Therapeutic agents and methods for enhancing immune responses in tumor microenvironment

12024560 ยท 2024-07-02

Assignee

Inventors

Cpc classification

International classification

Abstract

Human IgG1, IgG2, and IgG4 mutants having mutations in the hinge domain and exhibiting altered binding activity to Fc? receptors such as Fc?RIIB (CD32B). Also provided herein are methods for selectively activating immune responses in a subject using a therapeutic agent capable of targeting both an immune cell surface receptor and Fc?RIIB.

Claims

1. A protein comprising a variant Fc region, wherein the variant Fc region comprises the amino acid sequence of SEQ ID NO: 6 or SEQ ID NO: 18.

2. The protein of claim 1, wherein the variant Fc region comprises the amino acid sequence of SEQ ID NO:6.

3. The protein of claim 1, wherein the variant Fc region comprises the amino acid sequence of SEQ ID NO: 18.

4. The protein of claim 1, wherein the protein is an antibody.

5. A pharmaceutical composition, comprising the protein of claim 1 and a pharmaceutically acceptable carrier.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIGS. 1A-1W are charts showing binding activity of various IgG variants as indicated to different types of Fc? receptors expressed on CHO-K1 cells at the various concentrations as indicated. The concentrations of each IgG variant, from left to right, are 0 ?g/ml, 0.3 ?g/ml, 1 ?g/ml, 3 ?g/ml, and 10 ?g/ml in FIGS. 1A-1C, 1E-J, 1L-1N, 1P-1R, and 1T-1V. For FIGS. 1D, 1K, 1O, 1S, and 1W the bars, from left to right, correspond to the following concentrations of IgG variant: 0.3 ?g/ml, 1 ?g/ml, 3 ?g/ml, and 10 ?g/ml.

(2) FIGS. 2A-2C are charts showing stimulation of human CD8+ T cells in co-culture with parental or Fc?R expressing cells by a number of IgG variants as indicated by IFN-? secretion. The groups, from left to right, correspond to: no OKT, 0.01 ?g/ml, 0.03 ?g/ml, 0.1 ?g/ml, and 0.3 ?g/ml, in FIG. 2A. In FIGS. 2B and 2C, the groups, from left to right, correspond to 0.01 ?g/ml, 0.03 ?g/ml, and 0.1 ?g/ml.

(3) FIG. 3 is a chart showing murine T cell activation by a number of IgG molecules in the presence of anti-CD3 and/or anti-4-1BB antibodies.

(4) FIGS. 4A-4B are charts showing in vivo anti-tumor effects and the induction of serum ALT levels by anti-murine CD137 antibodies of different IgG isoforms.

(5) FIGS. 5A-5H are charts showing the antibody concentration of IgG variants in plasma after a single intravenous injection of 1-3 mg/kg. Male C57BL/6 mice were used, and four mice were assayed per time point. The charts of FIG. 5A show the plasma concentrations G1m27 after an IV dose of 3 mg/kg (top graph) and of G4m10 after an IV dose of 1.45 mg/kg (bottom graph). The charts of FIG. 5B show the plasma concentrations of G1m2 after an IV dose of 3 mg/kg (top graph) and of G4m2 after an IV dose of 3 mg/kg (bottom graph). The charts of FIG. 5C show the plasma concentrations of G1m29 after an IV dose of 3 mg/kg (top graph) and of G4m7 after an IV dose of 3 mg/kg (bottom graph). The charts of FIG. 5D show the plasma concentrations of G1m28 after an IV dose of 3 mg/kg (top graph) and of G4 after an IV dose of 3 mg/kg. The charts of FIG. 5E show the plasma concentrations of G4m28 after an IV dose of 1.45 mg/kg (top graph) and of G4m29 after an IV dose of 1.5 mg/kg (bottom graph). The charts of FIG. 5F show the plasma concentrations of G4m1 after an IV dose of 3 mg/kg (top graph) and of G4m27 after an IV dose of 1.45 mg/kg (bottom graph). FIG. 5G shows the plasma concentrations of G2m19 after an IV dose of 3 mg/kg (top graph) and of G2m1 after an IV dose of 3 mg/kg (bottom graph). FIG. 5H shows the plasma concentrations of G2 (wild type) after an IV dose 3 mg/kg (top graph) and of G1Maa after an IV dose of 3 mg/kg (bottom graph).

DETAILED DESCRIPTION OF THE INVENTION

(6) Agonistic anti-TNFR antibodies that are capable of binding to Fc?RIIB (CD32B) showed enhanced activity in mouse models and mouse IgG1 isoform showed the best anti-tumor efficacy. These results indicate that agonistic antibodies having selective binding activity to the Fc?RIIB (CD32B) would be expected to have better agonistic activity in stimulating immune responses. Further, it was observed that certain anti-tumor agonist antibodies showed differential liver toxicity, suggesting a novel approach for designing therapeutic agonist antibodies with enhanced therapeutic index (e.g., high treatment efficacy and low toxicity).

(7) Accordingly, described herein are approaches for designing IgG molecules (e.g., IgG1, IgG2, and IgG4 molecules such as human IgG1, human IgG2, and human IgG4 molecules) containing an Fc variant having selective binding activity to Fc?RIIB (CD32B) as relative to other Fc receptors such as Fc?RIII (CD16), and cancer treatment methods, which involve the use of therapeutic agents capable of cross-linking an immune cell receptor such as a receptor of the tumor necrosis factor receptor superfamily (TNFSF) and Fc?RIIB

(8) I. Fc Variants

(9) Described herein are Fc variants having enhanced selectivity to Fc?RIIB relative to its wild-type counterpart. An Fc fragment having selectivity to Fc?RIIB, selectively binding to Fc?RIIB, or specifically binding to Fc?RIIB is a term well understood in the art. A molecule is said to exhibit selective binding or specific binding if it reacts more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen (e.g., an Fc?RIIB receptor) than it does with alternative targets (e.g., Fc?RIII receptors). An Fc fragment specifically binds to an Fc receptor if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other Fc receptors. For example, an Fc fragment that specifically (or preferentially) binds to Fc?RIIB is an Fc fragment that binds this Fc receptor with greater affinity, avidity, more readily, and/or with greater duration than it binds to other Fc receptors. It is also understood with this definition that, for example, an Fc fragment that selectively or specifically binds to a first Fc receptor may or may not specifically or preferentially bind to a second Fc receptor. As such, selective binding, specific binding or preferential binding does not necessarily require (although it can include) exclusive binding. In some examples, an Fc fragment that selectively binds, or specifically binds to a target Fc receptor (e.g., Fc?RIIB) may not bind to other Fc receptors (i.e., binding not detectable by routine methods). Relative binding affinities of IgG1, IgG2, and IgG4 to different Fc receptors are given in Table 1 below.

(10) TABLE-US-00001 TABLE 1 Relative Binding Affinities of Human and Mouse Immunoglobulins to Fc Receptors Human Mouse Fc?R IgG1 IgG2 IgG4 Fc?R IgG1 IgG2a IgG2b I + + + + ? + + + + I ? + + + + + + + + IIa (H131) + + + + + + + III + + + + + + IIa (R131) + + + + + + IIb + + +/? + + IIb + + + + + + + + IIIa (V158) + + + + + + IV ? + + + + + IIIa (F158) + + +/? + +

(11) The Fc variants described herein may have enhanced selectivity to Fc?RIIB relative to their wild-type counterparts (the wild-type parent Fc region in which mutations are introduced to produce the Fc variants). The relative binding activity to Fc?RIIB versus another Fc receptor (e.g., Fc?RIII) of such an Fc variant is higher than the relative binding activity to Fc?RIIB versus the other Fc receptor (e.g., Fc?RIII) of the wild-type counterpart. The Fc variant may have enhanced binding activity to Fc?RIIB and/or decreased binding activity to another Fc receptor, for example, Fc?RIII In some embodiments, the Fc variants described herein may have decreased binding activity to both Fc?RIIB and another Fc receptor (for example, Fc?RIII); however, the level of decreased binding activity to the other Fc receptor (e.g., Fc?RIII) is greater than the level of decreased binding activity to Fc?RIIB

(12) In some embodiments, an Fc variant as described herein has a suitable binding affinity for Fc?RIIB, e.g., enhanced as compared with the wild-type parent Fc from which the Fc variant is derived. As used herein, binding affinity refers to the apparent association constant or K.sub.A. The K.sub.A is the reciprocal of the dissociation constant (K.sub.D). The Fc variant described herein may have a binding affinity (K D) of at least 10.sup.?5, 10.sup.?6, 10.sup.?7, 10.sup.?8, 10.sup.?9, 10.sup.?10 M, or lower for Fc?RIIB. An increased binding affinity corresponds to a decreased K.sub.D. Higher affinity binding of an Fc fragment for a first Fc receptor relative to a second Fc receptor can be indicated by a higher K.sub.A (or a smaller numerical value K.sub.D) for binding the first Fc receptor than the K.sub.A (or numerical value K.sub.D) for binding the second Fc receptor. In such cases, the Fc variant has specificity for the first Fc receptor relative to the second Fc receptor. In some embodiments, the Fc variants described herein have a higher binding affinity (a higher K.sub.A or smaller K.sub.D) to Fc?RIIB as compared to the binding affinity to Fc?RIII (either Fc?RIIIA or Fc?RIIIB) Differences in binding affinity (e.g., for specificity or other comparisons) can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 10.sup.5 fold.

(13) Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g., using a fluorescence assay). See also Examples below. Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v/v) Surfactant P20). These techniques can be used to measure the concentration of bound binding protein as a function of target protein concentration. The concentration of bound binding protein ([Bound]) is generally related to the concentration of free target protein ([Free]) by the following equation:
[Bound]=[Free]/(Kd+[Free])

(14) It is not always necessary to make an exact determination of K.sub.A, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to K.sub.A, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay (an in vitro or in vivo assay).

(15) In some embodiments, the Fc variants described herein may be designed by mutating one or more amino acid residues in the wild-type of human IgG1, IgG2, or IgG4 Fc fragments in light of the amino acid residues in the corresponding mouse IgG, for example, mouse IgG1. A sequence comparison of human and mouse IgGs is provided below (SEQ ID Nos: 67-69, 64, and 65, from top to bottom, each representing a combination of fragments 211-245, 260-278, and 320-332 of the corresponding Fc region):

(16) TABLE-US-00002 21-22-23-24-...26-27-...32-33- 123456789012345custom character 0123456789012345...0123456789012345678...0123456789012 UpperCoreLowerCH2 hIgG1 VDKKVEPK-SCDKTHTCPPCPAPELLGGPSVFLFPP...TCVVVDVSHEDPEVKFNWY...KCKVSNKALPAPI hIgG2 VDKTVERK-CC-V-E-CPPCPAPPVA-GPSVFLFPP...TCVVVDVSHEDPEVQFNWY...KCKVSNKGLPAPI hIgG4 VDKRVESKYG----PPCPSCPAPEELGGPSVFLFPP...TCVVVDVSQEDPEVQFNWY...KCKVSNKGLPSSI mIgG1 VDKKIVPR-DC--GCKPCICTVPEVS---SVFIFPP...TCVVVDISKDDPEVQFSWF...KCRVNSAAFPAPI mIgG2a VDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP...TCVVVDVSEDDPDVQISWF...KCKVNNKDLPAPI

(17) In some embodiments, the Fc variants described herein is a human IgG1, G2, or G4 Fc variants comprising one or more mutations (e.g., amino acid substitutions, deletions, or additions) in the hinge domain of an Fc fragment. Human IgGs contain a core motif of CPPC or CPSC in the hinge domain (positions 226-229 according to the EU index). Positions 216 to 225 are deemed as the upper portion of the hinge domain and positions 230-238 are deemed as the lower portion of the hinge domain. The numbering system used herein, unless explicitly indicated, is according to the EU index. In some examples, the one or more mutations can be located in the upper portion of the hinge domain. Alternatively or in addition, the one or more mutations can be located in the lower portion of the hinge domain.

(18) The mutations to a human IgG Fc can be made according to the corresponding amino acid residues in the hinge domain of mouse IgG1. For example, mouse IgG1 does not contain the GGP motif at positions 236-238. Accordingly, one or more of the residues in this GGP motif can be deleted from a human IgG1, IgG2, or IgG4 Fc fragment to produce the Fc variants described herein.

(19) Alternatively or in addition, the human Fc variants may contain one or more amino acid substitutions in the upper portion, in the lower portion, or both of the hinge domain. For example, the Fc variant may comprise one or more amino acid substitutions at one or more of positions 233, 234, 235, and/or 236. Such an amino acid substitution may be in combination with the deletion of one or more of the GGP motif (236-238) noted herein. These mutations may be introduced into a human IgG2 or IgG4 Fc fragment to produce the Fc variants described herein. In some examples, the Fc variants described herein contains a deletion at one or more of the positions 236-238 (e.g., 236, 237, 238 or any combination thereof)

(20) Any of the mutations in the hinge domain described herein may be in combination with a mutation (e.g., amino acid substitutions) at one or more positions that are involved in interaction with an Fc receptor. Such positions include, but are not limited to, positions 267, 273, 328, and/or 329. Exemplary amino acid substitutions at those positions include S261E, V271E, L328F, and P329G. Fc variants derived from IgG2 or IgG4 molecules that contain one or more mutations at positions 267, 273, 328, and/or 329 are also within the scope of the present disclosure. Such mutations may include amino acid substitutions at one or more of these positions, for example, S261E, V271E, L328F, and/or P329G.

(21) In some embodiments, an Fc variant described herein may comprise an amino acid sequence at least 85% identical (e.g., 90%, 95%, 98%, 99%, or above) to that of its wild-type counterpart (e.g., the Fc fragment of wild-type human IgG1, IgG2, or IgG4 described herein). The percent identity of two amino acid sequences is determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Sci. USA 87:2264-68, 1990, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. J. Mol. Biol. 215:403-10, 1990. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of interest. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.

(22) In one example, the amino acid residue substitutions in an Fc variant described herein are conservative amino acid residue substitutions. As used herein, a conservative amino acid substitution refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F. M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.

(23) Provided below is a sequence alignment showing exemplary positions where mutations can be introduced into hIgG1, hIgG2, and IgG4 to produce various Fc variants for the present disclosure.

(24) TABLE-US-00003 SequencealignmentofhumanIgG1variantsrelativetowild-typehumanIgG1 (SEQIDNOs:70-88,fromtoptobottom): embedded image

(25) TABLE-US-00004 SequencealignmentofhumanIgG2variantsrelativetowild-typehumanIgG2 (SEQIDNOs:89-105,fromtoptobottom): embedded image

(26) TABLE-US-00005 SequencealignmentofhumanIgG4variantsrelativetowild-typehumanIgG4 (SEQIDNOs:106-117,66,and118-127,fromtoptobottom) embedded image

(27) The amino acid sequences of wild-type human IgG1, IgG2, and IgG4 Fc fragments, and a number of exemplary hIgG1, hIgG2, and hIgG4 Fc variants are provided below:

(28) TABLE-US-00006 Aminoacidsequenceofwild-typehumanIgG1Fc fragment: (SEQIDNO:1) VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

(29) TABLE-US-00007 Aminoacidsequenceofwild-typehumanIgG2Fc fragment: (SEQIDNO:2) VDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWL NGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

(30) TABLE-US-00008 Aminoacidsequenceofwild-typehumanIgG4Fc fragment: (SEQIDNO:3) VDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK

(31) TABLE-US-00009 AminoacidsequenceofhumanIgG4S228PFc variant: (SEQIDNO:4) VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK

(32) TABLE-US-00010 AminoacidsequencesofexemplaryhumanIgG1Fc variants: G1m1: (SEQIDNO:5) VDKKVEPKSCDKTHTCPPCPAPELLSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m2: (SEQIDNO:6) VDKKVEPKSCDKTHTCPPCPAPELLGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m-2: (SEQIDNO:7) VDKKVEPKCCVECPPCPAPELLSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m-4: (SEQIDNO:8) VDKKVEPKYGPPCPPCPAPELLGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m5: (SEQIDNO:9) VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEEKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m7: (SEQIDNO:10) VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVEHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m8: (SEQIDNO:11) VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m9: (SEQIDNO:12) VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVEHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m15: (SEQIDNO:13) VDKKVEPKSCDKTHTCPPCPAPELLSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEEKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m17: (SEQIDNO:14) VDKKVEPKSCDKTHTCPPCPAPELLSVFLFPPKPKDTLMISRTPEVTCVV VDVEHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m18: (SEQIDNO:15) VDKKVEPKSCDKTHTCPPCPAPELLSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m19: (SEQIDNO:16) VDKKVEPKSCDKTHTCPPCPAPELLSVFLFPPKPKDTLMISRTPEVTCVV VDVEHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m25: (SEQIDNO:17) VDKKVEPKSCDKTHTCPPCPAPELLGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEEKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m27: (SEQIDNO:18) VDKKVEPKSCDKTHTCPPCPAPELLGPSVFLFPPKPKDTLMISRTPEVTC VVVDVEHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m28: (SEQIDNO:19) VDKKVEPKSCDKTHTCPPCPAPELLGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKAFPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1m29: (SEQIDNO:20) VDKKVEPKSCDKTHTCPPCPAPELLGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1mAA: (SEQIDNO:21) VDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G1mAG: (SEQIDNO:22) VDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

(33) TABLE-US-00011 AminoacidsequencesofexemplaryhumanIgG2Fc variants: G2m1: (SEQIDNO:23) VDKTVERKCCVECPPCPAPPVASVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m-1: (SEQIDNO:24) VDKTVERKSCDKTHTCPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQ DWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m2: (SEQIDNO:25) VDKTVERKCCVECPPCPAPPFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDW LNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m-4: (SEQIDNO:26) VDKTVERKYGPPCPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWL NGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m5: (SEQIDNO:27) VDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWL NGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m7: (SEQIDNO:28) VDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVEHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWL NGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m8: (SEQIDNO:29) VDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWL NGKEYKCKVSNKG:TAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m9: (SEQIDNO:30) VDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVEHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWL NGKEYKCKVSNKGFPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m10: (SEQIDNO:31) VDKTVERKCCVECPPCPAPEVSSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGFPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m15: (SEQIDNO:32) VDKTVERKCCVECPPCPAPPVASVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m17: (SEQIDNO:33) VDKTVERKCCVECPPCPAPPVASVFLFPPKPKDTLMISRTPEVTCVVVDV EHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m18: (SEQIDNO:34) VDKTVERKCCVECPPCPAPPVASVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGFPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m19: (SEQIDNO:35) VDKTVERKCCVECPPCPAPPVASVFLFPPKPKDTLMISRTPEVTCVVVDV EHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNG KEYKCKVSNKGFPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m20: (SEQIDNO:36) VDKTVERKCCVECPPCPAPPVAPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLN GKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK G2m27: (SEQIDNO:37) VDKTVERKCCVECPPCPAPPVAPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLN GKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Gbn28: (SEQIDNO:38) VDKTVERKCCVECPPCPAPPVAPSVFLFPPKPKDTLMISRTPEVTCVVVD VEHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHODWLN GKEYKCKVSNKGLPAPIEKTISKTKGQPREPOVYTLPPSREEMTKNOVSL TCLVKGFYPSDIAVEWESNGOPENNYKTTPPMLDSDGSFFLYSKLTVDKS RWOOGNVFSCSVMHEALHNHYTOKSLSLSPGK

(34) TABLE-US-00012 AminoacidsequencesofexemplaryhumanIgG4Fc variants: G4m1: (SEQIDNO:39) VDKRVESKYGPPCPPCPAPEFLSVFLFPPKPKDTLMISRTPEVTCVVVDV SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m-1: (SEQIDNO:40) VDKRVESKSCDKTHTPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS RLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m2: (SEQIDNO:41) VDKRVESKYGPPCPPCPAPEFLGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m-2: (SEQIDNO:42) VDKRVESKCCVEPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m3: (SEQIDNO:43) VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m4: (SEQIDNO:44) VDKRVESKYGPPCPPCPAPEFLSVFLFPPKPKDTLMISRTPEVTCVVVDV SQEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m5: (SEQIDNO:45) VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m7: (SEQIDNO:46) VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVEQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m8: (SEQIDNO:47) VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m9: (SEQIDNO:48) VDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVEQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m10: (SEQIDNO:49) VDKRVESKYGPPCPPCPAPEVSSVFLFPPKPKDTLMISRTPEVTCVVVDV SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m15 (SEQIDNO:128) VDKRVESKYGPPCPPCPAPEFLSVFLFPPKPKDTLMISRTPEVTCVVVDV SQEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m17: (SEQIDNO:50) VDKRVESKYGPPCPPCPAPEFLSVFLFPPKPKDTLMISRTPEVTCVVVDV EQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m18: (SEQIDNO:51) VDKRVESKYGPPCPPCPAPEFLSVFLFPPKPKDTLMISRTPEVTCVVVDV SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m19: (SEQIDNO:52) VDKRVESKYGPPCPPCPAPEFLSVFLFPPKPKDTLMISRTPEVTCVVVDV EQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m20: (SEQIDNO:53) VDKRVESKYGPPCPPCPAPEFLGSVFLFPPKPKDTLMISRTPEVTCVVVD VSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKS RWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m25: (SEQIDNO:54) VDKRVESKYGPPCPPCPAPEFLGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEEQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m27: (SEQIDNO:55) VDKRVESKYGPPCPPCPAPEFLGPSVFLFPPKPKDTLMISRTPEVTCVVV DVEQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m28: (SEQIDNO:56) VDKRVESKYGPPCPPCPAPEFLGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m29: (SEQIDNO:57) VDKRVESKYGPPCPPCPAPEFLGPSVFLFPPKPKDTLMISRTPEVTCVVV DVEQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKGFPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4m30: (SEQIDNO:58) VDKRVESKYGPPCPPCPAPEFLPSVFLFPPKPKDTLMISRTPEVTCVVVD VSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKS RWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK G4mPE: (SEQIDNO:59) VDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK

(35) The Fc variants described herein may exhibit an enhanced binding activity to Fc?RIIB as compared with the wild-type counterpart. Examples include G2m2, G2m5, G2m7, G2m8, G2m9, G1m7, G1m9, and G4m7. Alternatively or in addition, the Fc variants may have an enhanced selectivity to Fc?RIIB as compared with their wild-type counterparts, for example, G1m15, G1m17, G1m18, G1m19, G1m27, G1m28, G1m29, G4m1, G4m2, G4m7, G4m8, G4m9, G4m25, G4m27, and G4m28. These Fc variants can be used for constructing therapeutic agents described herein capable of cross-linking immune receptors and Fc?RIIB receptor.

(36) Alternatively, certain Fc variants as described herein may have low or no binding activity to any Fc?R. Examples include G1m2, G1m25, G4m5, G4m18, G4m19, and G4m20. Such Fc variants may retain the binding activity to FcRn. Therapeutic agents (e.g., antibodies) containing such Fc variants would have low or no activity to activate Fc? receptors and may have reduced toxicity relative to their wild-type counterparts.

(37) The changes of binding affinity/specificity of the exemplary Fc variants as compared with their wild-type counterparts are provided in Tables 2-4 below, where N/A indicates no data available. When the binding activity of an Fe variant is found to be no change as compared with the wild-type counterpart, it means that there is no significant variation of the binding activity between the Fe variant and the wild-type counterpart as indicated by the same assay under the same experimental conditions. When the binding activity of an Fe variant is increased or decreased as relative to its wild-type counterpart means that the binding activity of the Fc variant is higher or lower than that of the wild-type counterpart as determined by the same assay under the same experimental conditions and the variation is significant (e.g., biologically significant) as known to those skilled in the art. When the binding activity of an Fc variant is slightly increased or slightly decreased as relative to its wild-type counterpart means that the binding activity of the Fc variant is higher or lower than that of the wild-type counterpart as determined by the same assay under the same experimental conditions and the variation is statistically significant but to a limited level (e.g., up to 10%).

(38) TABLE-US-00013 TABLE 2 Fc?R Binding Activity of Human IgG1 Mutants As Relative to Wild-Type Human IgG1 IgG1 Changes of Binding Activity Relative to Wild-Type Counterparts Mutant Fc?RI Fc?RIIA(H131) Fc?RIIA(R131) Fc?RIIB Fc?RIIC Fc?RIII G1m1 Decreased Decreased Decreased Decreased Decreased Decreased G1m2 Decreased Decreased Decreased Decreased Decreased Decreased G1m-2 No change N/A N/A No change N/A No change G1m-4 No change N/A N/A No change N/A No change G1m5 Increased Increased Increased No change Increased Slightly decreased G1m7 Increased Increased Increased Increased Increased Slightly decreased G1m8 Increased Slightly No change Increased Slightly Slightly decreased increased decreased G1m9 Increased Decreased Increased Increased Increased No change G1m15 Decreased Decreased Decreased Decreased Decreased Decreased G1m17 Decreased Decreased Decreased Decreased Decreased Decreased G1m18 Decreased Decreased No change Decreased Decreased Decreased G1m19 Decreased Increased Increased Increased Increased Decreased G1m25 Decreased Decreased Decreased Decreased Decreased Decreased G1m27 Decreased Decreased Decreased Increased Decreased Decreased G1m28 Decreased Decreased Decreased Decreased Decreased Decreased G1m29 Decreased Decreased Increased Increased Increased Decreased G1mAA Decreased N/A Decreased Decreased Decreased Decreased G1mAG Decreased N/A Decreased Decreased Decreased Decreased

(39) TABLE-US-00014 TABLE 3 Fc?R Binding Activity of Human IgG2 Mutants As Relative to Wild-Type Human IgG2 IgG2 Change of Binding Activity Relative to Wild-Type Counterpart Mutant Fc?RI Fc?RIIA(H131) Fc?RIIA(R131) Fc?RIIB Fc?RIIC Fc?RIII G2m1 No change Decreased Decreased Decreased No change No change G2m2 Increased Decreased No change Increased No change No change G2m10 No change Decreased No change Slightly No change No change decreased G2m5 Slightly Decreased No change Decreased No change No change increased G2m7 No change Slightly Increased Increased Slightly No change increased increased G2m8 No change Decreased No change No change No change No change G2m9 No change No change Increased Increased Increased No change G2m-1 Increased N/A N/A Decreased N/A No change G2m-4 Increased N/A N/A Decreased N/A No change G2m15 No change N/A N/A Decreased N/A No change G2m17 No change N/A Increased No change Increased No change G2m18 Slightly N/A No change Decreased No change No change increased G2m19 No change N/A Increased Increased No change No change G2m20 No change N/A Increased Decreased No change No change G2m27 Slightly N/A N/A Increased N/A No change increased G2m28 No change N/A N/A Increased N/A No change

(40) TABLE-US-00015 TABLE 4 Fc?R Binding Activity of Human IgG4 Mutants As Relative to Wild-Type Human IgG4 IgG4 Change of Binding Activity Relative to Wild-Type Counterpart Mutant Fc?RI Fc?RIIA(H131) Fc?RIIA(R131) Fc?RIIB Fc?RIIC Fc?RIII G4m1 Decreased Increased No change Slightly Slightly No change decreased increased G4m2 Decreased No change Decreased Slightly No change No change decreased G4m10 Decreased No change Decreased Decreased No change No change G4m20 Decreased No change Decreased Decreased No change No change G4m3 Decreased No change No change Decreased No change No change G4m7 No change Increased Increased Increased Increased Slightly increased G4m8 No change No change Increased Slightly No change No change increased G4m9 No change No change Increased Increased Increased No change G4m17 Decreased No change Increased Increased Increased Increased G4m18 Decreased No change No change Decreased No change Increased G4m19 Decreased No change No change Decreased No change Slightly increased G4m25 Decreased No change Increased Slightly No change Increased decreased G4m27 Decreased No change No change Decreased No change Slightly increased G4m28 Decreased No change Slightly Increased Increased No change increased G4m29 Decreased No change Increased Increased Increased Slightly increased G4m4 Decreased No change No change Decreased No change No change G4m-1 No change N/A N/A No change N/A No change G4m-2 No change N/A N/A Decreased N/A No change G4mPE Decreased N/A N/A Slightly No change No change decreased G4m30 Decreased N/A No change Decreased No change No change

(41) An Fc variant as described herein can be designed following the guidance provided herein and produced via routine recombinant technology. Its binding affinity and specificity to various Fc receptors can be determined via routine methods. See also Examples below.

(42) II. Therapeutic Agents Capable of Cross-Linking Immune Receptors and Fc?RIIB

(43) Also provided herein are therapeutic agents that can cross-link immune receptors and Fc?RIIB receptor. Such therapeutic agents are expected to possess enhanced agonistic effects to activate immune cells such as T cells and NK cells in certain microenviroment such as cancer and tumor draining lymph nodes, so as to elicit or enhance immune responses against invading pathogens or diseases cells.

(44) (i) Binding Moieties

(45) The therapeutic agents described herein contain at least two binding moieties. One binding moiety is capable of binding to an immune cell receptor expressed on cell surface, for example, receptors of the TNF superfamily. Examples include Fas receptor/FAS, TWEAK receptor/TNFRSF12A, 4-1BB/TNFRSF9/CD137, TACI/TNFRSF13B, BAFF R/TNFRSF13C, CD27/TNFRSF7, CD30/TNFRSF8, CD40/TNFRSF5, DR3/TNFRSF25, DR4/TNFRSF10A, DR5/TNFRSF10B, DR6/TNFRSF21, GITR/TNFRSF18, HVEM/TNFRSF14, Lymphotoxin-beta receptor/LT?R, OX40/TNFRSF4, TROY/TNFRSF19, RELT/TNFRSF19L, TNFRSF12A, TACI/TNFRSF13B, TL1A/TNFSF15, TNFRSF17, TNFR1/TNFRSF1A, TNFRSF11B, RANK/TNFRSF11A, TR1/TNFRSF11B, NGFR, EDA2R and TNFRII/TNFRSF1B. In some instances, the binding moiety to the immune cell receptor is an antibody-binding fragment (e.g., a Fab fragment or a single-chain antibody fragment).

(46) The other binding moiety in the therapeutic agent is capable of binding to Fc?RIIB In some instances, this binding moiety has a selective binding activity to Fc?RIIB relative to another Fc receptor. Such a binding moiety can be any of the Fc variants described herein, which selectively or specifically binds Fc?RIIB

(47) In some embodiments, the therapeutic agent that cross-links an immune cell receptor and Fc?RIIB can be an antibody specific to the immune cell receptor and comprises an Fc fragment that has selective binding activity to Fc?RIIB, e.g., those described herein. For example, the therapeutic agent can be an antibody that binds any of the TNF superfamily members known in the art or listed here (e.g., CD137) and have a hIgG1, hIgG2, or hIgG4 Fc variant as described herein. In some examples, the antibody is an agonistic antibody.

(48) In some embodiments, the therapeutic agent is a bi-specific antibody comprising one antigen-binding moiety specific to the immune cell receptor as described herein and another antigen-binding moiety specific to an Fc? receptor such as Fc?RIIB

(49) (ii) Preparation of Therapeutic Agents

(50) Antibodies capable of binding to both an immune cell receptor such as a TNF superfamily member and Fc?RIIB as described herein can be made as follows. Antibodies binding to the immune cell receptor can be prepared by any method known in the art. See, for example, Harlow and Lane, (1998) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York.

(51) In some embodiments, antibodies specific to a target receptor (e.g., CD137) or an extracellular domain thereof can be made by the conventional hybridoma technology. The full-length target receptor or a fragment thereof, optionally coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that antigen. The route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein. General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein. It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines. Typically, the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.

(52) Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, D. W., et al., In Vitro, 18:377-381 (1982). Available myeloma lines, including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization. Generally, the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art. After the fusion, the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells. Any of the media described herein, supplemented with or without serum, can be used for culturing hybridomas that secrete monoclonal antibodies. As another alternative to the cell fusion technique, EBV immortalized B cells may be used to produce the anti-immune cell receptor monoclonal antibodies described herein. The hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).

(53) Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies capable of modulating the activity of the target immune cell receptor. Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures. The monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired. Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen. Immunization of a host animal with a target antigen or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride, SOCl, or R1N?C?NR, where R and R1 are different alkyl groups, can yield a population of antibodies (e.g., monoclonal antibodies).

(54) If desired, an antibody (monoclonal or polyclonal) of interest (e.g., produced by a hybridoma) may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use. In an alternative, the polynucleotide sequence may be used for genetic manipulation to humanize the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody. For example, the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically manipulate the antibody sequence to obtain greater affinity to the target antigen and greater efficacy in inhibiting or activating the activity of the immune cell receptor. It will be apparent to one of skill in the art that one or more polynucleotide changes can be made to the antibody and still maintain its binding specificity to the target receptor.

(55) In other embodiments, fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins. Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XENOMOUSE? from Amgen, Inc. (Fremont, Calif.) and HUMAB-MOUSE? and TC Mouse? from Medarex, Inc. (Princeton, N.J.). In another alternative, antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Winter et al., (1994) Annu. Rev. Immunol. 12:433-455.

(56) Alternatively, antibody library technology, such as the phage display technology (McCafferty et al., (1990) Nature 348:552-553), yeast display technology, or mammalian cell display technology, can be used to isolated antibodies such as human antibodies specific to a target immune receptor.

(57) Antigen-binding fragments of an intact antibody (full-length antibody) can be prepared via routine methods. For example, F(ab)2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab)2 fragments.

(58) Methods for constructing humanized antibodies are also well known in the art. See, e.g., Queen et al., Proc. Natl. Acad. Sci. USA, 86:10029-10033 (1989). In one example, variable regions of VH and VL of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art. Next, framework amino acid residues predicted to be important for the formation of the correct CDR structures are identified using the same molecular modeling analysis. In parallel, human VH and VL chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent VH and VL sequences as search queries. Human VH and VL acceptor genes are then selected.

(59) The CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof. When necessary, residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions (see above description) can be used to substitute for the corresponding residues in the human acceptor genes.

(60) Once an antibody capable of binding to a target immune cell receptor is obtained, its antigen-binding fragment can be conjugated to a suitable Fc fragment of a suitable IgG isoform, which can selectively binds FcgRIIB, for example, any of the Fc variants described herein via routine recombinant technology. In some instances, the antibody is first investigated for its agonistic effect to activate the immune cell receptor to which it binds. Such an agonistic antibody can be selected for making therapeutic agent described herein to enhance the agonistic effects.

(61) The resultant antibody molecules can be produced via routine recombinant technology as exemplified below. Nucleic acids encoding the heavy and light chain of an antibody as described herein can be cloned into one expression vector, each nucleotide sequence being in operable linkage to a suitable promoter. In one example, each of the nucleotide sequences encoding the heavy chain and light chain is in operable linkage to a distinct prompter. Alternatively, the nucleotide sequences encoding the heavy chain and the light chain can be in operable linkage with a single promoter, such that both heavy and light chains are expressed from the same promoter. When necessary, an internal ribosomal entry site (IRES) can be inserted between the heavy chain and light chain encoding sequences.

(62) In some examples, the nucleotide sequences encoding the two chains of the antibody are cloned into two vectors, which can be introduced into the same or different cells. When the two chains are expressed in different cells, each of them can be isolated from the host cells expressing such and the isolated heavy chains and light chains can be mixed and incubated under suitable conditions allowing for the formation of the antibody.

(63) Generally, a nucleic acid sequence encoding one or all chains of an antibody can be cloned into a suitable expression vector in operable linkage with a suitable promoter using methods known in the art. For example, the nucleotide sequence and vector can be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined together with a ligase. Alternatively, synthetic nucleic acid linkers can be ligated to the termini of a gene. These synthetic linkers contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/promoter would depend on the type of host cells for use in producing the antibodies.

(64) A variety of promoters can be used for expression of the antibodies described herein, including, but not limited to, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, E. coli lac UV5 promoter, and the herpes simplex tk virus promoter.

(65) Regulatable promoters can also be used. Such regulatable promoters include those using the lac repressor from E. coli as a transcription modulator to regulate transcription from lac operator-bearing mammalian cell promoters [Brown, M. et al., Cell, 49:603-612 (1987)], those using the tetracycline repressor (tetR) [Gossen, M., and Bujard, H., Proc. Natl. Acad. Sci. USA 89:5547-5551 (1992); Yao, F. et al., Human Gene Therapy, 9:1939-1950 (1998); Shockelt, P., et al., Proc. Natl. Acad. Sci. USA, 92:6522-6526 (1995)]. Other systems include FK506 dimer, VP16 or p65 using astradiol, RU486, diphenol murislerone, or rapamycin. Inducible systems are available from Invitrogen, Clontech and Ariad.

(66) Regulatable promoters that include a repressor with the operon can be used. In one embodiment, the lac repressor from E. coli can function as a transcriptional modulator to regulate transcription from lac operator-bearing mammalian cell promoters [M. Brown et al., Cell, 49:603-612 (1987)]; Gossen and Bujard (1992); [M. Gossen et al., Natl. Acad. Sci. USA, 89:5547-5551 (1992)] combined the tetracycline repressor (tetR) with the transcription activator (VP 16) to create a tetR-mammalian cell transcription activator fusion protein, tTa (tetR-VP 16), with the tetO-bearing minimal promoter derived from the human cytomegalovirus (hCMV) major immediate-early promoter to create a tetR-tet operator system to control gene expression in mammalian cells. In one embodiment, a tetracycline inducible switch is used. The tetracycline repressor (tetR) alone, rather than the tetR-mammalian cell transcription factor fusion derivatives can function as potent trans-modulator to regulate gene expression in mammalian cells when the tetracycline operator is properly positioned downstream for the TATA element of the CMVIE promoter (Yao et al., Human Gene Therapy). One particular advantage of this tetracycline inducible switch is that it does not require the use of a tetracycline repressor-mammalian cells transactivator or repressor fusion protein, which in some instances can be toxic to cells (Gossen et al., Natl. Acad. Sci. USA, 89:5547-5551 (1992); Shockett et al., Proc. Natl. Acad. Sci. USA, 92:6522-6526 (1995)), to achieve its regulatable effects.

(67) Additionally, the vector can contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA. Suitable vectors and methods for producing vectors containing transgenes are well known and available in the art.

(68) Examples of polyadenylation signals useful to practice the methods described herein include, but are not limited to, human collagen I polyadenylation signal, human collagen II polyadenylation signal, and SV40 polyadenylation signal.

(69) One or more vectors (e.g., expression vectors) comprising nucleic acids encoding any of the antibodies may be introduced into suitable host cells for producing the antibodies. The host cells can be cultured under suitable conditions for expression of the antibody or any polypeptide chain thereof. Such antibodies or polypeptide chains thereof can be recovered by the cultured cells (e.g., from the cells or the culture supernatant) via a conventional method, e.g., affinity purification. If necessary, polypeptide chains of the antibody can be incubated under suitable conditions for a suitable period of time allowing for production of the antibody.

(70) In some embodiments, methods for preparing an antibody described herein involve a recombinant expression vector that encodes both the heavy chain and the light chain of an antibody as described herein. The recombinant expression vector can be introduced into a suitable host cell (e.g., a dhfr-CHO cell) by a conventional method, e.g., calcium phosphate-mediated transfection. Positive transformant host cells can be selected and cultured under suitable conditions allowing for the expression of the two polypeptide chains that form the antibody, which can be recovered from the cells or from the culture medium. When necessary, the two chains recovered from the host cells can be incubated under suitable conditions allowing for the formation of the antibody.

(71) In one example, two recombinant expression vectors are provided, one encoding the heavy chain of the anti-immune cell receptor antibody and the other encoding the light chain of the same antibody. Both of the two recombinant expression vectors can be introduced into a suitable host cell (e.g., dhfr-CHO cell) by a conventional method, e.g., calcium phosphate-mediated transfection. Alternatively, each of the expression vectors can be introduced into a suitable host cells. Positive transformants can be selected and cultured under suitable conditions allowing for the expression of the polypeptide chains of the antibody. When the two expression vectors are introduced into the same host cells, the antibody produced therein can be recovered from the host cells or from the culture medium. If necessary, the polypeptide chains can be recovered from the host cells or from the culture medium and then incubated under suitable conditions allowing for formation of the antibody. When the two expression vectors are introduced into different host cells, each of them can be recovered from the corresponding host cells or from the corresponding culture media. The two polypeptide chains can then be incubated under suitable conditions for formation of the antibody.

(72) Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recovery of the antibodies from the culture medium. For example, some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.

(73) The bioactivity of the antibodies described herein can be verified using assays known in the art or described herein.

(74) (iii) Pharmaceutical Compositions

(75) The antibodies as described herein can be mixed with a pharmaceutically acceptable carrier (excipient) to form a pharmaceutical composition for use in treating a target disease. Acceptable means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art. See, e.g., Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.

(76) The pharmaceutical compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions. (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover). Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN? (polyoxyethylene sorbitan monolaurate), PLURONICS? (polyoxyethylene-polyoxypropylene-polyoxyethylene copolymer) or polyethylene glycol (PEG).

(77) In some examples, the pharmaceutical composition described herein comprises liposomes containing the antibodies (or the encoding nucleic acids) which can be prepared by methods known in the art, such as described in Epstein, et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556. Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.

(78) The antibodies, or the encoding nucleic acid(s), may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are known in the art, see, e.g., Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).

(79) In other examples, the pharmaceutical composition described herein can be formulated in sustained-release format. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT? (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(?)-3-hydroxybutyric acid.

(80) The pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.

(81) The pharmaceutical compositions described herein can be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.

(82) For preparing solid compositions such as tablets, the principal active ingredient can be mixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 to about 500 mg of the active ingredient of the present invention. The tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.

(83) Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g., TWEEN? (polyoxyethylene sorbitan monolaurate) 20, 40, 60, 80 or 85) and other sorbitans (e.g., SPAN? (sorbitan monolaurate) 20, 40, 60, 80 or 85). Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.

(84) Suitable emulsions may be prepared using commercially available fat emulsions, such as INTRALIPID? (10% intravenous fat emulsion), LIPOSYN? (intravenous fat emulsion), INFONUTROL? (intravenous fat emulsion), LIPOFUNDIN? (20% fat emulsion for infusion) and LIPIPHYSAN? (intravenous lipid emulsion). The active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g. egg phospholipids, soybean phospholipids or soybean lecithin) and water. It will be appreciated that other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emulsion. Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%. The fat emulsion can comprise fat droplets between 0.1 and 1.0 ?m, particularly 0.1 and 0.5 ?m, and have a pH in the range of 5.5 to 8.0.

(85) The emulsion compositions can be those prepared by mixing an antibody with INTRALIPID? (10% intravenous fat emulsion) or the components thereof (soybean oil, egg phospholipids, glycerol and water).

(86) Pharmaceutical compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above. In some embodiments, the compositions are administered by the oral or nasal respiratory route for local or systemic effect.

(87) Compositions in preferably sterile pharmaceutically acceptable solvents may be nebulized by use of gases. Nebulized solutions may be breathed directly from the nebulizing device or the nebulizing device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.

(88) III. Therapeutic Applications

(89) Any of the therapeutic agents (e.g., antibodies) capable of cross-linking an immune cell receptor and Fc?RIIB described herein are useful for enhancing immune responses against invading pathogens and/or diseased cells such as cancer cells.

(90) To practice the method disclosed herein, an effective amount of the pharmaceutical composition described herein can be administered to a subject (e.g., a human) in need of the treatment via a suitable route, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes. Commercially available nebulizers for liquid formulations, including jet nebulizers and ultrasonic nebulizers are useful for administration. Liquid formulations can be directly nebulized and lyophilized powder can be nebulized after reconstitution. Alternatively, the antibodies as described herein can be aerosolized using a fluorocarbon formulation and a metered dose inhaler, or inhaled as a lyophilized and milled powder.

(91) The subject to be treated by the methods described herein can be a mammal, more preferably a human. Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats. In some instances, the subject is a human patient having or at risk for a cell-mediated disease or disorder, such as cancer including but not limited to lung cancer, stomach cancer, liver cancer, breast cancer, skin cancer, pancreatic cancer, brain cancer, prostate cancer, bladder cancer, or colorectal cancer.

(92) As used herein, an effective amount refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. In some embodiments, the therapeutic effect is modulating (e.g., activating) the target immune receptor, thereby triggering or enhancing immune responses mediated by the receptor. Determination of whether an amount of the antibody achieved the therapeutic effect would be evident to one of skill in the art. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment.

(93) Empirical considerations, such as the half-life, generally will contribute to the determination of the dosage. For example, antibodies that are compatible with the human immune system, such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system. Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a target disease/disorder. Alternatively, sustained continuous release formulations of an antibody may be appropriate. Various formulations and devices for achieving sustained release are known in the art.

(94) In one example, dosages for an antibody as described herein may be determined empirically in individuals who have been given one or more administration(s) of the antibody. Individuals are given incremental dosages of the antagonist. To assess efficacy of the antagonist, an indicator of the disease/disorder can be followed.

(95) Generally, for administration of any of the therapeutic agents such as antibodies described herein, an initial candidate dosage can be about 2 mg/kg. For the purpose of the present disclosure, a typical daily dosage might range from about any of 0.1 mg/kg to 3 mg/kg to 30 mg/kg to 300 mg/kg to 3 mg/kg, to 30 mg/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate a target disease or disorder, or a symptom thereof. An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the antibody, or followed by a maintenance dose of about 1 mg/kg every other week. However, other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one-four times a week is contemplated. In some embodiments, dosing ranging from about 3 ?g/mg to about 2 mg/kg (such as about 3 ?g/mg, about 10 ?g/mg, about 30 ?g/mg, about 100 ?g/mg, about 300 ?g/mg, about 1 mg/kg, and about 2 mg/kg) may be used. In some embodiments, dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer. The progress of this therapy is easily monitored by conventional techniques and assays. The dosing regimen (including the antibody used) can vary over time.

(96) In some embodiments, for an adult patient of normal weight, doses ranging from about 0.3 to 5.00 mg/kg may be administered. In some examples, the dosage of the therapeutic agents such as antibodies described herein can be 10 mg/kg. The particular dosage regimen, i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history, as well as the properties of the individual agents (such as the half-life of the agent, and other considerations well known in the art).

(97) For the purpose of the present disclosure, the appropriate dosage of an antibody as described herein will depend on the specific antibody, antibodies, and/or non-antibody peptide (or compositions thereof) employed, the type and severity of the disease/disorder, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antagonist, and the discretion of the attending physician. Typically the clinician will administer an antibody, until a dosage is reached that achieves the desired result. In some embodiments, the desired result is a decrease in thrombosis. Methods of determining whether a dosage resulted in the desired result would be evident to one of skill in the art. Administration of one or more antibodies can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners. The administration of an antibody may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing a target disease or disorder.

(98) As used herein, the term treating refers to the application or administration of a composition including one or more active agents to a subject, who has a target disease or disorder, a symptom of the disease/disorder, or a predisposition toward the disease/disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder.

(99) Alleviating a target disease/disorder includes delaying the development or progression of the disease, or reducing disease severity. Alleviating the disease does not necessarily require curative results. As used therein, delaying the development of a target disease or disorder means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated. A method that delays or alleviates the development of a disease, or delays the onset of the disease, is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.

(100) Development or progression of a disease means initial manifestations and/or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. Development includes occurrence, recurrence, and onset. As used herein onset or occurrence of a target disease or disorder includes initial onset and/or recurrence.

(101) In some embodiments, the antibodies described herein are administered to a subject in need of the treatment at an amount sufficient to activate the activity of the target receptor by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo.

(102) Conventional methods, known to those of ordinary skill in the art of medicine, can be used to administer the pharmaceutical composition to the subject, depending upon the type of disease to be treated or the site of the disease. This composition can also be administered via other conventional routes, e.g., administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, and intracranial injection or infusion techniques. In addition, it can be administered to the subject via injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods. In some examples, the pharmaceutical composition is administered intraocularly or intravitreally.

(103) Injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like). For intravenous injection, water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipient is infused. Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients. Intramuscular preparations, e.g., a sterile formulation of a suitable soluble salt form of the antibody, can be dissolved and administered in a pharmaceutical excipient such as Water-for-Injection, 0.9% saline, or 5% glucose solution.

(104) The particular dosage regimen, i.e., dose, timing and repetition, used in the method described herein will depend on the particular subject and that subject's medical history.

(105) In some embodiments, more than one antibody, or a combination of an antibody and another suitable therapeutic agent, may be administered to a subject in need of the treatment. The antibody can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.

(106) Treatment efficacy for a target disease/disorder can be assessed by methods well-known in the art.

(107) The therapeutic agent described herein may be utilized in conjunction with other types of therapy for the target disease such as cancer. Additional anti-cancer therapy includes chemotherapy, surgery, radiation, gene therapy, and so forth. When a second therapeutic agent is used, such an agent can be administered simultaneously or sequentially (in any order) with the therapeutic agent described herein that cross-links an immune cell receptor and Fc?RIIB.

(108) When co-administered with an additional therapeutic agent, suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.

(109) The treatments of the disclosure can be combined with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, DC-based vaccines, etc.), or checkpoint inhibitors (including but not limited to agents that block CTLA4, PD1, LAGS, TIM3, etc.). Alternatively, the treatment of the present disclosure can be combined with a chemotherapeutic agent, for example, pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine), purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracyclines, bleomycin, busulfan, camptothecin, carboplatin, chlorambucil, cisplatin, cyclophosphamide, cytoxan, dactinomycin, daunorubicin, doxorubicin, epirubicin, hexamethyhnelamineoxaliplatin, iphosphamide, melphalan, merchlorehtamine, mitomycin, mitoxantrone, nitrosourea, plicamycin, procarbazine, taxol, taxotere, teniposide, triethylenethiophosphoramide and etoposide (VP16)); antibiotics such as dactinomycin (actinomycin D), daunorubicin, doxorubicin (adriamycin), idarubicin, anthracyclines, mitoxantrone, bleomycins, plicamycin (mithramycin) and mitomycin; enzymes (L-asparaginase which systemically metabolizes L-asparagine and deprives cells which do not have the capacity to synthesize their own asparagine); antiplatelet agents; antiproliferative/antimitotic alkylating agents such as nitrogen mustards (mechlorethamine, cyclophosphamide and analogs, melphalan, chlorambucil), ethylenimines and methylmelamines (hexamethylmelamine and thiotepa), alkyl sulfonates-busulfan, nitrosoureas (carmustine (BCNU) and analogs, streptozocin), trazenes-dacarbazinine (DTIC); antiproliferative/antimitotic antimetabolites such as folic acid analogs (methotrexate); platinum coordination complexes (cisplatin, carboplatin), procarbazine, hydroxyurea, mitotane, aminoglutethimide; hormones, hormone analogs (estrogen, tamoxifen, goserelin, bicalutamide, nilutamide) and aromatase inhibitors (letrozole, anastrozole); anticoagulants (heparin, synthetic heparin salts and other inhibitors of thrombin); fibrinolytic agents (such as tissue plasminogen activator, streptokinase and urokinase), aspirin, dipyridamole, ticlopidine, clopidogrel, abciximab; antimigratory agents; antisecretory agents (breveldin); immunosuppressives (cyclosporine, tacrolimus (FK-506), sirolimus (rapamycin), azathioprine, mycophenolate mofetil); anti-angiogenic compounds (e.g., TNP-470, genistein, bevacizumab) and growth factor inhibitors (e.g., fibroblast growth factor (FGF) inhibitors); angiotensin receptor blocker; nitric oxide donors; anti-sense oligonucleotides; antibodies (trastuzumab); cell cycle inhibitors and differentiation inducers (tretinoin); mTOR inhibitors, topoisomerase inhibitors (doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disruptors.

(110) For examples of additional useful agents see also Physician's Desk Reference, 59.sup.th edition, (2005), Thomson P D R, Montvale N.J.; Gennaro et al., Eds. Remington's The Science and Practice of Pharmacy 20.sup.th edition, (2000), Lippincott Williams and Wilkins, Baltimore Md.; Braunwald et al., Eds. Harrison's Principles of Internal Medicine, 15.sup.th edition, (2001), McGraw Hill, NY; Berkow et al., Eds. The Merck Manual of Diagnosis and Therapy, (1992), Merck Research Laboratories, Rahway N.J.

(111) IV. Kits

(112) The present disclosure also provides kits for use in enhancing the desired immune responses using any of the therapeutic agents described herein, for example, anti-TNF antibodies containing an Fc variant described herein that selectively binds Fc?RIIB

(113) In some embodiments, the kit can comprise instructions for use in accordance with any of the methods described herein. The included instructions can comprise a description of administration of the therapeutic agent to treat, delay the onset, or alleviate a target disease as those described herein. The kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has the target disease. In still other embodiments, the instructions comprise a description of administering a therapeutic agent such as an antibody to an individual at risk of the target disease.

(114) The instructions relating to the use of the therapeutic agent generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.

(115) The label or package insert indicates that the composition is used for treating, delaying the onset and/or alleviating a target disease or disorder such as cancer. Instructions may be provided for practicing any of the methods described herein.

(116) The kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump. A kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is the therapeutic agent as those described herein.

(117) Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiments, the invention provides articles of manufacture comprising contents of the kits described above.

(118) General Techniques

(119) The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are within the skill of the art. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press; Oligonucleotide Synthesis (M. J. Gait, ed., 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1998) Academic Press; Animal Cell Culture (R. I. Freshney, ed., 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds., 1993-8) J. Wiley and Sons; Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M. Weir and C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller and M. P. Calos, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel, et al., eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis, et al., eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: a practical approach (D. Catty., ed., IRL Press, 1988-1989); Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J. D. Capra, eds., Harwood Academic Publishers, 1995).

(120) Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference for the purposes or subject matter referenced herein.

Example 1. Engineering Human IgG1, IgG2 and IgG4 for Selective Fc?R2B/CD32B Binding

(121) To verify the impact of mutations in the hinge domain of human IgG1, IgG2, and IgG4 on binding activity to Fc?R2b/CD32B, the human Fc variants G1m1, G1m2, G2m1, G2m2, G2m10, G4m1, G4m2, G4m10, and G4m20 disclosed herein were linked to the VH fragment of an anti-CD137 antibody and the corresponding IgG1, G2, and G4 CH1 fragments to produce a full-length IgG heavy chain. These mutant IgG heavy chains were cloned, co-expressed with the light chain of the anti-CD137 antibody, and purified using standard molecular biology and antibody protocols. The amino acid sequences of the VH-CH1 fragment (VH domain italicized) and the light chain are provided below:

(122) TABLE-US-00016 VH-CH1(IgG1): (SEQIDNO:60) EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGK IYPGDSYTNYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGY GIFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTK VH-CH1(IgG2): (SEQIDNO:61) EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGK IYPGDSYTNYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGY GIFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCN VDHKPSNTK VH-CH1(IgG4): (SEQIDNO:62) EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGK IYPGDSYTNYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGY GIFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN VDHKPSNTK LightChain: (SEQIDNO:63) SYELTQPPSVSVSPGQTASITCSGDNIGDQYAHWYQQKPGQSPVLVIYQD KNRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCATYTGFGSLAVFG GGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE GSTVEKTVAPTECS

(123) These IgG mutants were tested for binding to a panel of human Fc receptors (FcRs), including FcRn, using the Octet Red96 System (ForteBio, Model #Red96). Human FcR proteins were purchased commercially (FcRn, MednaBio, E1032; FcRI, MednaBio, E1031; FcRIIA, MednaBio, E1033; FcRIIB/C, MednaBio, E1034; FcRIIIA-F158, MednaBio, E1036; FcRIIIA-V158, MednaBio, E1035; FcRIIIB, MednaBio, E1037). All Fey receptor assays were performed at pH 7.2; all FcRn assays were performed at pH 6. The Fey receptors were loaded onto anti-penta-HIS1K (ForteBio, Cat #18-5122) biosensors at a concentration of 20 ?g/mL. The loaded biosensors was then be dipped into an 8-point 1:3 dilution series of the test IgG molecules (including controls and the mutants described herein) in PBS with 0.1% BSA, 0.02% Tween-20 (pH 7.2) at a starting concentration of 300 nM. Kinetic analysis was performed using a 1:1 binding model and global fitting. The results are shown in Tables 5 and 6 below.

(124) TABLE-US-00017 TABLE 5 FcgR Binding Activity of IgG1 and IgG2 Mutants to Various Fc Receptors IgG1 IgG2 IgG4 G1m1 G1m2 G2m1 G2m2 G2m10 Fc?RI KD (M) 5.6E?9 No 4.8E?09 2.0E?07 No No 2.0E?09 No kon(1/Ms) 2.2E+05 No 3.6E+05 6.5E+05 No No 4.4E+05 No kdis(1/s) 1.2E?03 No 1.7E?03 1.3E?01 No No 9.1E?04 No Fc?RIIA KD (M) 5.6E?08 8.9E?08 4.0E?07 4.4E?07 No No 6.8E?08 1.70E?05 kon(1/Ms) 5.7E+05 4.4E+05 1.4E+05 2.5E+05 No No 8.4E+05 2.10E+04 kdis(1/s) 3.2E?02 3.9E?02 5.5E?02 1.1E?01 No No 5.7E?02 3.50E?01 Fc?RIIB KD (M) 1.3E?07 No 4.0E?07 No No No 1.6E?07 No kon(1/Ms) 1.2E+05 No 1.4E+05 No No No 6.2E+05 No kdis(1/s) 1.6E?02 No 5.0E?02 No No No 9.9E?02 No Fc?RIIIA(F) KD (M) 1.2E?07 No No 3.0E?07 No No 2.5E?07 No kon(1/Ms) 1.7E+05 No No 3.5E+05 No No 2.8E+05 No kdis(1/s) 2.0E?02 No No 1.0E?01 No No 7.0E?02 No Fc?RIIIA(V) KD (M) 6.0E?08 No 5.5E?07 No No No 1.6E?07 No kon(1/Ms) 4.5E+05 No 1.7E+05 No No No 2.1E+05 No kdis(1/s) 2.7E?02 No 9.2E?02 No No No 3.3E?02 No Fc?RIIIB KD (M) 1.3E?07 No No No No Low No No kon(1/Ms) 2.1E+05 No No No No Low No No kdis(1/s) 2.7E?02 No No No No Low No No FcRn KD (M) 1.6E?08 1.0E?08 1.8E?08 1.1E?08 1.3E?08 5.5E?09 1.0E?08 2.10E?08 kon(1/Ms) 4.8E+05 9.9E+05 6.4E+05 7.0E+05 7.1E+05 1.7E+05 9.0E+05 4.20E+05 kdis(1/s) 8.0E?03 9.9E?03 1.2E?02 7.8E?03 9.3E?03 9.6E?04 9.1E?03 8.80E?03

(125) TABLE-US-00018 TABLE 6 Fc?R Binding Activity of IgG4 Mutants IgG1 IgG2 IgG4 G4m1 G4m2 G4m10 G4m20 Fc?RI KD (M) 5.6E?9 No 4.8E?09 1.3E?07 No No No kon(1/Ms) 2.2E+05 No 3.6E+05 7.4E+05 No No No kdis(1/s) 1.2E?03 No 1.7E?03 9.7E?02 No No No Fc?RIIA KD (M) 5.6E?08 8.9E?08 4.0E?07 4.5E?07 No 8.30E?08 No kon(1/Ms) 5.7E+05 4.4E+05 1.4E+05 2.4E+05 No 4.50E+05 No kdis(1/s) 3.2E?02 3.9E?02 5.5E?02 1.1E?01 No 3.70E?02 No Fc?RIIB KD (M) 1.3E?07 No 4.0E?07 2.5E?07 1.5E?07 No No kon(1/Ms) 1.2E+05 No 1.4E+05 4.2E+05 3.1E+05 No No kdis(1/s) 1.6E?02 No 5.0E?02 1.1E?01 4.6E?02 No No Fc?RIIIA(F) KD (M) 1.2E?07 No No No No No No kon(1/Ms) 1.7E+05 No No No No No No kdis(1/s) 2.0E?02 No No No No No No FcgRIIIA(V) KD (M) 6.0E?08 No 5.5E?07 No No No No kon(1/Ms) 4.5E+05 No 1.7E+05 No No No No kdis(1/s) 2.7E?02 No 9.2E?02 No No No No FcgRIIIB KD (M) 1.3E?07 No No No No No No kon(1/Ms) 2.1E+05 No No No No No No kdis(1/s) 2.7E?02 No No No No No No FcRn KD (M) 1.6E?08 1.0E?08 1.8E?08 1.9E?08 9.8E?09 1.10E?08 1.9E?08 kon(1/Ms) 4.8E+05 9.9E+05 6.4E+05 6.9E+05 1.4E+06 5.10E+05 5.1E+05 kdis(1/s) 8.0E?03 9.9E?03 1.2E?02 1.3E?02 1.3E?02 5.50E?03 9.8E?03

(126) Certain IgG mutants tested in this study, for example, G4m2, showed selective binding activity to Fc?RIIB (CD32B), and also maintained binding activity to FcRn, which is important for the half-life of the IgG molecule in vivo. Others, such as G1m2, G2m1 or G4m20 lost binding to all Fc?Rs.

Example 2. Additional IgG1, IgG2, and IgG4 Mutants and Binding Activities to Various Fc Receptors

(127) The human Fc variants G1m5, G1m7, G1m8, G1m9, G2m5, G2m7, G2m8, G2m9, G4m5, G4m7, G4m8, and G4m9 disclosed herein were linked to the VH fragment of an anti-CD137 antibody and the corresponding IgG1, G2, and G4 CH1 fragments to produce a full-length IgG heavy chain. See Example 1 above. These mutant IgG heavy chains were cloned, co-expressed with the light chain of the anti-CD137 antibody (see Example 1 above), and purified using standard molecular biology and antibody protocols. The results are shown in Tables 7-9 below.

(128) TABLE-US-00019 TABLE 7 FcR Binding Activity of IgG1 Mutants IgG1 IgG2 IgG4 G1m5 G1m7 G1m8 G1m9 G1mAA Fc?RI KD (M) 5.6E?9 No 4.8E?09 1.6E?09 2.5E?09 2.5E?09 3.1E?09 2.35E?07 kon(1/Ms) 2.2E+05 No 3.6E+05 3.0E+05 6.3E+05 6.3E+05 5.1E+05 1.44E+05 kdis(1/s) 1.2E?03 No 1.7E?03 4.7E?04 1.6E?03 1.6E?03 1.6E?03 3.37E?02 Fc?RIIA KD (M) 5.6E?08 8.9E?08 4.0E?07 6.7E?07 2.9E?07 2.7E?07 6.8E?07 8.00E?07 kon(1/Ms) 5.7E+05 4.4E+05 1.4E+05 3.4E+05 3.8E+05 6.1E+05 1.8E+05 3.10E+05 kdis(1/s) 3.2E?02 3.9E?02 5.5E?02 2.3E?01 1.1E?01 1.7E?01 1.3E?01 2.47E?01 Fc?RIIB KD (M) 1.3E?07 No 4.0E?07 6.4E?07 1.1E?07 4.2E?07 2.5E?08 6.56E?07 kon(1/Ms) 1.2E+05 No 1.4E+05 2.8E+05 2.8E+05 2.7E+05 2.0E+05 2.38E+05 kdis(1/s) 1.6E?02 No 5.0E?02 1.8E?01 3.2E?02 1.1E?01 5.1E?03 1.56E?01 Fc?RIIIA(F) KD (M) 1.2E?07 No No No 1.4E?07 2.6E?07 1.8E?07 1.50E?06 kon(1/Ms) 1.7E+05 No No No 3.5E+05 2.2E+05 5.2E+05 1.16E+05 kdis(1/s) 2.0E?02 No No No 5.0E?02 5.7E?02 9.1E?02 1.75E?01 Fc?RIIIA(V) KD (M) 6.0E?08 No 5.5E?07 2.9E?07 8.7E?08 2.3E?07 8.6E?08 4.56E?07 kon(1/Ms) 4.5E+05 No 1.7E+05 2.5E+05 4.4E+05 3.2E+05 1.2E+06 9.23E+04 kdis(1/s) 2.7E?02 No 9.2E?02 7.3E?02 3.9E?02 7.4E?02 1.0E?01 4.20E?02 Fc?RIIIB KD (M) 1.3E?07 No No No No No No 5.56E?07 kon(1/Ms) 2.1E+05 No No No No No No 2.58E+05 kdis(1/s) 2.7E?02 No No No No No No 1.44E?01 FcRn KD (M) 1.6E?08 1.0E?08 1.8E?08 2.2E?08 1.5E?08 1.65E?08 1.91E?08 1.88E?08 kon(1/Ms) 4.8E+05 9.9E+05 6.4E+05 3.5E+05 6.7E+05 6.73E+05 6.07E+05 8.03E+05 kdis(1/s) 8.0E?03 9.9E?03 1.2E?02 7.7E?03 1.0E?02 1.11E?02 1.16E?02 1.50E?02

(129) TABLE-US-00020 TABLE 8 FcR Binding Activity of IgG2 Mutants IgG1 IgG2 IgG4 G2m5 G2m7 G2m8 G2m9 Fc?RI KD (M) 5.6E?9 No 4.8E?09 No No No No kon(1/Ms) 2.2E+05 No 3.6E+05 No No No No kdis(1/s) 1.2E?03 No 1.7E?03 No No No No Fc?RIIA KD (M) 5.6E?08 8.9E?08 4.0E?07 2.30E?07 1.20E?07 9.30E?08 2.80E?07 kon(1/Ms) 5.7E+05 4.4E+05 1.4E+05 6.00E+05 2.30E+05 9.90E+05 1.10E+05 kdis(1/s) 3.2E?02 3.9E?02 5.5E?02 1.40E?01 2.80E?02 9.20E?02 3.00E?02 Fc?RIIB KD (M) 1.3E?07 No 4.0E?07 3.10E?07 1.70E?07 5.00E?07 5.20E?08 kon(1/Ms) 1.2E+05 No 1.4E+05 3.90E+05 3.10E+05 5.10E+05 9.70E+04 kdis(1/s) 1.6E?02 No 5.0E?02 1.20E?01 5.20E?02 2.60E?01 5.00E?03 Fc?RIIIA(F) KD (M) 1.2E?07 No No No No No No kon(1/Ms) 1.7E+05 No No No No No No kdis(1/s) 2.0E?02 No No No No No No Fc?RIIIA(V) KD (M) 6.0E?08 No 5.5E?07 No No No No kon(1/Ms) 4.5E+05 No 1.7E+05 No No No No kdis(1/s) 2.7E?02 No 9.2E?02 No No No No Fc?RIIIB KD (M) 1.3E?07 No No No No No No kon(1/Ms) 2.1E+05 No No No No No No kdis(1/s) 2.7E?02 No No No No No No FcRn KD (M) 1.6E?08 1.0E?08 1.8E?08 1.40E?08 5.70E?09 6.30E?09 2.20E?08 kon(1/Ms) 4.8E+05 9.9E+05 6.4E+05 8.00E+05 9.10E+05 8.50E+05 2.70E+05 kdis(1/s) 8.0E?03 9.9E?03 1.2E?02 1.10E?02 5.20E?03 5.30E?03 5.80E?03

(130) TABLE-US-00021 TABLE 9 FcR Binding Activity of IgG4 Mutants IgG1 IgG2 IgG4 G4m5 G4m7 G4m8 G4m9 G4m30 G4PE Fc?RI KD (M) 5.6E?9 No 4.8E?09 N.D. 2.10E?09 3.80E?09 1.70E?08 5.28E?07 6.05E?07 kon(1/Ms) 2.2E+05 No 3.6E+05 N.D. 5.40E+05 7.20E+05 4.40E+05 3.65E+05 1.02E+05 kdis(1/s) 1.2E?03 No 1.7E?03 N.D. 1.10E?03 2.80E?03 7.40E?03 1.93E?01 6.17E?02 Fc?RIIA KD (M) 5.6E?08 8.9E?08 4.0E?07 N.D. 2.10E?07 2.60E?07 No 9.77E?07 5.45E?08 kon(1/Ms) 5.7E+05 4.4E+05 1.4E+05 N.D. 1.60E+05 3.90E+05 No 2.40E+05 4.69E+05 kdis(1/s) 3.2E?02 3.9E?02 5.5E?02 N.D. 3.40E?02 1.00E?01 No 2.34E?01 2.56E?02 Fc?RIIB KD (M) 1.3E?07 No 4.0E?07 N.D. 4.50E?08 8.90E?08 1.40E?07 2.22E?06 3.07E?08 kon(1/Ms) 1.2E+05 No 1.4E+05 N.D. 4.40E+05 5.30E+05 9.40E+04 5.36E+04 4.01E+05 kdis(1/s) 1.6E?02 No 5.0E?02 N.D. 2.00E?02 4.80E?02 1.30E?02 1.18E?01 1.23E?02 Fc?RIIIA (F) KD (M) 1.2E?07 No No N.D. No No No 2.84E?07 1.45E?07 kon(1/Ms) 1.7E+05 No No N.D. No No No 1.06E+06 4.68E+05 kdis(1/s) 2.0E?02 No No N.D. No No No 3.03E?01 6.78E?02 Fc?RIIIA (V) KD (M) 6.0E?08 No 5.5E?07 N.D. No No No 2.17E?07 2.02E?07 kon(1/Ms) 4.5E+05 No 1.7E+05 N.D. No No No 1.42E+06 2.96E+05 kdis(1/s) 2.7E?02 No 9.2E?02 N.D. No No No 3.09E?01 5.96E?02 Fc?RIIIB KD (M) 1.3E?07 No No N.D. No No No 2.16E?07 1.32E?07 kon(1/Ms) 2.1E+05 No No N.D. No No No 1.37E+06 4.37E+05 kdis(1/s) 2.7E?02 No No N.D. No No No 2.97E?01 5.79E?02 FcRn KD (M) 1.6E?08 1.0E?08 1.8E?08 N.D. 2.30E?08 2.00E?08 7.50E?08 7.61E?09 2.19E?08 kon(1/Ms) 4.8E+05 9.9E+05 6.4E+05 N.D. 5.20E+05 6.10E+05 2.30E+05 1.75E+06 6.98E+05 kdis(1/s) 8.0E?03 9.9E?03 1.2E?02 N.D. 1.20E?02 1.20E?02 1.70E?02 1.33E?02 1.52E?02

Example 3. Exemplary IgG Mutants Having Combined Mutations to Enhance Selective Binding to Fc?RIIB (CD32B)

(131) The human Fc variants G1m15, G1m17, G1m18, G1m19, G2m25, G2m27, G2m28, G4m15, G4m17, G4m18, and G4m19, G4m25, G4m27, G4m28, and G4m29 disclosed herein were linked to the VH fragment of an anti-CD137 antibody and the corresponding IgG1, G2, and G4 CH1 fragments to produce a full-length IgG heavy chain. See Example 1 above. These Fc variants contain a combination of one or mutations in the hinge domain and one or more mutations in the CH2 and/or CH3 domains. These mutant IgG heavy chains were cloned, co-expressed with the light chain of the anti-CD137 antibody (see Example 1 above), and purified using standard molecular biology and antibody protocols. The results are shown in Tables 10-12 below.

Example 4. Determination of Human IgG Mutants Binding Activity to Cellular Fc?R

(132) To determine the binding activity of human IgG mutants to cellular Fe receptors, CHO cells were genetically engineered to express human Fc?Rs (Fc?RI, Fc?RIIA (H131), Fc?RIIA (R131), Fc?RIIB, Fc?RIIC, and Fc?RIII) using a lentivirus delivery system as known in the art.

(133) IgG Fe mutants, including G1m-2, G1m-4, G1mAA, G1mAG, G2m-1 G2m-4, G2m15, G2m17, G2m17, G2m18, G2m19, G2m20, G2m27, G2m28, G4m-1, G4m-2, G430, and G4PE (amino acid sequences provided above) were designed and constructed following the disclosures herein. These IgG mutants contain mutations in either the upper hinge domain or the lower hinge domain as indicated.

(134) For FACS analysis of the IgG mutants' binding to different Fc?Rs, Fc?R overexpressing CHO cells were harvested using trypsin-EDTA and were suspended in cold staining buffer (3% BSA in PBS). Test IgG mutants, which were diluted in staining buffer, were added into the cells. The mixture was incubated 4? C. for 2 hours, and then washed twice with cold staining buffer and re-suspended in PE-labeled anti-human IgG followed by incubation at 4? C. for 2 hours. The mixture was washed twice with staining buffer and resuspended in 2% PFA in PBS for FACS.

(135) TABLE-US-00022 TABLE 10 FcR Binding Activity of Human IgG1 Mutants IgG1 G1m15 G1m17 G1m18 G1m19 G1m25 G1m27 G1m28 G1m29 Fc?RI KD (M) 5.6E?9 1.2E?07 8.8E?08 2.6E?07 1.2E?07 No No 2.4E?07 3.7E?08 kon(1/Ms) 2.2E+05 5.0E+05 4.6E+05 8.3E+05 7.1E+05 No No 6.4E+05 2.6E+05 kdis(1/s) 1.2E?03 6.0E?02 4.1E?02 2.1E?01 8.6E?02 No No 1.6E?01 9.8E?03 Fc?RIIA KD (M) 5.6E?08 4.8E?07 2.5E?07 1.4E?07 8.1E?08 No No No 5.3E?07 kon(1/Ms) 5.7E+05 2.3E+05 2.4E+05 2.0E+05 2.4E+05 No No No 2.6E+05 kdis(1/s) 3.2E?02 1.1E?01 5.9E?02 2.9E?02 1.9E?02 No No No 1.4E?01 Fc?RIIB KD (M) 1.3E?07 7.0E?07 1.8E?07 6.7E?07 1.1E?07 No 4.1E?07 4.1E?07 4.6E?08 kon(1/Ms) 1.2E+05 5.4E+05 2.4E+05 5.8E+05 2.6E+05 No 2.6E+05 4.8E+05 2.5E+05 kdis(1/s) 1.6E?02 3.8E?01 4.3E?02 3.9E?01 2.8E?02 No 1.0E?01 2.0E?01 1.1E?02 Fc?RIIIA (F) KD (M) 1.2E?07 No No No No No No No No kon(1/Ms) 1.7E+05 No No No No No No No No kdis(1/s) 2.0E?02 No No No No No No No No Fc?RIIIA (V) KD (M) 6.0E?08 No No No No No No No No kon(1/Ms) 4.5E+05 No No No No No No No No kdis(1/s) 2.7E?02 No No No No No No No No FcgRIIIB KD (M) 1.3E?07 No No No No No No No No kon(1/Ms) 2.1E+05 No No No No No No No No kdis(1/s) 2.7E?02 No No No No No No No No FcRn KD (M) 1.6E?08 2.1E?08 1.07E?08 1.28E?08 1.34E?08 1.5E?08 1.6E?08 1.7E?08 1.7E?08 kon(1/Ms) 4.8E+05 6.0E+05 7.15E+05 6.30E+05 7.70E+05 6.2E+05 6.5E+05 6.5E+05 7.6E+05 kdis(1/s) 8.0E?03 1.3E?02 7.64E?03 8.03E?03 1.03E?02 9.3E?03 1.0E?02 1.1E?02 1.3E?02

(136) TABLE-US-00023 TABLE 11 FcR Binding Activity of Human IgG2 Mutants IgG2 G2m17 G2m19 G2m20 G2m28 Fc?RI KD (M) No 2.53E?07 No No 6.61E?08 kon(1/Ms) No 1.09E+06 No No 1.49E+06 kdis(1/s) No 2.77E?01 No No 9.80E?02 Fc?RIIA KD (M) 8.9E?08 4.22E?07 3.36E?07 8.29E?07 1.91E?07 kon(1/Ms) 4.4E+05 6.48E+05 2.49E+05 1.99E+04 4.70E+05 kdis(1/s) 3.9E?02 2.74E?01 8.36E?02 1.65E?02 8.98E?02 Fc?RIIB KD (M) No 2.36E?07 2.40E?07 5.17E?07 2.56E?07 kon(1/Ms) No 3.61E+05 1.62E+05 1.76E+05 1.81E+05 kdis(1/s) No 8.48E?02 3.87E?02 9.15E?02 4.64E?02 Fc?RIIIA (F) KD (M) No 1.68E?07 No 9.17E?07 5.27E?07 kon(1/Ms) No 1.56E+06 No 1.43E+04 4.87E+05 kdis(1/s) No 2.62E?01 No 1.30E?02 2.57E?01 Fc?RIIIA (V) KD (M) No 1.53E?07 No 1.26E?06 No kon(1/Ms) No 1.34E+06 No 1.18E+04 No kdis(1/s) No 2.05E?01 No 1.49E?02 No Fc?RIIIB KD (M) No 1.17E?07 No No No kon(1/Ms) No 1.74E+06 No No No kdis(1/s) No 2.04E?01 No No No FcRn KD (M) 1.0E?08 7.46E?09 3.54E?08 5.76E?08 2.64E?08 kon(1/Ms) 19.9+E05.sup. 1.87E+06 2.65E+05 2.12E+05 7.37E+05 kdis(1/s) 9.9E+03 1.39E?02 9.41E?03 1.22E?02 1.95E?02

(137) TABLE-US-00024 TABLE 12 FcR Binding Activity of Human IgG4 Mutants IgG4 G4m15 G4m17 G4m18 G4m19 G4m25 G4m27 G4m28 G4m29 Fc?RI KD (M) 4.8E?09 N.D. No Low Low 4.6E?08 6.6E?08 5.6E?08 4.4E?08 kon(1/Ms) 3.6E+05 N.D. No Low Low 3.8E+05 3.7E+05 4.9E+05 5.2E+05 kdis(1/s) 1.7E?03 N.D. No Low Low 1.7E?02 2.5E?02 2.7E?02 2.3E?02 Fc?RIIA KD (M) 4.0E?07 N.D. 6.0E?07 Low Low 6.6E?07 Low 1.8E?06 2.6E?07 kon(1/Ms) 1.4E+05 N.D. 4.0E+04 Low Low 5.7E+04 Low 3.1E+04 1.0E+05 kdis(1/s) 5.5E?02 N.D. 2.4E?02 Low Low 3.8E?02 Low 5.5E?02 2.7E?02 Fc?RIIB KD (M) 4.0E?07 N.D. 2.8E?07 No Low 2.4E?07 3.1E?07 1.8E?07 7.8E?08 kon(1/Ms) 1.4E+05 N.D. 6.8E+04 No Low 1.3E+05 1.3E+05 1.9E+05 1.7E+05 kdis(1/s) 5.0E?02 N.D. 1.9E?02 No Low 3.0E?02 3.9E?02 3.4E?02 1.3E?02 Fc?RIIIA (F) KD (M) No N.D. No No No No No No No kon(1/Ms) No N.D. No No No No No No No kdis(1/s) No N.D. No No No No No No No Fc?RIIIA (V) KD (M) 5.5E?07 N.D. No No No No No No No kon(1/Ms) 1.7E+05 N.D. No No No No No No No kdis(1/s) 9.2E?02 N.D. No No No No No No No Fc?RIIIB KD (M) No N.D. No No No No No No No kon(1/Ms) No N.D. No No No No No No No kdis(1/s) No N.D. No No No No No No No FcRn KD (M) 1.8E?08 N.D. 5.2E?08 1.1E?08 1.3E?08 1.9E?08 2.3E?08 2.0E?08 2.3E?08 kon(1/Ms) 6.4E+05 N.D. 2.1E+05 6.1E+05 6.9E+05 4.8E+05 4.5E+05 5.8E+05 5.6E+05 kdis(1/s) 1.2E?02 N.D. 1.1E?02 6.8E?03 9.0E?03 9.0E?03 1.0E?02 1.2E?02 1.3E?02

(138) As shown in FIGS. 1A-1W, a number of human IgG1, IgG2, and IgG4 mutants showed binding activity to FC?Rs expressed on the cell surface. Qualitative summaries of the changes of the mutants' Fc? binding activity relative to the wild-type counterpart are provided in Tables 2-4 above.

Example 5. Human IgG Mutants Capable of Binding to Cellular Fc?RIIB Showed Enhanced Agonist Activity

(139) To verify that binding to cellular Fc?R2B would enhance agonist activity of the IgG mutants, a co-culture assay was developed, which involves CHO cells expressing Fc?R2B and human CD8 positive T cells. CHO-Fc?RIIB cells were plated at 2?10.sup.4/well in 96-well cell culture plate and were incubated overnight. To isolate human CD8 positive T cells, fresh blood from healthy donors were mixed with equal volume of DPBS gently. The blood sample was then placed on top of Ficoll underlay and centrifuged 30 min at 1000 g at RT without brake. The buffy coat containing PBMC was harvested into a new tube and was washed with DPBS. CD8 positive T cells were isolated from the PBMC using EASYSEP? Human CD8+ T Cell Isolation Kit (Stemcell #17953) according to the kit manual. The isolated CD8+ T cells suspended in RPMI media were added to the plates with CHO-Fc?RIIB cells. The anti-human CD3 antibody OKT3 was added to a final concentration of 0.1 ug/ml followed by addition of test antibodies diluted at desired concentrations. The plates were cultured for 3 days, and then the culture supernatants were harvested for measurement of IFNg concentration by ELISA using Human IFN-gamma ELISA Ready-SET-GO kit (EBIOSCIENCE, #88-7316-88).

(140) As shown in FIG. 2A-2C, a number of tested IgG mutants stimulated human CD8+ cells in the presence of CHO-Fc?RIIB cells as evidenced by the secretion of IFN-?.

Example 6. Effect of IgG Isotypes In Vitro and In Vivo in Mouse Models

(141) Two different antibodies against mouse 4-1BB (CD137), LOB12.3 and 3H3, were examined in detail. These two antibodies were cloned and expressed as various mouse IgG isotypes including murine IgG1, a murine IgG1 N297A mutant known to have diminished ability to bind FcRs (as a negative control), and murine IgG2a.

(142) Murine CD8 positive T cells were stimulated by the antibodies in a solution. In a typical in vitro co-stimulation assay of murine CD8 T cells, antibody LOB12.3 was not able to stimulate the T cells as measure by interferon gamma secretion, whereas 3H3 antibody exhibited agonistic activity regardless of the antibody isotype, as shown in FIG. 3.

(143) In vivo antitumor activity and liver toxicity were examined. The activity profile of these two antibodies and their isotypes were vastly different. In a murine syngeneic CT26 colorectal cancer model, both LOB12.3 and 3H3 showed robust antitumor activity including complete rejection of tumors, although the optimal isotype for each antibody is distinct. FIG. 4A-4B. LOB12.3 showed no obvious co-stimulatory activity in vitro but was efficacious in vivo when it was in murine IgG1 isotype, supporting that Fc?R2B mediated cross-linking would result in efficient agonistic activity. 3H3 is intrinsically agonistic and its activity was not dependent on Fc-mediated cross-linking. In fact, 3H3 in Fc-null mutant was most efficacious.

(144) An unexpected observation was the differential effect on liver toxicity of these antibodies. Both LOB12.3 and 3H3 were efficacious in inducing tumor rejection but only 3H3 showed liver toxicity as determined by increased liver enzyme ALT in serum samples of the treated animals (FIG. 4B).

(145) These experimental data, for the first time, suggested a potential utility of selecting and engineering agonistic antibodies for increased therapeutic index of co-stimulation agonist antibodies.

Example 7. Pharmacokinetic Study of Chimeric Antibodies

(146) In vivo studies were performed to study the pharmacokinetics of selected chimeric antibodies. Antibodies formulated in PBS were administered to C57BL/6 mice (6-7 weeks old, 19-20 g, male) via tail vein injection. Doses were 1-3 mg/kg (n=4 mice per group).

(147) Blood samples were taken prior to administration of the antibodies, and 1 h, 2 h, 4 h, 8 h, 1 d, 2 d, 3 d, 5 d, 8 d, 11 d, 15 d and 21 d following administration. 10 uL blood of per time point was extracted and added to 40 uL of a PBS-BSA solution. The sample was then mixed well and centrifuged at 2000 g for 5 minutes at 4? C. The supernatant was put on dry ice immediately after collection and stored at approximately ?70? C. until analysis. Antibody concentrations in the blood samples were determined by ELISA as described below briefly.

(148) CD137 protein (human CD137-His tag protein (Sino Biological Inc. Cat #10377-H08H-100) or rhesus monkey CD137-His (Sino Biological Inc. Cat #90305-K08H-100)) was diluted in PBS to 1 ?g/ml and used to coat an ELISA plate (Corning, Cat #9018, high binding) at a concentration of 500/well. The plate was incubated overnight at 4? C. The plate was then decanted and washed with PBS-T, and 2000/well assay diluent (1?PBS/1% BSA/0.05% Tween-20/0.05% proclin 300) was added. After a three hour incubation at room temperature, the plate was washed with PBS-T three times. The samples, at appropriate dilutions, along with known concentrations of antibody standards diluted in assay diluent to 0, 0.000003, 0.00003, 0.0003, 0.003, 0.03, and 0.3 ?g/ml (or approximately 0, 0.00002, 0.0002, 0.002, 0.02, 0.2 and 2 nM), were then added to the plate (50 ?l/well). The plate was incubated for one hour at 37? C. and then washed three times with PBS-T. Anti-human IgG-HRP conjugate (Bethyl Cat #A80-319P) at a 1:10,000 dilution was added to the plate (100 ?l/well). The plate was incubated for 0.5 hour at 37? C., followed by washing with PBS-T three times. The TMB substrate solution was added (100 ?l/well). The color was allowed to develop for 8 minutes before it was stopped with 1000/well 2N H2504. Absorbance at 450 nm was determined with an ELISA reader, and antibody concentrations were calculated from the standard curve dose responses.

(149) FIGS. 5A-5G show the plasma antibody concentration of the chimeric antibodies after a single intravenous injection of 1-3 mg/kg. The pharmacokinetics parameters of these antibodies examined are listed in Table 13 below, which indicates that most, if not all, of the mutations examined did not alter the normal IgG PK parameters.

(150) TABLE-US-00025 TABLE 13 Summary of Pharmacokinetics of IgG Variants Examined in Mice PK parameters Unit G4 G4m2 G4m7 G1m27 G1m28 G1m29 G4m27 G4m28 CL mL/day/kg 10.70 8.39 9.62 8.06 10.7 10.30 9.98 8.95 V.sub.ss mL/kg 144 146 130 152 142 142 122 126 V1 mL/kg 58.9 58.7 53.6 56.8 58.4 63.7 53.3 61.1 Alpha t.sub.1/2 day 0.1760 0.119 0.161 0.116 0.184 0.2850 0.306 0.295 Beta t.sub.1/2 day 9.9 12.3 10.2 13.40 9.54 9.9 8.9 10.3 AUC day*?g/mL 287 359 324 374 282 294 146 164 MRT day 13.8 17.5 14.4 19.0 13.4 13.8 12.2 14.3 PK parameters Unit G4m29 G1m2 G4m10 G2m19 G4m1 G1mAA G2 G2m1 CL mL/day/kg 10.70 8.58 9.47 7.19 6.24 7.71 6.28 8.41 V.sub.ss mL/kg 147 173 116 127 91 125 118 122 V1 mL/kg 66.1 56.6 49.7 39.2 52.6 49.2 53.4 Alpha t.sub.1/2 day 0.256 0.151 0.182 0.099 0.0919 0.108 0.123 Beta t.sub.1/2 day 9.99 14.8 8.9 13.1 10.40 11.5 13.7 10.3 AUC day*?g/mL 142 365.0 158 431 487 394 497 374 MRT day 13.9 21 12.7 18.5 14.7 16.4 19.6 14.6

OTHER EMBODIMENTS

(151) All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.

(152) From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.