage kidney disease. .sup.aNon-progressors were defined as eGFR loss <3.0 ml/min/1.73 m.sup.2/year and Progressors as eGFR loss ?3.0 ml/min/1.73 m.sup.2/year. Data presented as median (25.sup.th, 75.sup.th percentile) or count (proportion) measures.
    Differences between the two cohorts were tested using the Wilcoxon-rank-sum test for continuous variables, and the ?.sup.2 test for categorical variables.

    Example 2. Profiling Plasma Proteins that Protect Against Progressive Renal Decline

    [0213] The SOMAscan proteomic platform was used to measure 1129 plasma proteins, as described in Table 1 above. These plasma proteins were examined for elevated concentration in non-progressors at baseline. The schematic representation of this study is outlined in FIG. 3. In the Joslin exploratory T1D cohort, baseline plasma concentration of 73 proteins were positively and significantly correlated with eGFR slope at a false discovery rate (FDR) adjusted P<0.005 (Table 3), therefore, elevated baseline concentrations of these proteins were associated with slow or minimal renal decline during follow-up. These proteins can be considered candidate protective factors/biomarkers against progressive renal decline. Proteins that were negatively correlated with eGFR slope might be considered candidate factors/biomarkers increasing the risk of progressive renal decline and progression to ESKD. Rather, a separate study has published the association of 194 inflammatory circulating proteins with the risk of progression to ESKD in these two Joslin cohorts using the same SOMAscan proteomic platform (Niewczas et al., Nat Med 25: 805-813 (2019)).

    [0214] The 73 plasma proteins positively correlated with eGFR slope in subjects with T1D were analyzed further in the replication cohort of subjects with T2D. Eighteen proteins were found positively correlated with eGFR slope at a nominal P<0.05 (Table 3). As discussed herein, elevated concentrations of PKM2 in kidney tissue and in plasma were recently demonstrated as a novel biomarker and potential therapeutic target protecting against DKD in subjects with long duration of T1D (Qi et al., Nat Med 23: 753-762 (2017)). To determine whether this protein may be also involved in protection against progressive renal decline in subjects with impaired kidney function, PKM2, along with the 18 candidate proteins were included, in further analyses despite its non-significant correlation with eGFR slope in subjects with T2D. The names of 19 plasma proteins, correlation coefficients and P-values for each positively correlated protein with eGFR slope in the T1D and T2D cohorts, respectively, are presented in FIG. 4A. Correlations were generally slightly weaker in those with T2D, but all 18 proteins correlated positively and significantly with eGFR slope.

    TABLE-US-00013 TABLE 3 Global proteomic profiling data of the circulating plasma proteins in the exploratory cohort of 214 T1D subjects and in the replication cohort of 144 T2D subjects. Spearman's rank correlation coefficients (r.sub.s) between baseline concentration of 73 proteins and eGFR slope. Joslin T1D Cohort Joslin T2D Cohort UniProt ID Gene Symbol r.sub.s P-value* r.sub.s P-value* P02768 ALB 0.33 9.20E?07 0.18 3.01E?02 O43508 TNFSF12 0.32 2.00E?06 0.23 5.40E?03 P09486 SPARC 0.29 1.50E?05 0.21 1.15E?02 P00568 AK1 0.27 6.60E?05 0.18 3.04E?02 P02775 PPBPIII 0.27 6.70E?05 0.18 2.65E?02 P02775 PPBP2 0.26 9.60E?05 0.19 2.18E?02 P13501 CCL5 0.26 1.30E?04 0.23 5.30E?03 P07996 THBS1 0.24 3.20E?04 0.17 4.35E?02 P05067 APP 0.24 3.60E?04 0.21 1.34E?02 P02776 PF4 0.23 6.00E?04 0.21 1.17E?02 Q9NP95 FGF20 0.23 6.20E?04 0.18 2.71E?02 Q15389 ANGPT1 0.23 6.80E?04 0.23 6.10E?03 Q96DA6 DNAJC19 0.23 7.70E?04 0.17 4.09E?02 O15496 PLA2G10 0.23 8.90E?04 0.28 6.00E?04 Q08752 PPID 0.23 9.00E?04 0.18 3.41E?02 P05121 SERPINE1 0.22 9.90E?04 0.17 3.88E?02 P62826 RAN 0.22 1.40E?03 0.17 4.44E?02 Q06830 PRDX1 0.20 3.30E?03 0.17 4.72E?02 P14618 PKM2 0.21 2.00E?03 0.11 2.09E?01 P24298 GPT 0.31 5.10E?06 0.07 3.91E?01 P35625 TIMP3 0.30 7.10E?06 0.10 2.27E?01 P01857 IGHG1 IGHG2 0.30 9.10E?06 0.16 5.45E?02 P52209 PGD 0.28 4.20E?05 0.15 7.19E?02 P19876 P19875 CXCL3 CXCL2 0.27 8.10E?05 0.15 7.65E?02 Q9UHL4 DPP7 0.25 2.10E?04 0.09 2.67E?01 P14210 HGF 0.25 2.30E?04 0.03 7.38E?01 Q96RJ3 TNFRSF13C 0.25 2.70E?04 0.07 4.26E?01 P62979 RPS27A 0.24 3.00E?04 0.02 8.05E?01 P40925 MDH1 0.24 3.30E?04 0.02 8.47E?01 P49137 MAPKAPK2 0.24 4.90E?04 0.11 2.07E?01 Q9UJU6 DBNL 0.24 5.20E?04 0.04 6.24E?01 P07355 ANXA2 0.23 5.70E?04 ?0.05 5.84E?01 P07384 P04632 CAPN1 CAPNS 0.23 5.90E?04 0.11 1.95E?01 P30041 PRDX6 0.23 6.20E?04 0.09 2.71E?01 P29401 TKT 0.23 6.40E?04 0.02 8.10E?01 Q9Y3A5 SBDS 0.23 6.60E?04 0.14 1.04E?01 P51452 DUSP3 0.23 7.00E?04 0.08 3.68E?01 P69905, P68871 HBA1 HBB 0.23 8.50E?04 0.06 4.43E?01 P61088 UBE2N 0.22 9.20E?04 0.03 7.13E?01 P14550 AKR1A1 0.22 9.30E?04 ?0.05 5.22E?01 P09960 LTA4H 0.22 9.40E?04 ?0.32 <.0001 O60383 GDF9 0.22 9.50E?04 0.02 8.28E?01 O14929 HAT1 0.22 9.80E?04 0.10 2.35E?01 O15264 MAPK13 0.22 1.10E?03 ?0.05 5.20E?01 P50395 GDI2 0.22 1.10E?03 0.02 8.10E?01 P12931 SRC 0.22 1.20E?03 0.08 3.27E?01 Q13421 MSLN 0.22 1.20E?03 0.00 1.00E+00 P04040 CAT 0.22 1.30E?03 ?0.01 9.52E?01 P60174 TPI1 0.22 1.30E?03 0.01 9.08E?01 Q93038 TNFRSF25 0.22 1.30E?03 0.11 1.71E?01 P22392 NME2 0.22 1.40E?03 0.06 4.88E?01 P02794 P02792 FTH1 FTL 0.22 1.40E?03 0.11 2.06E?01 Q06323 PSME1 0.22 1.50E?03 0.00 9.78E?01 P62937 PPIA 0.21 1.60E?03 0.09 2.63E?01 P78556 CCL20 0.21 1.70E?03 0.05 5.46E?01 P19784 P67870 CSNK2A2 CSN 0.21 1.70E?03 0.19 1.17E?01 Q02083 NAAA 0.21 1.70E?03 0.07 3.92E?01 Q15181 PPA1 0.21 1.80E?03 0.04 6.29E?01 Q16548 BCL2A1 0.21 1.90E?03 0.03 7.24E?01 P31948 STIP1 0.21 2.10E?03 0.09 2.77E?01 P63241 EIF5A 0.21 2.20E?03 0.06 4.82E?01 P0C0S5 H2AFZ 0.21 2.20E?03 ?0.10 2.37E?01 P56211 ARPP19 0.21 2.50E?03 0.07 4.25E?01 P17612 PRKACA 0.21 2.50E?03 0.03 6.81E?01 P30086 PEBP1 0.21 2.60E?03 ?0.02 7.77E?01 P23528 CFL1 0.21 2.60E?03 ?0.06 4.78E?01 P54920 NAPA 0.21 2.60E?03 0.14 8.46E?02 Q8N5S9 CAMKK1 0.20 2.70E?03 0.11 1.81E?01 P63000 RAC1 0.20 2.70E?03 0.15 8.25E?02 P62979 RPS27A 0.20 2.90E?03 ?0.02 8.13E?01 P55008 AIF1 0.20 2.90E?03 ?0.07 3.91E?01 Q9UQ80 PA2G4 0.20 3.00E?03 0.07 3.73E?01 P14735 IDE 0.20 3.00E?03 0.06 4.78E?01 *Threshold for the significance used in cohort with T1D: FDR adjusted P-value <0.005 in the exploratory T1D cohort and a nominal P-value <0.05 in the replication T2D cohort. Coefficients (r.sub.s) are presented below and corresponding two-sided P values have been provided. Gene symbols indicated in bold were examined in the present study.

    Example 3. Plasma Proteins Protecting Against Progressive Renal Decline

    [0215] As both Joslin cohorts had impaired kidney function (CKD Stage 3) at baseline and had homogenous strength of association with eGFR slope, the SOMAscan results from both cohorts were combined. The association of baseline plasma concentration of each of the 19 proteins and the rate of progressive renal decline was analyzed using the logistic regression analysis. Subjects from combined Joslin cohorts were grouped to those with (1) fast renal decline (eGFR loss ?3.0 ml/min/year) or progression to ESKD, referred to as progressors; or (2) subjects with slow or minimal renal decline (eGFR loss <3.0 ml/min/year), referred to as non-progressors. To assess statistical independence of protective effect from clinical characteristics and risk factors associated with progressive renal decline, first univariate and then multivariable logistic models adjusted for baseline clinical covariates were performed. The list of potential confounders included age, gender, ethnicity/race, duration of diabetes, insulin treatment, renoprotection treatment, BMI, systolic and diastolic blood pressures, HbA1c, eGFR and ACR. The key covariates, consisting of HbA1c, eGFR and ACR were included in the final logistic model. Information about selection of covariates into the logistic models are provided in Table 4. The results of univariable and multivariable analyses are shown in FIG. 4B. All models were adjusted for type of diabetes. The effects are shown as odds ratios (OR) with 95% confidence interval (95% CI) per one quartile increase in baseline plasma concentration of the specific protein. In the univariate model, all 19 proteins including PKM2 (FIG. 4B-marked with ##) protected (had OR<1.0) against progressive renal decline. Elevated plasma concentrations of 8 proteins remained associated with protection against progressive renal decline in the final model adjusted for baseline clinical covariates including eGFR, HbA1c, ACR and type of diabetes (FIG. 4B and Table 5). These 8 plasma proteins, referred to as confirmed protective proteins, included TNFSF12, SPARC, CCL5, APP, PF4, DNAJC19, ANGPT1 and FGF20 (FIG. 4B-marked with #). Baseline concentrations of PKM2 were not associated with protection against progressive renal decline after further adjustment by clinical covariates. Although significant (P<0.05) in the univariate analysis, the effect of PKM2 became statistically non-significant after adjustment for clinical covariates.

    TABLE-US-00014 TABLE 4 Selection of potential covariates into the logistic regression model. Maximum Likelihood Estimates Potential covariates Estimate Standard Error Wald Chi-square P-value Age ?0.02 0.02 0.94 0.33 Gender 0.04 0.27 0.02 0.90 Ethnicity 0.96 0.74 1.68 0.20 Insulin Rx ?0.27 0.45 0.36 0.55 Renoprotection Rx 0.18 0.35 0.26 0.61 Duration of diabetes ?0.02 0.02 0.67 0.41 BMI ?0.01 0.02 0.33 0.56 Systolic BP ?0.001 0.01 0.01 0.93 Diastolic BP 0.01 0.02 0.16 0.69 HbA1c 0.24 0.09 6.85 0.0089 ACR 1.10 0.19 33.96 <.0001 eGFR ?0.05 0.01 15.11 0.0001 BMI, Body mass index; BP, Blood pressure; Rx, treatment; Renoprotection, Prescription of angiotensin-converting enzyme inhibitor (ACE-I) or angiotensin II receptor blocker (ARB); HbA1c, Hemoglobin A1c; ACR, Albumin-to-creatinine ratio; eGFR, Estimated glomerular filtration rate.

    [0216] The criteria to retain a covariate in the final model were statistical significance at nominal P<0.05 and by inspection of ? estimates, such that a change of ? of 20% or higher was considered non-negligible.

    TABLE-US-00015 TABLE 5 Logistic regression models examining the association of 19 circulating plasma proteins and progressive renal decline in the combined Joslin cohorts with T1D and T2D. Model 1 Model 2 Gene symbol for proteins OR (95% CI) OR (95% CI) ALB 0.71 (0.58, 0.87) 0.83 (0.66, 1.05) TNFSF12 0.61 (0.50, 0.75) 0.75 (0.59, 0.95)* SPARC 0.66 (0.54, 0.81) 0.75 (0.59, 0.95)* AK1 0.72 (0.59, 0.87) 0.89 (0.70, 1.02) PPBPIII 0.70 (0.57, 0.85) 0.83 (0.65, 1.04) PPBP2 0.69 (0.56, 0.84) 0.81 (0.64, 1.02) CCL5 0.70 (0.58, 0.86) 0.75 (0.60, 0.95)* THBS1 0.75 (0.62, 0.92) 0.88 (0.70, 1.11) APP 0.70 (0.58, 0.86) 0.78 (0.61, 0.98)* PF4 0.69 (0.56, 0.84) 0.78 (0.62, 0.99)* FGF20 0.66 (0.54, 0.81) 0.69 (0.54, 0.88)* ANGPT1 0.68 (0.56, 0.83) 0.72 (0.57, 0.91)* DNAJC19 0.68 (0.55, 0.83) 0.78 (0.62, 0.99)* PLA2G10 0.63 (0.52, 0.78) 0.80 (0.63, 1.01) PPID 0.70 (0.58, 0.86) 0.88 (0.70, 1.10) SERPINE1 0.75 (0.62, 0.92) 0.92 (0.73, 1.17) RAN 0.73 (0.60, 0.88) 0.90 (0.71, 1.15) PRDX1 0.79 (0.65, 0.96) 1.03 (0.82, 1.30) PKM2 0.74 (0.61, 0.90) 0.91 (0.72, 1.15)

    [0217] The effect is shown as an odds ratio (95% CI) per one quartile increase in circulating concentration of the relevant protein. Model 1: Unadjusted; Model 2: Adjusted for baseline eGFR, HbA1c and ACR. All models were adjusted by type of diabetes. *Proteins in bold are significant (P<0.05) in both models.

    [0218] To examine which of the confirmed protective proteins contributed independently to protection against progressive renal decline, first, relationships at baseline were analyzed among the 8 proteins and important clinical covariates using a Spearman's rank correlation. The correlation matrix shown in FIG. 5A indicates that variation in baseline HbA1c had no impact on variation of the 8 protective proteins, whereas variation in baseline eGFR correlated weakly with TNFSF12 and FGF20. In contrast, baseline ACR correlated weakly with all of the proteins (FIG. 5A and FIG. 6) except for FGF20. In addition, all of the protective proteins correlated negatively with plasma tumor necrosis factor receptor 1 (TNF-R1) concentration, reported by us previously as one of the circulating inflammatory proteins associated with increased risk of progression to ESKD (Niewczas et al., Nat Med 25: 805-813 (2019)), indicating a decreased plasma TNF-R1 concentrations with increasing concentrations of the protective proteins. The confirmed protective proteins were grouped into three sub-groups according to their correlation coefficients with each other (FIG. 5A). Sub-group (A) contained 5 extremely highly inter-correlated proteins; SPARC, CCL5, APP, PF4 and ANGPT1. Sub-group (B) contained 2 proteins; DNAJC19 and TNFSF12, that were moderately correlated between themselves and with proteins in sub-group (A). Sub-group (C) contained FGF20, a protein not correlated with any of the other proteins except for moderate correlation with TNFSF12. This pattern of grouping of proteins was preserved and confirmed in the hierarchical cluster analysis, as described in FIG. 5B. This finding suggests that plasma concentration of these three sub-groups of proteins are regulated by different mechanisms. This is in contrast to the 5 proteins in sub-group (A) which showed such strong inter-correlation that one can hypothesize that they are regulated by the same mechanisms.

    [0219] To further test which of these 8 proteins (three sub-groups) independently contributed to protection against progressive renal decline, a multivariable logistic regression analysis was performed with backward elimination of proteins and clinical covariates that had no or weak effects (?>0.1) (Table 6). All relevant clinical characteristics and 8 confirmed protective proteins were included in the analysis. In the final model, three baseline clinical variables, eGFR, HbA1c, and ACR significantly increased the risk of progressive renal decline, and three baseline plasma proteins, ANGPT1 (exemplar of sub-group A), TNFSF12 (exemplar of sub-group B) and FGF20 (sub-group C) significantly protected against progressive renal decline. The odds ratios (95% CI) obtained from the multivariable logistic regression analysis for the clinical covariates and the exemplar protective proteins are shown in FIG. 5C.

    TABLE-US-00016 TABLE 6 Ranking of proteins/clinical covariates for elimination from the multivariable logistic regression analysis using backward elimination procedure. Proteins with ? > 0.1 were eliminated from the final logistic regression model. Proteins/Clinical Summary of backward elimination covariates Wald Chi-Square P-value Eliminated proteins PF4 0.073 0.79 SPARC 0.18 0.67 CCL5 0.58 0.45 APP 0.57 0.45 DNAJC19 0.76 0.39 Selected proteins/covariates in the final model eGFR 5.21 0.022 HbA1c 8.43 0.0037 ACR 35.81 <.0001 TNFSF12 2.84 0.092 ANGPT1 5.73 0.017 FGF20 6.48 0.011

    Example 4. Combined Effect of Three Exemplar Protective Proteins

    [0220] To estimate the combined effect of the three exemplar protective proteins on risk of progressive renal decline and progression to ESKD, an index of protection was developed. The plasma concentration of the three exemplar protective proteins (ANGPT1, TNFSF12 and FGF20) were evaluated in each subject. Value above median for each protein was scored as 1 and below as 0; by summing up the scores, a subject could have a total protection index varying between 0 (all proteins below median) and 3 (all proteins above median). The association between the index of protection and progressive renal decline is shown in FIG. 7A. The odds ratio (95% CI) for progressive renal decline was 0.69 (0.28, 1.69), 0.34 (0.14, 0.83) and 0.19 (0.1, 0.52) for subjects with the total index of protection 1, 2 and 3, respectively, when compared with subjects with the protection index value 0. To visualize the combined effect of the three protective proteins, the cumulative risk of progression to ESKD was analyzed in the combined study cohorts according to the index of protection. FIG. 7B shows the cumulative incidence of ESKD during 7.5 years of follow-up according to values of the protection index. Subjects with all 3 protective protein values above median had very low risk of developing ESKD, with the cumulative incidence of 16% during 7.5 years of follow-up. In contrast, those with the protective index value 0, e.g. all three protective protein values below median, had very high cumulative incidence of ESKD of 80%. The highly statistically significant P-value (P=2.7?10.sup.?10) indicates strong evidence of a significant difference in the cumulative incidence of ESKD among the four subgroups.

    [0221] To examine whether the results shown in FIG. 7A could have been confounded by inflammatory circulating proteins (e.g. high TNF-R1 plasma concentration) or clinical covariates, the logistic regression analysis was performed in the combined Joslin cohorts (T1D and T2D). In this analysis, the protection index was considered as a continuous variable as opposed to discrete variable as in FIG. 7A. As shown in Table 7, the effect of index of protection was highly significant (P<0.0001), the odds ratio was 0.47 (95% CI:0.32-0.60). By including into the model one inflammatory protein, TNF-R1, reported by us previously (5), the protective effect of the index was attenuated, the odds ratio increased to 0.60 (95% CI:0.45-0.78) but remained highly statistically significant (P<0.0002). It is instructive that adding into the model many clinical covariates did not substantially change the odds ratio for the protective index.

    TABLE-US-00017 TABLE 7 Effect estimates measured as odds ratios (95% CI) of index of protection (FGF20, TNFSF12 and ANGPT1) on risk of progressive renal decline in univariate and multivariable logistic regression models in both Joslin cohorts combined. Model comparisons Model (P-value) Predictive metrics 1 2 3 2 vs 1 3 vs 2 3 vs 1 C-statistics ? SE 0.687 ? 0.03 0.765 ? 0.03 0.833 ? 0.02 0.0005 <0.0001 <0.0001 ?2 Log Likelihood 439 401 352 Akaike information 443 407 364 criterion (AIC) Covariates Odds Ratio (95% CI) Significance (P-value) Protection Index 0.47 (0.36, 0.60 (0.45, 0.61 (0.45, <0.0001 0.0002 0.001 0.60) 0.78) 0.82) TNF-R1 2.04 (1.61, 1.63 (1.23, <0.0001 0.0007 2.58) 2.15) HbA1c 1.32 (1.12, 0.001 1.56) ACR 2.54 (1.77, <0.0001 3.63) eGFR 0.99 (0.96, 0.49 1.02) SE, Standard error; CI, Confidence intervals; TNF-R1, Tumor necrosis factor receptor 1; HbA1c, Hemoglobin A1c; ACR, Albumin-to-creatinine ratio; eGFR, Estimated glomerular filtration rate. Model 1 has been compared to the model with the same protection index in the presence of TNF-R1 (Model 2) and to the model with same protection index and TNF-R1, in the presence of important clinical covariates (Model 3).

    Example 5. Validation of Three Exemplar Protective Proteins in Early CKD

    [0222] To demonstrate the robustness of the findings, a validation study was conducted in an independent Joslin cohort of 294 subjects with T1D who had had albuminuria but normal kidney function at baseline. This cohort was followed for 7-15 years to determine eGFR slope and ascertain time of onset of ESKD. Plasma samples from the validation study of 294 T1D subjects underwent profiling of the proteins of interest using the same SOMAscan platform. In contrast to the exploratory and replication cohorts, which had impaired kidney function (CKD Stage 3) at baseline, the validation cohort had normal kidney function (CKD Stages 1 and 2; Median eGFR (25.sup.th, 75.sup.th percentile): 100 (82, 114) ml/min/1.73 m.sup.2) at baseline. The clinical characteristics of the validation cohort are shown in Table 8.

    TABLE-US-00018 TABLE 8 Demographics and clinical characteristics of an independent validation cohort of T1D subjects with normal kidney function. Validation Cohort Joslin T1D CKD12 Cohort Characteristics (N = 294) At baseline Male (%) 55 Age (years) 38 (32, 45) Duration of diabetes (years) 25 (17, 32) HbA1c (%) 8.8 (7.9, 9.8) eGFR (ml/min/1.73 m.sup.2) 100 (82, 114) ACR (?g/mg creatinine) 491 (112, 1099) During follow-up eGFR slope (ml/min/1.73 m.sup.2/year) ?2.6 (?7.1, ?1.1) Non-progressors* (%) 53 Progressors* (%) 47 New cases of ESKD within 10 years follow-up (%) 19 T1D, Type 1 diabetes; CKD, Chronic Kidney Disease; HbA1c, Hemoglobin A1c; eGFR, Estimated glomerular filtration rate; ACR, Albumin-to-creatinine ratio; ESKD, End-stage renal disease. Non-progressors were defined as eGFR loss <3.0 ml/min/1.73 m.sup.2/year and progressors as eGFR loss ?3.0 ml/min/1.73 m.sup.2/year. Data presented as median (25th, 75th percentile) or count (proportion) measures.

    [0223] The plasma concentration of the three exemplar protective proteins (ANGPT1, TNFSF12 and FGF20) were evaluated in each subject and the index of protection was developed. The association between the index of protection and progressive renal decline is shown in FIG. 7C. The odds ratio (95% CI) for progressive renal decline was 0.48 (0.24, 0.95), 0.46 (0.24, 0.89) and 0.11 (0.05, 0.27) for subjects with the total index of protection 1, 2 and 3, respectively, when compared with subjects with the protection index value 0. The cumulative risk of progression to ESKD was also analyzed in the validation cohort according to the index of protection. FIG. 7D shows the cumulative incidence of ESKD during 7.5 years of follow-up according to values of the protection index. None of the subjects with all 3 protective protein values above median progressed to ESKD during 7.5 years of follow-up. The low cumulative incidence of ESKD was observed for subjects with the protection index values 1 and 2; 14% and 11%, respectively, when compared with subjects with the protection index value 0 with the cumulative incidence of 33% during 7.5 years of follow-up. The highly statistically significant P-value (P=1.7?10.sup.?5) suggests strong evidence of a significant difference in the cumulative incidence of ESKD among the four subgroups.

    [0224] Furthermore, two (ANGPT1 and FGF20) out of three exemplar protective proteins were validated using different platforms. ANGPT1 measurements were validated in a subset of samples (n=32) using the Human Ang-1 MSD R-Plex assay (F21YQ-3, Meso Scale Diagnostics) according to the manufacturer's protocols. Briefly, an MSD GOLD Small Spot Streptavidin plate was coated with 100 ?l of biotinylated Ang-1 capture antibody in coating diluent 100 and incubated for 1 hour at room temperature. The plate was washed with 150 ?l/well of washing buffer (1?PBS-Tween 20), and duplicates of 25 ?l of serially diluted standard from 100,000 pg to 24 pg/ml and 32 plasma samples from our study were all loaded on the same plate. After 1-hour incubation with shaking at room temperature, the plate was washed and incubated with 50 ?l of conjugated detection antibody (MSD GOLD SULFO-TAG?) for 1 hour at room temperature, then washed, and finally 150 ?l/well of read buffer was added on the plate. The plate was loaded into an MSD instrument where a voltage was applied to the plate electrodes to measure to intensity of the emitted light and provided a quantitative measure of the analyte in the sample.

    [0225] The correlation between antibody-based (MSD) measurements and aptamer-based (SOMAscan) results was extremely good. The Spearman's rank correlation coefficient between the SOMAscan and MSD ANGPT1 measurements was r.sub.s=0.76, P<0.0001. To analytically validate SOMAmer specificity, protocols integrating DNA-based affinity pull-down of intact proteins with mass spectrometry were developed. Fourteen FGF20 tryptic peptides spanning amino acids (a.a.) 50-211 of the FGF20 protein sequence were identified in the FGF20 SOMAmer plasma pull-downs spiked with recombinant FGF20, whereas no FGF20 peptides were identified in the FGF20 SOMAmer plasma pull-downs that were not spiked with recombinant FGF20. An example of an extracted ion chromatogram of FGF20 tryptic peptide GGPGAAQLAHLHGILR (a.a. 50-65; SEQ ID NO: 9) is shown in FIG. 8. This FGF20 peptide was identified in the plasma pull-down spiked with recombinant FGF20 but was not detected in the plasma pull-down not spiked with recombinant FGF20, thereby verifying the FGF20 SOMAmer specificity on the SOMAscan platform.

    Example 6. Plasma Concentration of Protective Proteins in Non-Diabetic and Diabetic Subjects

    [0226] Two possibilities exist on how to explain the elevated concentrations of protective proteins in non-progressors compared to those at risk of progressive renal decline at study entry. The first possibility is that diabetes and related kidney damage may cause a decrease in plasma concentrations of the putative protective proteins. As a result, progressors would have lower protein concentrations than non-progressors due to more extensive underlying kidney damage, which was not recognized by clinical covariates and not accounted for in the multivariable models. If this was true, one would hypothesize that protective proteins are further elevated in non-diabetics as compared to slow-declining diabetics. The second possibility is that diabetes may not be a factor in determining the concentrations of the putative protective proteins, however, elevated concentrations of these proteins at baseline could protect against progressive renal decline. Consequently, subjects with elevated plasma concentrations of these proteins would comprise mainly non-progressors, whereas those with low concentrations of these proteins would be at risk of progressive renal decline. If this was true, one would hypothesize that, in comparison with non-diabetics, non-progressors should have higher concentrations of the putative protective proteins, whereas progressors would have protein concentrations lower than or similar to the controls.

    [0227] To distinguish between the two possibilities described above, plasma concentrations of the protective proteins were compared among healthy non-diabetic parents of T1D subjects, non-progressors and progressors with T1D and T2D, using the same aptamer-based SOMAscan platform. Baseline clinical characteristics and baseline values of the protective proteins among the three study sub-groups are shown in Table 9. The non-diabetics were older, had normal HbA1c, normal ACR and almost normal eGFR in comparison with diabetic subjects. By design, non-progressors and progressors had similarly impaired kidney function at baseline but dramatically different eGFR slopes during 7-15 years of follow-up. With regard to the 8 confirmed protective proteins, the lowest baseline concentrations were observed in non-diabetics and the highest values were observed in non-progressors, while progressors' concentrations fell between the two other sub-groups. A comparison of the 3 exemplar protective proteins among the 3 sub-groups is shown in FIG. 9, supporting the role of these protective proteins primarily against progressive renal decline.

    TABLE-US-00019 TABLE 9 Clinical characteristics and plasma concentrations of 8 confirmed protective proteins in non-diabetic parents of T1D subjects and in the combined Joslin cohorts, for non-progressors and progressors. Combined Joslin cohorts (N = 358) Non-diabetics Non-progressors Progressors Characteristics (N = 79) (N = 140) (N = 218) At baseline Male, n 40 (51%) 78 (56%) 120 (55%) Age at study entry (years) 61 (57, 66) 56 (48, 61) 47 (40, 60) Duration of diabetes (years) 24 (14, 34) 24 (18, 31) BMI (kg/m.sup.2) 29 (25, 34) 27 (24, 33) Systolic BP (mm Hg) 133 (122, 148) 136 (126, 149) Diastolic BP (mm Hg) 72 (67, 81) 78 (70, 83) Insulin Rx, % 81% 89% Renoprotection Rx, % 82% 83% HbA1c (%) 5.4 (5.2, 5.6) 7.4 (6.9, 8.6) 8.4 (7.4, 9.6) eGFR (ml/min/1.73 m.sup.2) 71.2 (62, 82) 49 (42, 55) 42 (34, 51) ACR (mg/g creatinine) 5.8 (3.9, 7.8) 175 (40, 502) 1106 (402, 2232) During follow-up eGFR slope (ml/min/1.73 m.sup.2/year) ?1.2 (?2.2, ?0.31) ?6.2 (?9.8, ?4.1) Deaths unrelated to ESKD, n (%) 10 (7%) 13 (6%) Baseline plasma concentrations (RFU) Sub-group A SPARC 17775 (13587, 28777) 43192 (30001, 62701) 33266 (21572, 49352) CCL5 14900 (7180, 24835) 25351 (13498, 46022) 18973 (10635, 32056) APP 23162 (17824, 36917) 45776 (29392, 72317) 35561 (23106, 52307) PF4 20031 (9581, 46044) 52730 (21260, 100893) 31230 (13449, 70052) ANGPT1 757 (640, 1189) 1564 (1093, 2522) 1248 (934, 1916) Sub-group B DNAJC19 540 (484, 585) 587 (540, 675) 555 (507, 604) TNFSF12 270 (240, 296) 291 (269, 316) 267 (244, 288) Sub-group C FGF20 371 (311, 417) 491 (449, 550) 460 (421, 507) BMI, Body mass index; BP, Blood pressure; Rx, treatment; Renoprotection, Prescription of angiotensin-converting enzyme inhibitor (ACE-I) or angiotensin II receptor blocker (ARB); HbA1c, Hemoglobin A1c; eGFR, Estimated glomerular filtration rate; ACR, Albumin-to-creatinine ratio; RFU, Relative fluorescence unit. Data presented as median (25.sup.th, 75.sup.th percentile) or count (proportion) measures.

    [0228] To examine whether plasma concentration of protective proteins preceded the diabetic state and the development of early renal decline, a comparative analysis was performed on plasma concentration of the 3 exemplar protective proteins (ANGPT1, TNFSF12 and FGF20) in non-diabetic parents of two categories of T1D probands, normo-albuminuria or ESKD (or proteinuria). Baseline characteristics and baseline values of the 3 protective proteins among non-diabetic parents of the two categories of T1D probands are shown in Table 10. Interestingly, as depicted in Table 10, parents of children with kidney complications (ESKD or Proteinuria) had significantly lower circulating FGF20 concentrations than parents with children who remained without kidney complications despite long diabetes duration.

    TABLE-US-00020 TABLE 10 Circulating plasma concentrations of top 3 protective proteins in non-diabetic parents of two categories of T1D probands. Normoalbuminuria Proteinuria or ESKD Characteristics (N = 40) (N = 39) At baseline Male, n (%) 50% 51% Age, years 61 ? 6 62 ? 5 eGFR (ml/min/1.73 m.sup.2) 75 ? 13 71 ? 13 HbAlc (%) 5.4 ? 0.3 5.4 ? 0.4 ACR (?g/mg creatinine) 5.9 ? 3.4 9.4 ? 13.5 Baseline plasma concentrations (RFU) ANGPT1 771 (577, 1185) 746 (658, 1203) TNFSF12 266 (242, 283) 273 (240, 303) FGF20 392 (351, 449) 337 (298, 383)** ESKD, end-stage kidney disease; HbA1c, hemoglobin A1c; ACR, albumin-to-creatinine ratio; eGFR, estimated glomerular filtration rate; RFU, relative fluorescent unit. Data presented as mean ? standard deviation, median (25.sup.th, 75.sup.th percentile) or count (proportion) measures. Differences between the two groups were tested using the Wilcoxon-rank-sum test for continuous variables. **P < 0.01.

    Discussion of Examples 1 to 6

    [0229] Through unbiased proteomic profiling, the present study described in the above examples identified circulating plasma proteins that were specifically associated with protection against progressive renal decline and progression to ESKD in two independent cohorts of subjects with diabetes and moderately impaired kidney function. Eight circulating proteins were identified that had a protective effect against progressive renal decline independent from clinical covariates such as baseline eGFR, HbA1c, ACR and type of diabetes. These proteins could be grouped into three sub-groups; (A) SPARC, CCL5, APP, PF4, ANGPT1, (B) DNAJC19, TNFSF12 and (C) FGF20. It is instructive to note that when the 8 confirmed protective proteins were considered together, only three proteins representing each of the sub-groups, e.g., ANGPT1, TNFSF12 and FGF20, showed a strong independent protective effect against progressive renal decline. The combined effect of these 3 exemplar protective proteins was nicely demonstrated by very low cumulative risk of ESKD in subjects who had values above median for all 3 proteins at the beginning of follow-up. Furthermore, the fact that the concentrations of these protective proteins were much higher in non-progressors than non-diabetics provides strong evidence that the proteins or the pathways that they represent, are causally involved in protection against progressive renal decline. These study findings are highly generalizable as the importance of these 3 exemplar protective proteins is confirmed in three independent cohorts of study participants with different types of diabetes, T1D and T2D, and at different stages of DKD, those with early and late stages of DKD, that were prospectively followed for a decade.

    [0230] Angiopoietins (ANGPT) are growth factors involved in angiogenesis and vascular inflammation. Among the members of the ANGPT family, Angiopoietin-1 (ANGPT1) and Angiopoietin-2 (ANGPT2) are both ligands for the Tie-2 receptor (Suri et al., Cell 87: 1171-1180 (1996); Maisonpierre et al., Science 277: 55-60 (1997)). ANGPT1 is a major ligand and activator of the Tie-2 receptor, maintaining vessel integrity by activation of the phosphatidyl-inositol 3-kinase/protein kinase B (PI3K/Akt) pathway (Brindle et al., Circ Res 98: 1014-1023 (2006)), therefore protecting the endothelium from excessive activation by growth factors and cytokines (Fiedler et al., Trends Immunol 27: 552-558 (2006)). ANGPT2, on the other hand, is considered a natural antagonist of ANGPT1 by preventing the binding of ANGPT1 to the Tie-2 receptor, consequently reducing ANGPT1/Tie-2 pathway activation and promoting blood vessel wall destabilization and vascular leakage (Maisonpierre et al., Science 277: 55-60 (1997); Fiedler et al., Trends Immunol 27: 552-558 (2006)). Since ANGPT1 and ANGPT2 are competing with each other for the Tie-2 receptor and have opposite actions, it is perhaps beneficial to measure both angiopoietins to assess the equilibrium of the ongoing angiogenesis process, such that disruption of the equilibrium between ANGPT1 and ANGPT2 (e.g. in favor of ANGPT2) leads to diabetes-mediated angiopoietin imbalance, e.g. destabilization of blood vessel walls, promotes inflammation and fibrosis (Gnudi, Diabetologia 59: 1616-1620 (2016)). Since ANGPT2 was measured on the SOMAscan platform and the results were available for this study, the protective effect of ANGPT1 was compared with the risk effect of ANGPT2 as well as the effect of ratio of ANGPT1/ANGPT2 (in favor of ANGPT1) on the risk of progressive renal decline. Unfortunately, the findings of these analyses did not show a stronger protective effect of the ratio of the two angiopoietins in comparison with the protective effect of ANGPT1 alone (Table 11), supporting the protective role of ANGPT1 alone against progressive renal decline rather than the ratio of the two angiopoietins.

    TABLE-US-00021 TABLE 11 Logistic regression models comparing the protective effect of ANGPT1, the risk effect of ANGPT2 and the effect of ANGPT1/ANGPT2 ratio on the risk of progressive renal decline in the combined Joslin cohorts. Model 1 Model 2 Protein OR (95% CI) OR (95% CI) ANGPT1 0.68 (0.56, 0.83) 0.72 (0.57, 0.91) ANGPT2 1.48 (1.21, 1.81) 1.19 (0.95, 1.51) ANGPT1/ANGPT2 Ratio 0.68 (0.55, 0.82) 0.79 (0.63, 1.01) ANGPT1, Angiopoietin-1; ANGPT2, Angiopoietin-2. Model 1: Unadjusted; Model 2: Adjusted for baseline eGFR, HbA1c and ACR. All models were adjusted by type of diabetes.

    [0231] More research has been done regarding the protective effect of ANGPT1. ANGPT1 has been shown to exert an anti-inflammatory effect and protect endothelial cell permeability against inflammatory factors (Pizurki et al., Br J Pharmacol 139: 329-336 (2003)). A variant of ANGPT1, known as Cartilage Oligomeric Matrix Protein-angiopoietin-1 (COMP-Ang1) was developed to investigate the protective effect of COMP-Ang1 in unilateral ureteral obstruction-induced renal fibrosis and in diabetic nephropathy animal models (Kim et al., J Am Soc Nephrol 17: 2474-2483 (2006); Lee et al., Nephrol Dial Transplant 22: 396-408 (2007)). Diabetic db/db mice treated with COMP-Ang1 had reduced albuminuria and fasting blood glucose concentrations, decreased mesangial expansion, thickening of the glomerular basement membrane and podocyte foot process broadening (Lee et al., Nephrol Dial Transplant 22: 396-408 (2007)). Studies using genetically modified mice have further confirmed the importance of ANGPT1 expression concentrations in diabetic glomerular disease. Overexpression or repletion of ANGPT1 in diabetic mice, specifically in the glomeruli, led to a reduction in albumin excretion accompanied by a decrease in diabetes-induced nephrin phosphorylation (Dessapt-Baradez et al., J Am Soc Nephrol 25: 33-42 (2014)), resulting in a reduced nephrin degradation and podocyte foot process broadening, leading to a more stable and functional glomerular filtration barrier (Zhu et al., Kidney International 73: 556-566 (2008)). Taking all these observations together with our strong findings in humans showing elevated plasma ANGPT1 concentrations protected against progressive renal decline, it is quite evident that ANGPT1 may be a potential therapeutic target to prevent or reduce the risk of progressive renal decline in diabetes.

    [0232] The present study demonstrated that ANGPT1 is significantly and highly correlated with four other confirmed protective proteins (PF4, SPARC, APP and CCL5), suggesting that these proteins may have similar physiological relevance, be part of common pathways or be under the same genetic regulations. A common pathway in which all 5 of these proteins are expressed and secreted relates to platelet function. Thrombin is known to induce the release of ANGPT1 from platelets to aid in endothelial cell stabilization during vascular repair (Li et al., Thromb Haemost 85: 204-206 (2001)). Platelet Factor-4 (PF4) is released from the alpha-granules of activated platelets and binds with high affinity to heparin. It is a strong chemoattractant for neutrophils, fibroblasts, and monocytes (Lord et al., J Biol Chem 292: 4054-4063 (2017)). Secreted protein acidic and rich in cysteine (SPARC) is also an alpha granule component of human platelets and is secreted during platelet activation. Additionally, it is also produced by fibroblasts, endothelial cells, macrophages, and adipocytes. SPARC is involved in cell proliferation, repair of tissue damage, collagen matrix formation, and osteoblast differentiation (Yun et al., Biomed Res Int 2016: 9060143 (2016)). Platelets are the primary source of amyloid beta A4 protein (APP) in blood circulation (Li et al., Blood 84: 133-142 (1994)). C-C motif chemokine 5 (CCL-5), also known as RANTES, is also released by activated platelet alpha-granules, deposited on inflamed endothelium, and mediates transmigration of monocytes onto activated endothelium. Low plasma CCL-5 concentrations are an independent predictor of cardiac mortality in patients referred for coronary angiography (Nomura et al., Clin Exp Immunol 121: 437-443 (2000)). Previous studies have reported that activated platelets play a role in the development of diabetic nephropathy (Omoto et al., Nephron 81: 271-277 (1999); Zhang et al., J Am Soc Nephrol 29: 2671-2695 (2018)). The results of this study further point to the importance of platelet secreted proteins in the progression of diabetic nephropathy. Platelet activated protein secretion may protect against vascular damage associated with leukocyte trafficking, thereby protecting against faster progression of diabetic nephropathy. The relevance of these proteins with regard to protection against progressive renal decline needs to be investigated further.

    [0233] Tumor Necrosis Factor (TNF) Ligand Superfamily Member 12 (TNFSF12), also known as TWEAK, is a member of a large TNF superfamily of ligands and receptors (Chicheportiche et al., J Biol Chem 272: 32401-32410 (1997)). Findings from in vitro and in vivo models have shown that the administration of TNFSF12 increases inflammatory cytokine production in renal tubular cells, e.g. increased mRNA and protein expression of monocyte chemoattractant protein-1 and interleukin-6 (IL-6), whereas the blockage of TNFSF12 prevented tubular chemokine and IL-6 expression, interstitial inflammation and macrophage infiltration in mice (Sanz et al., J Am Soc Nephrol 19: 695-703 (2008)). The role of TNFSF12 in the development/progression of DKD remains unclear. So far there has been sparse literature devoted to this topic; a few cross-sectional studies have investigated a relationship between circulating TNFSF12 concentrations and DKD. One study reported decreased circulating TNFSF12 concentrations in T2D and ESKD subjects (Kralisch et al., Atherosclerosis 199: 440-444 (2008)). The actions of TNFSF12 in other kidney diseases and other forms of diabetes have also been reported (Sanz et al., J Cell Mol Med 13: 3329-3342 (2009); Dereke et al., PLoS One 14: e0216728 (2019); Bernardi et al., Clin Sci (Lond): 133, 1145-1166 (2019)). In experimental folic acid-induced acute kidney injury, TNFSF12 deficiency reduced kidney apoptosis and inflammation and improved kidney function. A case-control study involving women with and without gestational diabetes mellitus (GBM) reported decreased TNFSF12 concentrations in women with GBM compared to pregnant volunteers without GBM. The present study is the only follow-up observation in which very robust findings point to TNFSF12 as a protective protein against progressive renal decline, contrary to findings in the aforementioned studies. This finding needs to be explored further in humans and in animal studies.

    [0234] Fibroblast growth factor 20 (FGF20) is a member of a large family of 22 fibroblast growth factors (FGFs), comprising 7 sub-families consisted of secreted signaling proteins and intracellular non-signaling proteins (Itoh et al., J Biochem 149: 121-130 (2011)). Seventeen out of 22 FGFs were measured on the SOMAscan proteomic platform and only FGF20 was robustly associated with protection against progressive renal decline. FGF20 is a novel neurotrophic factor that was originally identified in the rat brain and has been suggested to play vital roles in the development of dopaminergic neurons (Ohmachi et al., Biochem Biophys Res Commun 277: 355-360 (2000); Correia et al., Front Neuroanat 1: 4 (2007); Shimada et al., J Biosci Bioeng 107: 447-454 (2009)). In addition, numerous studies have reported correlations between Parkinson's disease susceptibility with FGF20 genetic polymorphisms in different ethnicities although some studies reported no evidence of association between FGF20 and Parkinson's disease (Pan et al., Parkinsonism Relat Disord 18: 629-631 (2012); Sadhukhan et al., Neurosci Lett 675: 68-73 (2018); van der Walt et al., Am J Hum Genet 74: 1121-1127 (2004); Clarimon et al., BMC Neurol 5: 11 (2005); Wider et al., Mov Disord 24: 455-459 (2009)). Interestingly, a previous study demonstrated the essential role of FGF20/Fgf20 in the development of kidney by maintaining the stemness of nephron progenitors both in humans and in mice (Barak et al., Dev Cell 22: 1191-1207 (2012)). FGF20 was expressed exclusively in nephron progenitors in the kidney. Loss of FGF20/Fgf20 in humans and in mice resulted in kidney agenesis, a condition in which one or both fetal kidneys fail to develop and hence a newborn was missing one or both kidneys.

    [0235] FGF20 was first discovered in 2001 by Jeffers and his colleagues as they identified FGF20 as a novel oncogene that may represent a potential target for the treatment of human malignancy (Jeffers et al., Cancer Research 61: 3131-3138 (2001)). Subsequently, the same authors demonstrated that FGF-20 (CG53135-05) has therapeutic activity to treat experimental intestinal inflammation (Jeffers et al., Gastroenterology 123: 1151-1162 (2002)), whereas another study reported FGF20 as a novel radioprotectant such that the administration of a single dose of FGF20 in mice before potentially lethal total-body radioactivity, reduced the lethal effects of acute radiation exposure and led to substantial increases in overall survival (Maclachlan et al., Int J Radiat Biol 81: 567-579 (2005)). Based on these findings, CG53135-05 (re-named as Velafermin) was evaluated in a Phase II clinical trial of cancer patients as a protective drug against developing oral mucositis, a side effect of chemotherapy (Schuster et al., Support Care Cancer 16: 477-483 (2008)). Results of this trial showed that Velafermin had a favorable safety and tolerability profile, however, it did not demonstrate sufficient efficacy when added to the treatment of oral mucositis.

    [0236] The present study demonstrates FGF20 as one of the confirmed protective proteins that is most strongly associated with protection against progressive renal decline and progression to ESKD in the combined cohorts with T1D and T2D. The association is independent from circulating inflammatory proteins and relevant clinical covariates. High plasma concentrations of FGF20 at baseline predicted less renal decline during 7-15 years of follow-up. This association points to the involvement of FGF20 and its independent role to retard or decrease the risk of progressive renal decline and development of ESKD. As such, FGF20 may be a useful target for preventing or delaying the onset of progressive renal decline and ESKD in diabetes. Another interesting finding from our study was observed in plasma profiles of non-diabetic parents of two categories of T1D probands, either normo-albuminuria or ESKD/Proteinuria. Surprisingly, non-diabetic parents of T1D offspring with ESKD/Proteinuria had significantly lower plasma concentrations of FGF20 than those parents with T1D offspring without kidney complications. These findings prompt a question and/or speculation whether a genetic predisposition or component inherited from a parent may modulate corresponding protein concentrations in their offspring, and if confirmed in larger studies, could have a profound implication in future research on determinants of progressive renal decline in T1D (and also in T2D).

    [0237] Recent interest in studies on protective factors against late diabetic complications, including DKD, has been initiated by the Joslin Medalist Study. This cross-sectional study enrolled nationwide subjects who survived with T1D for at least 50 years. Those who remained without late diabetic complications have been compared with regard to a large number of characteristics including variousomics profiles of biospecimens with non-diabetic spouses and with those who developed complications very late in the diabetes course. Comparing proteomic profiles of kidney tissues obtained from subjects in the three sub-groups, several glucose metabolic enzymes/proteins were identified in the glomeruli, including PKM2, which were highly elevated among those who remained without DKD despite extremely long duration of diabetes. By following this finding with a series of functional studies, the authors concluded that the upregulation of PKM2 may be a way of preventing the development of DKD (Qi et al., Nat Med 23: 753-762 (2017)).

    [0238] The present study also searched for protective factors but was very different from the Medalist study. Where the latter was cross-sectional and searched for candidate protective proteins to be investigated in cellular and animal studies, this study was a Joslin clinic population-based prospective observation that investigated the association between baseline circulating plasma proteins that protected against progressive renal decline and fast progression to ESKD during 7-15 years of follow-up. Furthermore, the two studies were based on two different premises. The Medalist study aimed to find protective proteins against onset/development of late diabetic complications whereas this study aimed to identify protective proteins against progressive renal decline in subjects with already existing mild renal impairment. This is most likely the reason we could not confirm with statistical significance the PKM2 finding obtained in the Joslin Medalist study.

    [0239] The strengths of this study include its prospective design, long-term follow-up observations of three independent study cohorts, the consistency of data in T1D and T2D, and the use of SOMAscan proteomic platform to measure protein concentrations in all Joslin cohorts. Furthermore, in this study, findings for key potential confounders and type of diabetes were adjusted. However, as with any study, the present study must be also considered in light of potential limitations. First, this is an observational study and while these proteins might directly protect against progression of renal decline, they could alternatively be indirect reporters of a protective process. Causal explanations of our findings will need to be established through animal models and clinical trials for confirmation that they are directly protective. Second, the findings are restricted to Caucasian individuals with diabetes who have chronic kidney disease and impaired kidney function, therefore, the results may not be generalizable to individuals in other populations and with other kidney diseases. Third, the baseline plasma samples were not taken at the onset of diabetes, hence, slow or fast progressive renal decline is relative to the time of blood sampling but not the onset of disease. The present study includes a subset of participants enrolled into the JKS in the 2000s and followed until 2012-13. Before enrollment, these individuals were under the care of the Joslin Clinic for many years (it was impractical to follow these individuals at the very beginning of diabetes onset) and their inclusion in our prospective studies was unrelated to their unknown future outcomes during subsequent follow-up. Therefore, these study findings reflect the unbiased contemporary natural history of CKD and the development of ESKD in individuals with diabetes. Notwithstanding the foregoing, the identification of protective proteins for ESKD and progression thereto, is remarkable and provides ample opportunity for both diagnostics and therapies for addressing what is a devastating diagnosis for any patient.

    Example 7. Circulating Level of Testican-2 is Independently Associated with Protection Against ESKD in T1D Patients

    [0240] We searched for additional protective proteins using SOMAscan in a small Joslin Cohort with T1D. Characteristics for patients who progressed to ESKD within 10 years of follow-up and for those who remained without ESKD are shown in Table 12. The circulating level of Testican-2 (SPOCK2) was significantly higher in non-progressors than in progressors. This difference is illustrated in FIG. 10. Similar difference was observed for the three protective proteins, FGF20, TNFSF12 and ANGPT1 as described in the examples above.

    TABLE-US-00022 TABLE 12 Clinical characteristics of 113 Joslin T1D Late DKD patients. Non-ESKD progressors ESKD Characteristics (n = 54) progressors (n = 59) p-value At baseline Male, n (%) 23 (43%) 31 (53%) Age (years) 50 (41, 56) 45 (37, 51) Duration of diabetes (years) 35 (24, 41) 28 (21, 35) HbAlc (%) 8.3 (7.5, 9.2) 8.7 (7.7, 10) eGFR (ml/min/1.73 m.sup.?2) 48 (40, 53) 36 (25, 44) ACR (mg/g creatinine) 282 (28, 681) 1720 (712, 2568) During follow-up eGFR slope (ml/min/1.73 m.sup.?2/year) ?2.0 (?3.5, ?1.0) ?6.7 (?10, ?4.0) Baseline plasma concentrations (RFU) SPOCK2 664 (588, 738) 526 (473, 635) 2.04E?05 FGF20 486 (434, 531) 432 (392, 483) 5.71E?05 TNFSF12 283 (261, 303) 248 (233, 270) 2.04E?05 ANGPT1 1866 (1273, 2847) 1272 (1069, 1781) 1.04E?03 T1D, Type 1 diabetes; DKD, Diabetic kidney disease; HbA1c, Hemoglobin A1c; eGFR, Estimated glomerular filtration rate; ACR, Albumin-to-creatinine ratio; ESKD, End-stage kidney disease; RFU, Relative fluorescence unit; SPOCK2, Testican-2; FGF20, Fibroblast growth factor 20; TNFSF12, Tumor necrosis factor superfamily ligand 12; ANGPT1, Angiopoietin-1.

    [0241] To test the protective effect of circulating SPOCK2 (Testican-2) against progression to ESKD, we performed logistic a regression analysis. The results are shown in Table 13 below. In the univariate logistic regression (Model 1) all protective proteins had strong protective effect against progression to ESKD (OR below 1 indicates protective effect). Protective effect for SPOCK2 (Testican-2) was also seen in multivariable logistic regression analysis (Model 2) when relevant clinical variable and all protective proteins were analyzed together.

    [0242] In conclusion, circulating level of SPOCK2 (Testican-2) is independently associated with protection against ESKD, and can be used together with the three protective proteins (FGF20, ANG1 and TNFSF12) previously reported to develop a so-called protection index.

    TABLE-US-00023 TABLE 13 Associations of 4 protective proteins with the development of ESKD in the Joslin cohort with T1D. Logistic models Model 1 Model 2 Protein OR (95% CI) P-value OR (95% CI) P-value SPOCK2 0.37 (0.25, 0.57) 3.20E?06 0.49 (0.30, 0.78) 3.00E?04 FGF20 0.49 (0.34, 0.72) 2.00E?04 x x TNFSF12 0.42 (0.29, 0.63) 2.00E?05 x x ANGPT1 0.57 (0.40, 0.81) 2.00E?03 x x eGFR 0.37 (0.25, 0.57) 3.20E?06 x x ACR 3.52 (2.21, 5.62) 1.30E?07 x x HbA1c 1.38 (0.98, 1.96) 6.75E?02 x x

    [0243] The effect is shown as an odds ratio (OR) per one quartile change in circulating concentration of specific protein with corresponding 95% CIs. OR below 1 indicates protection.

    [0244] Model 1: OR for covariates without adjustments

    [0245] Model 2; OR for SPOCK2 was adjusted for FGF20, ANG1, TNFSF12, eGFR, ACR and HbA1c

    [0246] T1D, Type 1 diabetes; ESKD, End-stage kidney disease; OR, Odds ratio; CI, Confidence interval; HbA1c, Hemoglobin A1c; GFR, Glomerular filtration rate; ACR, Albumin-to-creatinine ratio, SPOCK2, Testican-2; FGF20, Fibroblast growth factor 20; TNFSF12, Tumor necrosis factor superfamily ligand 12; ANGPT1, Angiopoietin-1.

    [0247] x: data not available

    TABLE-US-00024 TABLE14 SEQUENCETABLE Sequence Identifier AminoAcidSequence Description SEQIDNO:1 MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAE Human VTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQN SPARC HHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKV CSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPC KYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNL LTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNY NMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPM EHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD LVI SEQIDNO:2 MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIA Human RPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPE CCL5 KKWVREYINSLEMS SEQIDNO:3 MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMF HumanAPP CGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYC QEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPH FVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHL HWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFV CCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGS EDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEA EEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAET GPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTE EYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTP DAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQ VMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQE AANERQQLVETHMARVEAMLNDRRRLALENYITALQ AVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRM VDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAV AEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDA LMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVP ANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEV KMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLM VGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTP EERHLSKMQQNGYENPTYKFFEQMQN SEQIDNO:4 MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGD HumanPF4 LQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLK NGRKICLDLQAPLYKKIIKKLLES SEQIDNO:5 MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQV Human FQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTAN DNAJC19 KGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEG QAKK SEQIDNO:6 MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHG Human QCAYTFILPEHDGNCRESTTDQYNTNALQRDAPHVEPD ANGPT1 FSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMA QIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQ VLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEK NSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTY IIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCT KEGVLLKGGKREEEKPFRDCADVYQAGENKSGIYTIYI NNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRG WKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIEL MDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAG KQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWF DACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSL RSTTMMIRPLDF SEQIDNO:7 MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGL Human LLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQT TNFSF12 EESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEV HPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIG EFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLA LRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIR TLPWAHLKAAPFLTYFGLFQVH SEQIDNO:8 MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLG Human ERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGF FGF20 HLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVD SGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYS SNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTH FLPRPVDPERVPELYKDLLMYT SEQIDNO:9 GGPGAAQLAHLHGILR FGF20 tryptic peptide(a.a. 50-65) SEQIDNO: HHHHHH hexahistidine 10 SEQIDNO: MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGN Human 11 FMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYIKSWE Testican-2 DNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAM (SPOCK2) CISRKKLEHRIKQPTVKLHGNKDSICKPCHMAQLASVC GSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQ AATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSK QNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTS ADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVS TAEWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSC DEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHGS PDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEE GEAGEADDGGYIW

    INCORPORATION BY REFERENCE

    [0248] The entire contents of all references, patents and published patent applications cited throughout this application are hereby incorporated by reference in their entirety.