Cell-free production of geranyl pyrophosphate from glycerol in a cell-free manufacturing system
12006528 ยท 2024-06-11
Assignee
Inventors
Cpc classification
B01L2200/0631
PERFORMING OPERATIONS; TRANSPORTING
B01J19/004
PERFORMING OPERATIONS; TRANSPORTING
C12Y101/01088
CHEMISTRY; METALLURGY
B01L3/00
PERFORMING OPERATIONS; TRANSPORTING
C12Y503/03002
CHEMISTRY; METALLURGY
B01L2300/1894
PERFORMING OPERATIONS; TRANSPORTING
C12P9/00
CHEMISTRY; METALLURGY
C12Y203/01009
CHEMISTRY; METALLURGY
B01L2300/048
PERFORMING OPERATIONS; TRANSPORTING
C12P7/40
CHEMISTRY; METALLURGY
B01L2200/147
PERFORMING OPERATIONS; TRANSPORTING
C12Y205/0101
CHEMISTRY; METALLURGY
C12P19/32
CHEMISTRY; METALLURGY
C12Y402/01009
CHEMISTRY; METALLURGY
International classification
C12P9/00
CHEMISTRY; METALLURGY
B01L3/00
PERFORMING OPERATIONS; TRANSPORTING
Abstract
Geranyl pyrophosphate (GPP) is a key intermediate molecule in the bioproduction of thousands of natural products. Currently, natural products are either cultivated from plants, synthesized via complex chemical synthesis strategies, or through cell-based factories also known as biofoundries. However, in order to replicate the process in a cell free environment, numerous enzymes and cofactors must be utilized making this approach costly and unviable. In order to make this process viable, a new approach was needed that uses fewer enzymes and co-factors. As described herein, the present invention demonstrates that it is possible to create GPP from glycerol through a short and concise biosynthetic pathway outside of the cell.
Claims
1. A method of converting glycerol to geranyl pyrophosphate (GPP) and additional secondary metabolites in a cell-free medium, the method comprising: a) adding glycerol to a reaction mixture; b) adding a plurality of enzymes to the reaction mixture from (a); wherein the plurality of enzymes comprises an enzyme that comprises SEQ ID NO: 1 (maltose binding protein alditol oxidase (MPD-ALDO) or an optimized form thereof, and one or more enzymes selected from the group consisting of: an enzyme that comprises SEQ ID NO: 2 (dihydroxy-acid dehydratase (DHAD)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 3 (acetyl-phosphate transferase (PTA)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 4 (acetyl-CoA acetyltransferase (PhaA)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 5 (HMG-CoA Synthase A110G (HMGS)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 6 (HMG-CoA Reductase (HMGR)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 7 (mevalonate kinase (MVK)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 8 (phosphomevalonate kinase (PMVK)) or an optimized form thereof, an enzyme that comprises SEQ ID NO: 9 (diphosphomevalonate kinase (MDC)) or an optimized form thereof, and an enzyme that comprises SEQ ID NO: 10 (isopentyl-PP Isomerase (IDI)) or an optimized form thereof; c) removing a supernatant from the reaction mixture from (b); and d) isolating GPP.
2. The method of claim 1, wherein at least five enzymes are added to the reaction mixture.
3. The method of claim 1, wherein at least ten enzymes are added to the reaction mixture.
4. The method of claim 1, further comprising adding a phenyl transferase enzyme to step (b) to convert GPP to cannabigerolic acid (CBGA).
5. The method of claim 4, wherein the conversion of GPP to CBGA is used to determine the amount of GPP produced from the method.
6. The method of claim 1, wherein the reaction mixture comprises co-factors.
7. The method of claim 6, wherein the cofactors are adenosine triphosphate (ATP), nicotinamide adenine dinucleotide (NAD.sup.+), nicotinamide adenine dinucleotide phosphate (NADP.sup.+), or a combination thereof.
8. The method of claim 6, wherein the cofactors are recycled.
9. The method of claim 8, wherein glucose dehydrogenase (GDH), and polyphosphate kinase 2 (PPK2) are added to the reaction mixture to recycle the co-factors.
10. The method of claim 1, wherein one or more of the enzymes are immobilized.
11. The method of claim 1, wherein one or more of the enzymes are non-immobilized.
12. The method of claim 1, wherein the plurality of enzymes in the reaction mixture comprises all of the plurality of enzymes from step (b).
13. The method of claim 12, wherein the enzymes in the reaction mixture are immobilized.
14. The method of claim 9, wherein the PPK2 enzyme comprises SEQ ID NO: 12 or an optimized form thereof.
15. The method of claim 9, wherein the GDH enzyme has comprises SEQ ID NO: 13 or an optimized form thereof.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
(1) The features and advantages of the present invention will become apparent from a consideration of the following detailed description presented in connection with the accompanying drawings in which:
(2)
(3)
DETAILED DESCRIPTION OF THE INVENTION
(4) Before the present compounds, compositions, and/or methods are disclosed and described, it is to be understood that this invention is not limited to specific synthetic methods or to specific compositions, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.
(5) Additionally, although embodiments of the disclosure have been described in detail, certain variations and modifications will be apparent to those skilled in the art, including embodiments that do not provide all the features and benefits described herein. It will be understood by those skilled in the art that the present disclosure extends beyond the specifically disclosed embodiments to other alternative or additional embodiments and/or uses and obvious modifications and equivalents thereof. Moreover, while a number of variations have been shown and described in varying detail, other modifications, which are within the scope of the present disclosure, will be readily apparent to those of skill in the art based upon this disclosure. It is also contemplated that various combinations or sub-combinations of the specific features and aspects of the embodiments may be made and still fall within the scope of the present disclosure. Accordingly, it should be understood that various features and aspects of the disclosed embodiments can be combined with or substituted for one another in order to form varying modes of the present disclosure. Thus, it is intended that the scope of the present disclosure herein disclosed should not be limited by the particular disclosed embodiments described herein.
(6) As used herein, the singular forms a, an, and the are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms including, includes, having, has, with, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term comprising.
(7) As used herein, reaction solution may refer to all components necessary for enzyme-based chemical transformation. This is typically, but not limited to, buffering agent, salts, cofactor, and substrate (i.e., starting material).
(8) As used herein, reaction mixture may refer to all components from the reaction solution plus the enzyme(s) and/or products from the reaction. In some embodiments, the reaction mixture may refer to just the reaction solution without any enzymes or reaction products.
(9) In some embodiments, reaction solution and reaction mixture may be used interchangeably.
(10) As used herein, buffering agents may refer to chemicals added to water-based solutions that resist changes in pH by the action of acid-base conjugate components.
(11) As used herein, supernatant may refer to the soluble liquid fraction of a sample.
(12) As used herein, batch reactions may refer to a chemical or biochemical reaction performed in a closed system such as a fermenter or typical reaction flask.
(13) As used herein, cofactors may refer to a non-protein chemical compound that may bind to a protein and assist with a biological chemical reaction. Co-factors may be metal ions, organic compounds, or other chemicals. Non-limiting examples of cofactors may include but are not limited to ATP and NADPH.
(14) As used herein, cofactor recycling may refer to regeneration of functional cofactor capable of participating in enzyme-catalyzed reactions. A non-limiting example of this regeneration is a separate reaction acting on the altered cofactor produced by a primary enzymatic reaction, such as the enzymatic conversion of ADP back to ATP.
(15) Referring now to
(16) The present features a method of converting glycerol to geranyl pyrophosphate (GPP) and additional secondary metabolites. In some embodiments, the method comprises adding glycerol to a reaction mixture. In some embodiments, the method comprises adding a plurality of enzymes to the aforementioned reaction mixture. In some embodiments, the enzymes are selected from a group consisting of alditol oxidase (Aldo), dihydroxy-acid dehydratase (DHAD), pyruvate oxidase (PyOx), acetyl-phosphate transferase (PTA), acetyl-CoA acetyltransferase (PhaA), HMG-CoA Synthase A110G (HMGS), HMG-CoA Reductase (HMGR), mevalonate kinase (MVK), phosphomevalonate kinase (PMVK), diphosphomevalonate kinase (MDC), isopentyl-PP Isomerase (IDI), and farnesyl-PP synthase S82F (FPPS). In some embodiments, the method comprises removing a supernatant from the aforementioned reaction mixture. In some embodiments, the method comprises isolating or producing GPP.
(17) The present invention may also feature a method of converting glycerol to geranyl phosphate (GPP) and additional secondary metabolites. In some embodiments, the method comprises adding glycerol and alditol oxidase (Aldo) to a reaction mixture. In some embodiments, the method further comprises adding dihydroxy-acid dehydratase (DHAD) to the reaction mixture. In some embodiments, the method comprises removing a supernatant of the aforementioned reaction mixture and adding pyruvate oxidase (PyOx) to the supernatant of the reaction mixture. In some embodiments, the method comprises removing a supernatant of the aforementioned reaction mixture and at least two enzymes selected from a group consisting of acetyl-phosphate transferase (PTA), acetyl-CoA acetyltransferase (PhaA), HMG-CoA Synthase A110G (HMGS), HMG-CoA Reductase (HMGR), mevalonate kinase (MVK), phosphomevalonate kinase (PMVK), diphosphomevalonate kinase (MDC), isopentyl-PP Isomerase (IDI), and farnesyl-PP synthase S82F (FPPS) to the supernatant of the reaction mixture. In some embodiments, the method comprises removing the supernatant from the aforementioned reaction mixture and producing or isolating GPP.
(18) In some embodiments, at least one enzyme is added to the reaction mixture. In some embodiments, at least two enzymes are added to the reaction mixture. In some embodiments, at least three enzymes are added to the reaction mixture. In some embodiments, at least four enzymes are added to the reaction mixture. In some embodiments, at least five enzymes are added to the reaction mixture. In some embodiments, at least six enzymes are added to the reaction mixture. In some embodiments, at least seven enzymes are added to the reaction mixture. In some embodiments, at least eight enzymes are added to the reaction mixture. In some embodiments, at least nine enzymes are added to the reaction mixture. In some embodiments, at least ten enzymes are added to the reaction mixture. In some embodiments, at least eleven enzymes are added to the reaction mixture. In some embodiments, at least twelve enzymes are added to the reaction mixture.
(19) In some embodiments, the enzymes may be added to the reaction mixture asynchronously. In other embodiments, the enzymes may be added to the reaction mixture simultaneously.
(20) In some embodiments, the method further comprises adding a NphB enzyme before the final removal of the supernatant from the reaction mixture to convert GPP to cannabigerolic acid (CBGA). In some embodiments, CBGA is used to determine the amount of GPP produced in the above-mentioned method. In some embodiments, the production of CBGA is used as an analytical tool. In some embodiments, the production of CBGA from GPP by NphB is used as a detection method. In some embodiments, the production of CBGA by NphB is used to detect the amount of GPP. In some embodiments, the amount of CBGA produced from the conversion of GPP by the NphB enzyme is 1:1.
(21) In some embodiments, the reaction mixtures described herein comprise cofactors. In some embodiments, the cofactors comprise adenosine triphosphate (ATP), nicotinamide adenine dinucleotide (NAD.sup.+), nicotinamide adenine dinucleotide phosphate (NADP.sup.+), or a combination thereof. In some embodiments, the methods described herein utilized cofactor recycling. In some embodiments, the cofactors are recycled. In some embodiments, the method further comprises adding glucose dehydrogenase (GDH), and polyphosphate kinase 2 (PPK2) to the reaction mixture. In some embodiments, glucose dehydrogenase (GDH), and polyphosphate kinase 2 (PPK2) are added to the reaction mixture to recycle the co-factors.
(22) In some embodiments, the temperature of the reaction may range from about 22? C. to about 50? C. In some embodiments, the temperature of the reaction is about 20? C. In some embodiments, the temperature of the reaction is about 25? C. In some embodiments, the temperature of the reaction is about 30? C. In some embodiments, the temperature of the reaction is about 35? C. In some embodiments, the temperature of the reaction is about 40? C. In some embodiments, the temperature of the reaction is about 45? C. In some embodiments, the temperature of the reaction is about 50? C. In some embodiments, the temperature of the reaction is about 55? C.
(23) In some embodiments, the pH of the reaction may range from about 6.5 to about 9.0. In some embodiments, the pH of the reaction is about 5.0. In some embodiments, the pH of the reaction is about 5.5. In some embodiments, the pH of the reaction is about 6.0. In some embodiments, the pH of the reaction is about 6.5. In some embodiments, the pH of the reaction is about 7.0. In some embodiments, the pH of the reaction is about 8.5. In some embodiments, the pH of the reaction is about 9.0. In some embodiments, the pH of the reaction is about 9.5. In some embodiments, the pH of the reaction is about 10.0.
(24) In some embodiments, the time to run the reaction may range from about 2 hours to about 32 hours. In some embodiments, the time to run the reaction is about 0.5 hour. In some embodiments, the time to run the reaction is about 1 hour. In some embodiments, the time to run the reaction is about 2 hours. In some embodiments, the time to run the reaction is about 5 hours. In some embodiments, the time to run the reaction is about 10 hours. In some embodiments, the time to run the reaction is about 15 hours. In some embodiments, the time to run the reaction is about 20 hours. In some embodiments, the time to run the reaction is about 25 hours. In some embodiments, the time to run the reaction is about 30 hours. In some embodiments, the time to run the reaction is about 35 hours. In some embodiments, the time to run the reaction is about 40 hours. In some embodiments, the time to run the reaction is about 45 hours. In some embodiments, the time to run the reaction is greater than 45 hours.
(25) In some embodiments, the enzymes are immobilized. In some embodiments, immobilized enzymes are immobilized onto solid supports. Non-limiting examples of solid supports may include but are not limited to epoxy methacrylate, amino C.sub.6 methacrylate, or microporous polymethacrylate. In further embodiments, various surface chemistries may be used for linking the immobilized enzyme to a solid surface, including but not limited to covalent, adsorption, ionic, affinity, encapsulation, or entrapment. In other embodiments, the enzymes are non-immobilized.
(26) In some embodiments, one or more of the enzymes are immobilized. In other embodiments, all the enzymes are immobilized. In some embodiments, one or more of the enzymes are non-immobilized. In other embodiments, all the enzymes are non-immobilized. In some embodiments, the plurality of enzymes are immobilized. In other embodiments, the plurality of enzymes are non-immobilized.
(27) In some embodiments, various reaction conditions may be altered to ensure functional enzymes, including but not limited to reaction time, oxygenation/deoxygenation, pH, buffering agents, and reaction temperature.
(28) In some embodiments, the methods described herein teaches away from previously described methods because the presently claimed methods utilized less enzymes and co-factors to produce GPP. In certain embodiments, methods described herein do not use 24 cofactor equivalents used by Valliere et al., (or 60% of cofactors). In certain embodiments, only ten of the enzymes taught by Valliere et al. are used in the presently claimed method.
Example
(29) The following is a non-limiting example of the present invention. It is to be understood that said example is not intended to limit the present invention in any way. Equivalents or substitutes are within the scope of the present invention.
(30) Enzyme Expression and Purification: All genes were synthesized and cloned into expression plasmids and then transformed into E. coli cells for expression. Cells were grown in TB media supplemented with 50 ?g/mL kanamycin sulfate at 37? C. and 200 rpm until A.sub.600=0.6. Cells were cooled to 18? C., expression was induced and grown for an additional 18 h. Cell pellets were collected by centrifugation, frozen, and then resuspended in a 5 mL lysis buffer (50 mM Tris pH 8.0, 300 mM NaCl, 5% glycerol, 1 mM PMSF) per gram of cell paste. Cell lysates were prepared by sonication and cellular debris was removed by centrifugation. Clarified lysate was loaded onto GE XK series columns containing IMAC-Nickel resin. Proteins were eluted using a 15CV gradient from buffer A (50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol) into 70% buffer B (2 M imidazole, 50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol). Fractions containing proteins of interest were pooled and transitioned into buffer A (above) with a GE HiPrep 26/10 desalting column, with the exception of MBP-Aldo, which was stored in 50 mM Tris pH 8.0, 500 mM NaCl, 0.1% Triton X-100.
(31) 1.0 Production of GPP with the non-immobilized cell-free pathway: As described herein, the pathway first converts glycerol to glyceric acid using alditol oxidase (Aldo, EC 1.1.3.41) before subsequent conversion into pyruvic acid using dihydroxy-acid dehydratase (DHAD, EC 4.2.1.9,
(32) To ensure functional enzymes, specific reaction conditions including timed reaction oxygenation, de-oxygenation, pH changes, specific buffers, and reaction temperature had to be found. First, the reported Aldo is unstable and inactive. To overcome this, a modified Aldo was created housing a fusion maltose-binding protein (MBP) tag to improve solubility and stability in solution (SEQ ID 1). The MBP-fused Aldo converted glycerol into glyceric acid (100%, 1.75 g/L). Second, the published reaction with Sulfolobus solfataricus DHAD was also not reproducible. To overcome this, many DHAD enzyme orthologs were screened; and it was found that DHAD from Thermosynechococcus vulcanus converted 100% of glyceric acid to pyruvic acid (1.32 g/L).
(33) With these new enzymes, a one-pot reaction containing both Aldo (11 ?M) and DHAD (16 ?M) converted glycerol into pyruvic acid (100% conversion, yield 1.23 g/L). Compared to previous work starting from glucose, the present improved system afforded 14 mM of pyruvic acid in 24 hours, without the use of cofactors and nine fewer enzymes providing a significant improvement. It should also be noted that previous attempts from glucose require many additional enzymes, cofactors, and reaction manufacturing complications such as protein precipitation. Removing these constraints allows a commercially viable approach to GPP from an inexpensive carbon source.
(34) After optimization of Aldo and DHAD, the remaining enzymes in the pathway that convert pyruvic acid into geranyl pyrophosphate had to be created and optimized (GPP,
(35) 2.0 Protein Immobilization and Optimization: To increase stability, longevity, and catalysis, each purified enzyme in the pathway was immobilized onto solid supports. Different commercial support materials were routinely screened for product and substrate retention, enzyme retention, and activity of the immobilized enzyme. The support collection comprised of various surface chemistries for the following types of linkage: covalent, adsorption, ionic, affinity, encapsulation, and entrapment. Typically, 50 mg of resin was mixed with 4.0 mg of an enzyme in a desalting buffer 16-24 h at room temperature. The amount of immobilized enzyme was quantified by measuring protein concentration in solution before and after immobilization by either BCA or Bradford assay. All immobilized enzymes were screened for optimal values for resin type, substrate concentration (5 mM-250 mM), pH (5.0-9.0), temperature (20-50? C.), buffering agent (Tris, HEPES, PO.sub.4), and time (1 h-36 h). Optimal reaction conditions and results for each enzyme are as follows (Table 1A).
(36) TABLE-US-00001 TABLE 1A Conditions found for the immobilized enzymes used in the GPP biomanufacturing route (FIG. 1A). Reaction Conditions Screened Temp Time Yield Enzyme Name (? C.) pH (h) (%) MBP-Aldo (Aldo) 37 9.0 21 98 Dihydroxy Acid Dehydratase (DHAD) 45 8.0 16 32 Pyruvate Oxidase (PyOx) 37 6.5 16 91 Acetyl-phosphate transferase (PTA) 32 8.0 8 60 Acetyl-CoA acetyltransferase (PhaA) 32 8.0 8 44 HMG-CoA Synthase A110G (HMGS) 32 7.5 2 54 HMG-CoA Reductase (HMGR) 37 7.0 2 98 Mevalonate Kinase (MVK) 37 8.0 87 Phosphomevalonate Kinase (PMVK) 37 8.0 32 96 Diphosphomevalonate Kinase (MDC) 37 8.0 16 94 Isopentyl-PP Isomerase (IDI) 22 8.0 2 28 Farnesyl-PP synthase S82F (FPPS) 25 8.3 4 81 Prenyl transferase (NphB) 50 8.0 6 16
(37) The percent yields in the foregoing table are presented for illustrative purposes. In some embodiments, each step of the GPP biomanufacturing process may have a percent yield of up to 99%, up to 99.5%, up to 99.9% or up to 100%. In some embodiments, the percent yields in each step of the GPP biomanufacturing process may have values within the ranges in the following table (Table 1B).
(38) TABLE-US-00002 TABLE 1B Exemplary ranges for the immobilized enzymes that may be used in the GPP biomanufacturing route (FIG. 1A). Exemplary Reaction Conditions Approxi- Approxi- Approxi- mate mate mate Yield Enzyme Name Temp (? C.) pH Time (h) (%) MBP-Aldo (Aldo) 37 9 21 98-100% Dihydroxy Acid 45 8.0 16 32-100% Dehydratase (DHAD) Pyruvate Oxidase (PyOx) 37 6.5 16 91-100% Acetyl-phosphate 32 8.0 8 60-100% transferase (PTA) Acetyl-CoA 32 8.0 8 44-100% acetyltransferase (PhaA) HMG-CoA Synthase 32 7.5 2 54-100% A110G (HMGS) HMG-CoA Reductase 37 7.0 2 98-100% (HMGR) Mevalonate Kinase 37 8.0 87-100% (MVK) Phosphomevalonate 37 8.0 32 96-100% Kinase (PMVK) Diphosphomevalonate 37 8.0 16 94-100% Kinase (MDC) Isopentyl-PP Isomerase 22 8.0 2 28-100% (IDI) Farnesyl-PP synthase 25 8.3 4 81-100% S82F (FPPS) Prenyl transferase (NphB) 50 8.0 6 16-100%
(39) 2.1 Optimization of Alditol Oxidase (Aldo): MBP-Aldo was immobilized onto activated amino C.sub.6 methacrylate resin. The immobilized enzyme was used to convert glycerol into glyceric acid. The reaction solution (50 mM Tris pH 9, 2.5 mM MgCl.sub.2, 20 mM glycerol) was mixed with 50 ?M immobilized enzyme at 37? C. for 21 hours. Immobilized MBP-Aldo converted 100% of 20 mM glycerol to yield 20 mM (1.75 g/L) glyceric acid. For sampling, the reaction mixture was analyzed through high-performance liquid chromatography (HPLC). The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 30 cm Aminex HPX-87H column equipped with a micro-guard cation H refill cartridge. The column was heated to 55? C. with the sample block being maintained at 25? C. For each sample, 1 ?L was injected, and using a mobile phase comprised of 100% sulfuric acid (10 mM). The sample time was a total of 45 minutes with glyceric acid eluting at 17.2 mins and glycerol eluting at 21.0 minutes. A Refractive Index Detector (RID, Agilent) was used after a 2 h equilibration period produced a stable baseline.
(40) 2.2 Optimization of Dihydroxy Dehydratase (DHAD): DHAD was mixed with activated amino C.sub.6 methacrylate resin and the immobilized enzyme was used to convert glyceric acid into pyruvic acid. The reaction solution (50 mM Tris pH 8.5, 2.5 mM MgCl.sub.2, 20 mM glyceric acid) was mixed with 50 ?M immobilized enzyme at 45? C. for 16 hours. Immobilized DHAD was able to convert 99% of 20 mM glyceric acid for a yield of 15 mM (1.32 g/L, 75%) pyruvic acid. For sampling, the reaction mixture was examined on an HPLC system to examine the amount of glycerol and glyceric acid. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 30 cm Aminex HPX-87H column equipped with a micro-guard cation H refill cartridge. The column was heated to 55? C. with the sample block being maintained at 25? C. For each sample, 1 ?L was injected and an isocratic gradient comprised of 100% sulfuric acid (10 mM) was used as the mobile phase. The sample time was a total of 45 minutes with pyruvic acid eluting at 16.0 minutes and glyceric acid eluting at 17.2 mins. A Refractive Index Detector (Agilent) was used after a 2 h equilibration period produced a stable baseline.
(41) 2.3 Optimization of Pyruvate Oxidase (PyOx): PyOx was mixed with activated amino C.sub.6 methacrylate resin and the immobilized enzyme was used to convert pyruvic acid into acetyl phosphate. The reaction solution (10 mM Tris, 50 mM KH.sub.2PO.sub.4, 50 mM K.sub.2HPO.sub.4, pH 6.5, 5.0 mM MgCl.sub.2, 100 mM NaCl, 20 mM pyruvic acid, 20 mM thiamine pyrophosphate) was mixed with 3.85 ?M immobilized enzyme at 37? C. for 16 hours. Immobilized PyOx was able to convert 91% of 5 mM pyruvate for a yield of 4.55 mM (837 mg/L) acetyl phosphate. For sampling, the reaction fluid was examined on an HPLC system to examine the amount of pyruvate and acetyl phosphate. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 30 cm Aminex HPX-87H column equipped with a micro-guard cation H refill cartridge. The column was heated to 55? C. with the sample block being maintained at 25? C. The HPLC method comprised of 5 ?l sample injection volume and an isocratic gradient comprised of 100% sulfuric acid (10 mM) was used as the mobile phase. The run time was a total of 25 minutes with acetyl phosphate eluting at 23.6 mins and pyruvate eluting at 16.0 minutes. A Refractive Index Detector (Agilent) was used after a 2 h equilibration period produced a stable baseline.
(42) 2.4 Optimization of Phosphate acetyltransferase (PTA): PTA was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert acetyl phosphate into acetyl-coenzyme A (acetyl-CoA). The reaction solution (10 mM Tris, 50 mM KH.sub.2PO.sub.4, 50 mM K.sub.2HPO.sub.4, pH 8.0, 5.0 mM MgCl.sub.2, 100 mM NaCl, 3.2 mM acetyl phosphate, 3.2 mM CoA) was mixed with immobilized enzyme at 32? C. for 8 hours. Immobilized PTA (38.4 ?M) was able to convert 60% of 3.2 mM acetyl phosphate for a yield of 1.92 mM (1.7 g/L) acetyl-CoA. For sampling, the reaction fluid was examined on an HPLC system to examine the amount of acetyl phosphate and acetyl-CoA. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a HYPERSIL ODS COLUMN 150 mm?3 mm equipped with a BetaSil C18 20 mm?2.1 mm guard column. The column was heated to 25? C. with the sample block being maintained at 4? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 75 mM CH.sub.3COONa (sodium acetate) and 100 mM NaH.sub.2PO.sub.4 (sodium dihydrogen phosphate) mixed with acetonitrile (ACN) in a ratio 94:6. The run time was a total of 12 minutes with acetyl-CoA eluting at 8.5 mins and coenzyme A (CoA) eluting at 3.9 minutes. A diode array detector (Agilent) was used for the detection of the molecule of interest at 259 nm.
(43) 2.5 Optimization of Acetyl-Coenzyme A C-acetyltransferase (PhaA): PhaA was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert acetyl-CoA into acetoacetyl-CoA. The reaction solution (50 mM Tris, 50 mM KH.sub.2PO.sub.4, 50 mM K.sub.2HPO.sub.4, pH 8.0, 5.0 mM MgCl.sub.2, 100 mM NaCl, 2.5 mM acetyl CoA) was mixed with immobilized enzyme at 32? C. for 8 hours. Immobilized PhaA (20 ?M) was able to convert 44% of 2.5 mM acetyl-CoA for a yield of 1.1 mM (1.1 g/L) acetoacetyl-CoA. The retention time of AcCoA and acetoacetyl CoA coincide; therefore, PhaA activity was measured based on the amount of CoA produced in the reaction, as CoA and acetoacetyl CoA are produced in equimolar amounts. For sampling, the reaction fluid was examined on an HPLC system to examine the amount of AcCoA and CoA. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a HYPERSIL ODS COLUMN 150 mm?3 mm equipped with a BetaSil C18 20 mm?2.1 mm guard column. The column was heated to 25? C. with the sample block being maintained at 4? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 75 mM CH.sub.3COONa and 100 mM NaH.sub.2PO.sub.4 mixed with ACN in a ratio 94:6. The run time was a total of 12 minutes with acetyl-coA eluting at 8.5 mins and coenzyme A eluting at 3.9 minutes. A diode array detector (Agilent) was used for the detection of the molecule of interest at 259 nm.
(44) 2.6 Optimization of Hydroxymethylglutaryl-CoA synthase (HMGS): HMGS was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert acetoacetyl CoA to HMG-CoA. The reaction solution (50 mM Tris 100 mM NaCl, 5 mM MgCl.sub.2 pH 7.5, 5 mM acetoacetyl CoA) was mixed with 0.5 ?M immobilized enzyme at 32? C. for 2 hours. After 2 hours, the reaction solution was incubated with 20.7 ?M HMGR and 5 mM NADPH. HMGR is used to convert NADPH into NADP+ and thus reaction performance can be monitored at 340 nm. The coupled reaction was able to convert 54% of the starting material to mevalonic acid (2.7 mM or 416 mg/L). The activity of HMGR was measured by monitoring the loss of NADPH at 340 nm using a spectrophotometer.
(45) 2.7 Optimization of Hydroxymethylglutaryl-CoA reductase (HMGR): HMGR was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert NADPH into NADP+. The reaction solution (50 mM Tris, 100 mM NaCl, 5 mM MgCl.sub.2 pH 7.0, 5 mM NADPH) was mixed with 0.4 ?M immobilized enzyme at 32? C. for 2 hours. Immobilized HMGR was able to convert 98% of 5 mM (nicotinamide adenine dinucleotide phosphate (NADPH) for a yield of 4.9 mM NADP+ which is equimolar to mevalonic acid produced in the reaction (4.9 mM or 755 mg/L). The activity of HMGR was measured by monitoring the loss of NADPH at 340 nm using a spectrophotometer.
(46) 2.8 Optimization of Mevalonate Kinase (MVK): MVK was mixed with macroporous polymethacrylate resin and the immobilized enzyme was used to convert mevalonic acid into mevalonic acid-5-phosphate. Reaction solution (50 mM Tris, 5 mM MgCl.sub.2, pH 8, 4 mM ATP, 4 mM mevalonic acid) was mixed with 133 ?M immobilized enzyme at 37? C. for 8 hours. Immobilized MVK was able to convert 79% of 4 mM ATP for a yield of 3.16 mM (1.68 g/L) ADP. For sampling, the reaction mixture was examined on an HPLC system to examine the amount of adenosine triphosphate (ATP) and adenosine diphosphate (ADP). The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a HYPERSIL ODS COLUMN 150 mm?3 mm equipped with a BetaSil C18 20 mm?2.1 mm guard column. The column was heated to 25? C. with the sample block being maintained at 4? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 100 mM KH.sub.2PO.sub.4 (potassium dihydrogen phosphate), 8 mM TBAHS (tetrabutylammonium hydrogen sulfate), pH 6.0, 20% methanol (v/v). The run time was a total of 10 minutes with ATP eluting at 5.7 mins and ADP eluting at 4.6 minutes. A diode array detector (Agilent) was used for the detection of the molecule of interest at 254 nm.
(47) 2.9 Optimization of Phosphomevalonate Kinase (PMVK): PMVK was mixed with amino C.sub.6 methacrylate resin and the immobilized enzyme was used to convert mevalonic acid-5-phosphate into mevalonic acid-5-pyrophosphate. The reaction solution (50 mM Tris, 5 mM MgCl.sub.2, pH 8, 4 mM ATP, 4 mM mevalonic acid-5-phosphate) was mixed with 160 ?M immobilized enzyme at 37? C. for 32 hours. Immobilized MVK was able to convert 96% of 4 mM ATP for a yield of 3.84 mM (1.79 g/L) ADP. For sampling, the reaction fluid was examined on an HPLC system to examine the amount of ATP and ADP. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a HYPERSIL ODS COLUMN 150 mm?3 mm equipped with a BetaSil C18 20 mm?2.1 mm guard column. The column was heated to 25? C. with the sample block being maintained at 4? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 100 mM KH.sub.2PO.sub.4, 8 mM TBAHS, pH 6.0, 20% methanol (v/v). The run time was a total of 10 minutes with ATP eluting at 5.7 mins and ADP eluting at 4.6 minutes. A diode array detector (Agilent) was used for the detection of the molecule of interest at 254 nm.
(48) 2.10 Optimization of Diphosphomevalonate Kinase (MDC): MDC was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert mevalonic acid-5-pyrophosphate into isopentenyl pyrophosphate. Reaction solution (50 mM Tris, 5 mM MgCl.sub.2, pH 8, 4 mM ATP, 4 mM mevalonic acid-5-pyrophosphate) was mixed with 160 ?M immobilized enzyme at 37? C. for 32 hours. Immobilized MVK was able to convert 94% of 2 mM ATP for a yield of 1.8 mM (839 mg/L) ADP. For sampling, the reaction fluid was examined on an HPLC system to examine the amount of ATP and ADP. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a HYPERSIL ODS COLUMN 150 mm?3 mm equipped with a BetaSil C18 20 mm?2.1 mm guard column. The column was heated to 25? C. with the sample block being maintained at 4? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 100 mM KH.sub.2PO.sub.4, 8 mM TBAHS, pH 6.0, 20% methanol (v/v). The run time was a total of 10 minutes with ATP eluting at 5.7 mins and ADP eluting at 4.6 minutes. A diode array detector (DAD) was used for the detection of the molecule of interest at 254 nm.
(49) 2.11 Optimization of Isopentenyl-diphosphate Delta-isomerase (IDI): IDI was mixed with macroporous polymethacrylate resin and the immobilized enzyme was used to convert isopentenyl pyrophosphate (IPP) into dimethylallyl pyrophosphate (DMAPP). The reaction solution (50 mM Tris pH 8, 5 mM MgCl.sub.2, 10 mM NaCl, 0.24 mM IPP) was mixed with 86 ?M immobilized enzyme at 25? C. for 2 hours. Then, the reaction mixture was incubated with 0.24 mM olivetolic acid, 85 ?M NphB, and 29.7 ?M FPPS for 2 hours. Completed reactions were extracted 3? with ethyl acetate, evaporated, and then resuspended in methanol for analysis on an HPLC system to examine the amount of CBGA present in the reaction mixture. The coupled reaction was able to convert 28% of the starting material to 21.3 mg/L of the product. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 250 mm?4.6 mm, 5 ?m liChrospher RP8 column equipped with a guard column. The column was heated to 30? C. with the sample block being maintained at 25? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 25% buffer A (water, 0.1% formic acid, 5 mM ammonium formate) and 75% buffer B (acetonitrile, 0.1% formic acid, 5 mM ammonium formate). CBGA produced in the reaction was measured using DAD at 228 nm. The run time was a total of 10 minutes with CBGA eluting at 3.68 mins.
(50) 2.12 Optimization of Polyprenyl synthetase family protein (FPPS): FPPS was mixed with macroporous polymethacrylate resin and the immobilized enzyme was used to convert isopentenyl pyrophosphate (IPP) and dimethylallyl pyrophosphate (DMAPP) into geranyl pyrophosphate (GPP). The reaction solution (50 mM Tris pH 8, 5 mM MgCl.sub.2, 10 mM NaCl, 0.24 mM IPP, 0.24 mM DMAPP, 0.24 mM olivetolic acid (OA)) and 120 ?M NphB protein was mixed with 86 ?M immobilized enzyme at 25? C. for 4 hours. Immobilized FPPS was able to convert 81% of 240 ?M IPP and 240 ?M DMAPP for a yield of 195 ?M GPP. Analysis of GPP production is coupled to the activity of the prenyltransferase (NphB) that combines GPP and olivetolic acid to produce CBGA. Completed reactions were extracted 3? with ethyl acetate, evaporated, and resuspended in methanol for analysis on an HPLC system to examine the amount of CBGA present in the reaction mixture. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 250 mm?4.6 mm, 5 ?m LiChrospher RP8 column equipped with a guard column. The column was heated to 30? C. with the sample block being maintained at 25? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic mobile phase comprised of 25% buffer A (water, 0.1% formic acid, 5 mM ammonium formate) and 75% buffer B (acetonitrile, 0.1% formic acid, 5 mM ammonium formate). The coupled reaction yielded cannabigerolic acid (CBGA) at 129.6 ?M or 41 mg/L. CBGA produced in the reaction was measured using DAD at 228 nm. The run time was a total of 10 minutes with CBGA eluting at 3.68 mins.
(51) 2.13 Optimization of Polyphosphate kinase 2 (PPK2): PPK2 was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert ADP into ATP to recycle this cofactor. Reaction solution (10 mM Tris pH 9, 10 mM MgCl.sub.2, 10 mM NaCl, 5.0 mM poly-phosphate, 5.0 mM ADP) was mixed with 95 ?M immobilized enzyme at 37? C. for 1 hour. Immobilized PPK2 was able to convert 5.0 mM ADP for a yield of 5.0 mM ATP (100%, 2.5 g/L). For sampling, the reaction fluid was examined on an HPLC system to examine the amount of ATP and ADP present in the reaction mixture. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a HYPERSIL ODS Column 150 mm?3 mm equipped with a BetaSil C18 20 mm?2.1 mm guard column. The column was heated to 25? C. with the sample block being maintained at 4? C. For each sample, 5 ?L was injected and an isocratic mobile phase comprised of 100 mM KH.sub.2PO.sub.4, 8 mM TBAHS, pH 6.0, 20% methanol. The run time was a total of 10 minutes with ATP eluting at 5.7 mins and ADP eluting at 4.6 minutes. A diode array detector (DAD) was used for the detection of the molecule of interest at 254 nm.
(52) 2.14 Optimization of Glucose Dehydrogenase (GDH): GDH was mixed with epoxy methacrylate resin and the immobilized enzyme was used to convert NADP+ into NADPH to recycle this essential cofactor. The reaction solution (50 mM Tris pH 9, 20 mM glucose, 5.0 mM NADP+) was mixed with 200 ?M immobilized enzyme at 22? C. for 15 minutes. Immobilized GDH was able to convert 5.0 mM NADP+ to yield 5.0 mM NADPH (100%, 3.7 g/L). The activity of GDH was detected by measuring the NADPH concentration of the reaction solution with a plate reader at 340 nm.
(53) TABLE-US-00003 TABLE2 EnzymeSequences: Enzyme: Sequence: SEQIDNO: MaltoseBinding KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPD 1 ProteinAlditol KLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPD oxidase(MPB-ALDO) KAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLP Streptomyces NPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAAD coelicolorA3 GGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMN Accession: ADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTV WP_011030685 LPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTD EGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGE IMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRIT KGENLYFQGGMASMTGGQQMGRGSGMSDITVTNWAGNITYT AKELLRPHSLDALRALVADSARVRVLGSGHSFNEIAEPGDG GVLLSLAGLPSVVDVDTAARTVRVGGGVRYAELARVVHARG LALPNMASLPHISVAGSVATGTHGSGMGNGSLASMVREVEL VTADGSTVVIARGDERFGGAVTSLGALGVVTSLTLDLEPAY EMEQHVFTELPLAGLDPATFETVMAAAYSVSLFTDWRAPGF RQVWLKRRTDRPLDGFPYAAPATEKMHPVPGMPAVNCTEQF GVPGPWHERLPHFRAEFTPSSGAELQSEYLMPREHALAALH AMDAIRETLAPVLQTCEIRTVAADAQWLSPAYGRDTVAAHF TWVEDTAAVLPVVRRLEEALVPFAARPHWGKVFTVPAGELR ALYPRLADFGALARALDPAGKFTNAFVRGVLAG Dihydroxy-acid MAENWRSRIITEGVQRTPNRAMLRAVGFGDEDFNKPIVGVA 2 dehydratase(DHAD) SAHSTITPCNMGIAALASRAEAGIRAAGGMPQLFGTITVSD Thermosynechococcus GISMGTEGMKYSLVSRDVIADSIETVCNAQSMDGVLAIGGC vulcanus DKNMPGAMIAMARMNIPAIFVYGGTIKPGHWQGQDLTVVSA Accession: FEAVGQFSAGKMDEATLHAIEHHACPGAGSCGGMFTANTMS WP_126985616 SAFEAMGMSLMYSSTMTAEDAEKADSTELAGKVLVEAIRKN IRPRDIITRKSIENAISVIMAVGGSTNAVLHFLAIAHSAEV PLTIDDFETIRQRVPVLCDLKPSGKYVTADLHRAGGIPQVM KMLLNAGLLHGDCLTITGETIAERLRHVPDTPDPNQDVIRP FDQPLYATGHLAILKGNLASEGAVAKISGVKNPQITGPARV FDSEEACLDAILAGKINPGDVIVIRYEGPVGGPGMREMLAP TSAIIGAGLGDSVGLITDGRFSGGTYGMVVGHVAPEAAVGG TIALVQEGDSITIDAHRRLLQLNVSEEELAARRAKWQPPAP RYTRGVLAKYAKLVSSSSLGAVTDRFV Phosphate MTTDLFTALKAKVTGTARKIVFPEGTDDRILTAASRLATEQ 3 acetyltransferase VLQPIVLGDEQAIRVKAAALGLPLEGVEIVNPRRYGGFDEL (PTA) VSAFVERRKGKVTEETARELLFDENYFGTMLVYMGAADGLV Geobacillus SGAAHSTADTVRPALQIIKTKPGVDKTSGVFIMVRGDEKYV stearothermophilus FADCAINIAPNSHDLAEIAVESARTAKMFGLKPRVVLLSFS Accession: TKGSASSPETEKVVEAVRLAKEMAPDLILDGEFQFDAAFVP WP_053532564 EVAKKKAPDSVIQGDANVFIFPSLEAGNIGYKIAQRLGGFE AVGPILQGLNKPVNDLSRGCSAEDAYKLALITAAQSLGE Acetyl-CoAC- MTDVVIVSAARTAVGKFGGSLAKIPAPELGAVVIKAALERA 4 acetyltransferase GVKPEQVSEVIMGQVLTAGSGQNPARQAAIKAGLPAMVPAM (PhaA) TINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMSAAPH Multispecies VLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENV Cupriavidus AKEYGITREAQDEFAVGSQNKAEAAQKAGKFDEEIVPVLIP Accession: QRKGDPVAFKTDEFVRQGATLDSMSGLKPAFDKAGTVTAAN WP_010810132 ASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAGVDPK VMGMGPVPASKRALSRAEWTPQDLDLMEINEAFAAQALAVH QQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMKRR DAKKGLASLCIGGGMGVALAVERK Hydroxymethyl- MTIGIDKISFFVPPYYIDMTALAEARNVDPGKFHIGIGQDQ 5 glutaryl-CoA MAVNPISQDIVTFAANAAEAILTKEDKEAIDMVIVGTESSI synthase DESKAAAVVLHRLMGIQPFARSFEIKEGCYGATAGLQLAKN (HMGS_A110G) HVALHPDKKVLVVAADIAKYGLNSGGEPTQGAGAVAMLVAS Enterococcus EPRILALKEDNVMLTQDIYDFWRPTGHPYPMVDGPLSNETY faecalis IQSFAQVWDEHKKRTGLDFADYDALAFHIPYTKMGKKALLA Accession: KISDQTEAEQERILARYEESIIYSRRVGNLYTSSLYLGLIS WP_010785222 LLENATTLTAGNQIGLFSYGSGAVAEFFTGELVAGYQNHLQ KETHLALLDNRTELSIAEYEAMFAETLDTDIDQTLEDELKY SISAINNTVRSYRN Hydroxymethyl- MKTVVIIDALRTPIGKYKGSLSQVSAVDLGTHVTTQLLKRH 6 glutaryl-CoA STISEEIDQVIFGNVLQAGNGQNPARQIAINSGLSHEIPAM reductase TVNEVCGSGMKAVILAKQLIQLGEAEVLIAGGIENMSQAPK (HMGR) LQRFNYETESYDAPFSSMMYDGLTDAFSGQAMGLTAENVAE Enterococcus KYHVTREEQDQFSVHSQLKAAQAQAEGIFADEIAPLEVSGT faecalis LVEKDEGIRPNSSVEKLGTLKTVFKEDGTVTAGNASTINDG Accession: ASALIIASQEYAEAHGLPYLAIIRDSVEVGIDPAYMGISPI WP_002361742 KAIQKLLARNQLTTEEIDLYEINEAFAATSIVVQRELALPE EKVNIYGGGISLGHAIGATGARLLTSLSYQLNQKEKKYGVA SLCIGGGLGLAMLLERPQQKKNSRFYQMSPEERLASLLNEG QISADTKKEFENTALSSQIANHMIENQISETEVPMGVGLHL TVDETDYLVPMATEEPSVIAALSNGAKIAQGFKTVNQQRLM RGQIVFYDVADAESLIDELQVRETEIFQQAELSYPSIVKRG GGLRDLQYRAFDESFISVDFLVDVKDAMGANIVNAMLEGVA ELFREWFAEQKILFSILSNYATESVVTMKTAIPVSRLSKGS NGREIAEKIVLASRYASLDPYRAVTHNKGIMNGIEAVVLAT GNDTRAVSASCHAFAVKEGRYQGLTSWTLDGEQLIGEISVP LALATVGGATKVLPKSQAAADLLAVTDAKELSRVVAAVGLA QNLAALRALVSEGIQKGHMALQARSLAMTVGATGKEVEAVA QQLKRQKTMNQDRALAILNDLRKQ MevalonateKinase MLKFSKIEKLLRNNMVSCSAPGKIYLFGEHAVVYGETAIAC 7 (MVK) AVELRTRVRAELNDSITIQSQIGRTGLDFEKHPYVSAVIEK Methanosarcina MRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNEL mazeiTuc01 FGFGLSLQEIAKLGHEIElKVQGAASPTDTYVSTFGGVVTI Accession: PERRKLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDL AGF97182 IEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGLLDAL GVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTAPEK CNQVAEAIAGAGGKVTITKPTEQGLKVD Phosphomevalonate MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFS 8 Kinase(PMVK) DSYRIYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQ Streptococcus NLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYN pneumoniae LSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQS Accession: FDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVG WP_000562411 WTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQG KSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAV AKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQER IGHDDKS Diphosphomevalonate MYHSLGNQFDTRTRTSRKIRRERSCSDMDREPVTVRSYANI 9 Kinase(MDC) AIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANV Streptococcus TADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQN pneumoniaeR6 NMPTAAGLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAKF Accession: ASGSSSRSFYGPLGAWDKDSGEIYPVETDLKLAMIMLVLED AAK99143 KKKPISSRDGMKLCVETSTTFDDVVVRQSEKDYQDMLIYLK ENDFAKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMD FVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIFGQR YRLIVSKTKDLSQDDCC Isopentenyl- MQTEHVILLNAQGVPTGTLEKYAAHTADTRLHLAFSSWLFN 10 diphosphateDelta- AKGQLLVTRRALSKKAWPGVWTNSVCGHPQLGESNEDAVIR isomerase(IDI) RCRYELGVEITPPESIYPDFRYRATDPSGIVENEVCPVFAA Multispecies RTTSALQINDDEVMDYQWCDLADVLHGIDATPWAFSPWMVM Bacteria QATNREARKRLSAFTQLK Accession: WP_001192820 Polyprenyl MAQLSVEQFLNEQKQAVETALSRYIERLEGPAKLKKAMAYS 11 synthetasefamily LEAGGKRIRPLLLLSTVRALGKDPAVGLPVACAIEMIHTYF protein(FPPSS82F) LIHDDLPSMDNDDLRRGKPTNHKVFGEAMAILAGDGLLTYA Geobacillus FQLITEIDDERIPPSVRLRLIERLAKAAGPEGMVAGQAADM stearothermophilus EGEGKTLTLSELEYIHRHKTGKMLQYSVHAGALIGGADARQ Accession: TRELDEFAAHLGLAFQIRDDILDIEGAEEKIGKPVGSDQSN WP_033016440 NKATYPALLSLAGAKEKLAFHIEAAQRHLRNADVDGAALAY ICELVAARDH Polyphosphate MALDEAPAEARPGSRAVELEIDGRSRIFDIDDPDLPKWIDE 12 kinse2(PPK2) EAFRSDDYPYKKKLDREEYEETLTKLQIELVKVQFWMQATG Rhizobacteria KRVMAVFEGRDAAGKGGAIHATTANMNPRSARVVALTKPTE Accession: TERGQWYFQRYVATFPTAGEFVLFDRSWYNRAGVEPVMGFC WP_010968631 TPDQYEQFLKEAPRFEEMIANEGIHLFKFWINIGREMQLKR FHDRRHDPLKIWKLSPMDIAALSKWDDYTGKRDRMLKETHT EHGPWAVIRGNDKRRSRINVIRHMLTKLDYDGKDEAAIGEV DEKILGSGPGFLR Glucose MYSDLEGKWVITGSASGLGRAMGVRFAREKAKWINYRSRES 13 Dehydrogenase EANDVLEEIKKVGGEAIAVKGDVTVESDVVNLIQSAVKEFG (GDH) TLDVMINNAGIENAVPSHEMPLEDWNRVINTNLTGAFLGSR Bacillussp.G3 EAIKYFVEHDIKGSVINMSSVHEKIPWPLFVHYAASKGGMK Accession: LMTETLAMEYAPKGIRVNNIGPGAINTPINAEKFADPKKRA GQ402830.1 DVESMIPMGYIGKPEEIAAVATWLASSEASYVTGITLFADG GMTLYPSFQAGRG *Note: Pyruvate Oxidase (PyOx, Aerococcus viridans) was purchased from AG Scientific, product P-1600.
(54) 3.0 Use of all immobilized Enzymes to create GPP from glycerol: After demonstrating generation of GPP from glycerol with free enzymes, and also demonstrating that all of the required individual enzymes are active when immobilized, the next aim was to generate GPP from glycerol using immobilized enzymes. Each enzyme was immobilized onto 10 mg of resin as listed in Table 3. Purified enzymes were mixed with resin for 18 hours at 21? C. and immobilized enzymes were pooled into a single tube.
(55) TABLE-US-00004 TABLE 3 Specifics for immobilized enzyme batch reactions. Amount Enzyme Name (mg) Resin MBP-Aldo (Aldo) 0.5 Amino C.sub.6 methacrylate Dihydroxy Acid Dehydratase (DHAD) 0.5 Amino C.sub.6 methacrylate Pyruvate Oxidase (PyOx) 0.25 Amino C.sub.6 methacrylate Acetyl-phosphate transferase (PTA) 0.15 Epoxy methacrylate Acetyl-CoA acetyltransferase (PhaA) 0.1 Epoxy methacrylate HMG-CoA Synthase A110G (HMGS) 0.15 Epoxy methacrylate HMG-CoA Reductase (HMGR) 0.4 Epoxy methacrylate Mevalonate Kinase (MVK) 0.2 Macroporous polymethacrylate Phosphomevalonate Kinase (PMVK) 0.2 Amino C.sub.6 methacrylate Diphosphomevalonate Kinase (MDC) 0.4 Epoxy methacrylate Isopentyl-PP Isomerase (IDI) 0.35 Macroporous polymethacrylate Farnesyl-PP synthase S82F (FPPS) 0.2 Macroporous polymethacrylate Prenyl Transferase (NphB) 0.2 Macroporous polymethacrylate
(56) For this multi-step reaction, the first three enzymes (Aldo, DHAD, and PyOX) were first added sequentially into the batch reactor. First, immobilized MBP-Aldo was added to reaction solution (50 mM Tris pH 9, 2.5 mM MgCl.sub.2, 10 mM glycerol) for 18 h at 37? C. Next, immobilized DHAD was added to the reaction solution and incubated for 18 h at 45? C. The supernatant was removed from the immobilized enzymes, and the reaction solution was adjusted to contain 50 mM NaCl, 20 mM potassium phosphate (pH 6.5), 10 mM thiamine pyrophosphate, and finally, the pH of the reaction solution was adjusted to pH 6.0. Immobilized PyOx was then added to the reaction solution for 16 h at 37? C. The supernatant was then removed from immobilized enzyme and the reaction solution was adjusted to contain 50 mM Tris, 20 mM potassium phosphate, 2.5 mM MgCl.sub.2, 50 mM NaCl, 10 mM NADPH, 10 mM ATP, 10 mM CoA, 4 mM olivetolic acid, and pH 8.0 for a final volume of 1.0 mL. The remaining ten immobilized enzymes in this pathway were added to the reaction mixture. The reactions were carried out for five days at 37? C. and were then extracted ethyl acetate (2?200 ?L), evaporated under reduced pressure, and resuspended in methanol (1 mL) for analysis on a HPLC system to examine the amount of CBGA present in the reaction mixture. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 250 mm?4.6 mm, 5 ?m liChrospher RP8 column equipped with a guard column. The column was heated to 30? C. with the sample block being maintained at 25? C. HPLC method comprised of 5 ?l sample injection volume and an isocratic gradient comprised of 25% buffer A (water, 0.1% formic acid, 5 mM ammonium formate) and 75% buffer B (acetonitrile, 0.1% formic acid, 5 mM ammonium formate) was used as the mobile phase. The reaction yielded cannabigerolic acid (CBGA) at 155 ?M or 49 mg/L (
(57) 4.0 Use of Immobilized Enzymes to create GPP from Glycerol with Cofactors (ATP and NADPH recycling): In addition to demonstrating the immobilized glycerol to GPP pathway success, the recycling of two common cofactors (ATP and NADPH) in the reaction was achieved. The immobilized enzyme composition shown in Table 4 was used in the reaction.
(58) TABLE-US-00005 TABLE 4 Specifics for immobilized cofactor recycling enzymes for batch reactions. Amount Enzyme Name (mg) Resin Polyphosphate kinase 2 (PPK2) 0.1 Epoxy methacrylate Glucose dehydrogenase (GDH) 0.1 Epoxy methacrylate MBP-Aldo (Aldo) 0.5 Amino C.sub.6 methacrylate Dihydroxy Acid Dehydratase (DHAD) 0.5 Amino C.sub.6 methacrylate Pyruvate Oxidase (PyOx) 0.25 Amino C.sub.6 methacrylate Acetyl-phosphate transferase (PTA) 0.15 Epoxy methacrylate Acetyl-CoA acetyltransferase (PhaA) 0.1 Epoxy methacrylate HMG-CoA Synthase A110G (HMGS) 0.15 Epoxy methacrylate HMG-CoA Reductase (HMGR) 0.4 Epoxy methacrylate Mevalonate Kinase (MVK) 0.2 Macroporous polymethacrylate Phosphomevalonate Kinase (PMVK) 0.2 Amino C.sub.6 methacrylate Diphosphomevalonate Kinase (MDC) 0.4 Epoxy methacrylate lsopentyl-PP Isomerase (IDI) 0.35 Macroporous polymethacrylate Farnesyl-PP synthase S82F (FPPS) 0.2 Macroporous polymethacrylate Prenyl Transferase (NphB) 0.2 Macroporous polymethacrylate
(59) For this multi-step reaction, the first three enzymes (Aldo, DHAD, and PyOX) were first added sequentially into the batch reactor. First, immobilized MBP-Aldo was added to reaction solution (50 mM Tris pH 9, 2.5 mM MgCl.sub.2, 10 mM glycerol) for 18 h at 37? C. Next, immobilized DHAD was added to the reaction solution and incubated for 18 h at 45? C. The supernatant was removed from the immobilized enzymes, and the reaction solution was adjusted to contain 50 mM NaCl, 20 mM potassium phosphate (pH 6.5), 10 mM thiamine pyrophosphate, and finally, the pH of the reaction solution was adjusted to pH 6.0. Immobilized PyOx was then added to the reaction solution for 16 h at 37? C. The supernatant was then removed from immobilized enzyme and the reaction solution was adjusted to contain 50 mM Tris, 20 mM potassium phosphate, 2.5 mM MgCl.sub.2, 50 mM NaCl, 10 mM NADPH, 10 mM ATP, 10 mM CoA, 4 mM olivetolic acid, and pH 8.0 for a final volume of 1.0 mL. The remaining 12 enzymes (as shown in Table 4) were added to a reaction solution of 50 mM Tris, 20 mM potassium phosphate, 2.5 mM MgCl.sub.2, 50 mM NaCl, 3.3 mM NADPH, 3.3 mM ATP, 5.0 mM poly-phosphate, 5.0 mM glucose 10 mM CoA, 4 mM olivetolic acid and pH 8.0 in a final volume of 1.0 mL. Batch reactions continued for 5 days at 37? C. and were then extracted with ethyl acetate (3?200 ?L), evaporated under reduced pressure, and resuspended in methanol (1 mL) for analysis on a HPLC system to examine the amount of CBGA present in the reaction mixture. The HPLC method was as follows: An Agilent 1200 HPLC was fitted with a 250 mm?4.6 mm, 5 ?m liChrospher RP8 column equipped with a guard column. The column was heated to 30? C. with the sample block being maintained at 25? C. The HPLC method comprised of a 5 ?l sample injection volume and a mobile phase comprised of 25% buffer A (water, 0.1% formic acid, 5 mM ammonium formate) and 75% buffer B (acetonitrile, 0.1% formic acid, 5 mM ammonium formate). The reaction yielded cannabigerolic acid (CBGA) at 114 ?M or 36 mg/L. CBGA produced in the reaction was measured using DAD at 228 nm. The run time was a total of 10 minutes with CBGA eluting at 3.68 mins.
EMBODIMENTS
(60) The following embodiments are intended to be illustrative only and not to be limiting in any way.
(61) Embodiment 1: A method of converting glycerol to geranyl pyrophosphate (GPP) and additional secondary metabolites, the method comprising (a) adding glycerol to a reaction mixture; (b) adding a plurality of enzymes to the reaction mixture from (a), wherein the enzymes are selected from a group consisting of alditol oxidase (Aldo), dihydroxy-acid dehydratase (DHAD), pyruvate oxidase (PyOx), acetyl-phosphate transferase (PTA), acetyl-CoA acetyltransferase (PhaA), HMG-CoA Synthase A110G (HMGS), HMG-CoA Reductase (HMGR), mevalonate kinase (MVK), phosphomevalonate kinase (PMVK), diphosphomevalonate kinase (MDC), isopentyl-PP Isomerase (IDI), and farnesyl-PP synthase S82F (FPPS); (c) removing a supernatant from the reaction mixture from (b); and isolating or producing GPP.
(62) Embodiment 2: The method of embodiment 1, wherein at least two enzymes are added to the reaction mixture.
(63) Embodiment 3: The method of embodiment 1 or embodiment 2, wherein at least five enzymes are added to the reaction mixture.
(64) Embodiment 4: The method of any one of embodiments 1-3, wherein at least ten enzymes are added to the reaction mixture.
(65) Embodiment 5: The method of any one of embodiments 1-4, further comprising adding a NphB enzyme to step (b) to convert GPP to (cannabigerolic acid) CBGA
(66) Embodiment 6: The method of embodiment 5, wherein the conversion of GPP to CBGA is used to determine the amount of GPP produced from the method.
(67) Embodiment 7: The method of any one of embodiments 1-6, wherein the reaction mixture comprises co-factors.
(68) Embodiment 8: The method of embodiment 7, wherein the cofactors are adenosine triphosphate (ATP), nicotinamide adenine dinucleotide (NAD.sup.+), nicotinamide adenine dinucleotide phosphate (NADP.sup.+), or a combination thereof.
(69) Embodiment 9: The method of embodiment 7 or embodiment 8, wherein the cofactor are recycled.
(70) Embodiment 10: The method of embodiment 9, wherein glucose dehydrogenase (GDH), and polyphosphate kinase 2 (PPK2) are added to the reaction mixture to recycle the co-factors.
(71) Embodiment 11: The method of claim any one of embodiments 1-10, wherein one or more of the enzymes are immobilized.
(72) Embodiment 12: The method of claim any one of embodiments 1-10, wherein the plurality of enzymes are immobilized
(73) Embodiment 13: The method of claim any one of embodiments 1-10, wherein one or more of the enzymes are non-immobilized.
(74) Embodiment 14: The method of claim any one of embodiments 1-10, wherein the plurality of enzymes are non-immobilized.
(75) Embodiment 15: A method of converting glycerol to geranyl pyrophosphate (GPP) and additional secondary metabolites, the method comprising (a) adding glycerol and alditol oxidase (Aldo) to a reaction mixture; (b) adding dihydroxy-acid dehydratase (DHAD) to the reaction mixture from (a); (c) removing a supernatant of the reaction mixture from (b); (d) adding pyruvate oxidase (PyOx) to the supernatant of the reaction mixture from (c); (e) removing a supernatant of the reaction mixture from (d); (f) adding at least two enzymes selected from a group consisting of acetyl-phosphate transferase (PTA), acetyl-CoA acetyltransferase (PhaA), HMG-CoA Synthase A110G (HMGS), HMG-CoA Reductase (HMGR), mevalonate kinase (MVK), phosphomevalonate kinase (PMVK), diphosphomevalonate kinase (MDC), isopentyl-PP Isomerase (IDI), farnesyl-PP synthase S82F (FPPS), and prenyl transferase (NphB) to the supernatant of the reaction mixture from (e); (g) removing a supernatant from the reaction mixture from (f); and (h) isolating GPP.
(76) Embodiment 16: The method of embodiment 15 further comprising adding a NphB enzyme to step (f) to convert GPP to (cannabigerolic acid) CBGA.
(77) Embodiment 17: The method of embodiment 16, wherein the conversion of GPP to CBGA is used to determine the amount of GPP produced from the method.
(78) Embodiment 18: The method of any one of embodiments 15-17, wherein the reaction mixture comprises co-factors.
(79) Embodiment 19: The method of embodiment 18, wherein the cofactors are adenosine triphosphate (ATP), nicotinamide adenine dinucleotide (NAD.sup.+), nicotinamide adenine dinucleotide phosphate (NADP.sup.+), or a combination thereof.
(80) Embodiment 20: The method of embodiment 17 or embodiment 18, wherein the cofactor are recycled.
(81) Embodiment 21: The method of embodiment 20, wherein glucose dehydrogenase (GDH), and polyphosphate kinase 2 (PPK2) are added to the reaction mixture to recycle the co-factors.
(82) Embodiment 22: The method of claim any one of embodiments 15-21, wherein one or more of the enzymes are immobilized.
(83) Embodiment 23: The method of claim any one of embodiments 15-21, wherein the plurality of enzymes are immobilized
(84) Embodiment 24: The method of claim any one of embodiments 15-21, wherein one or more of the enzymes are non-immobilized.
(85) Embodiment 25: The method of claim any one of embodiments 15-21, wherein the plurality of enzymes are non-immobilized.
(86) As used herein, the term about refers to plus or minus 10% of the referenced number.
(87) Although there has been shown and described the preferred embodiment of the present invention, it will be readily apparent to those skilled in the art that modifications may be made thereto which do not exceed the scope of the appended claims. Therefore, the scope of the invention is only to be limited by the following claims. In some embodiments, the figures presented in this patent application are drawn to scale, including the angles, ratios of dimensions, etc. In some embodiments, the figures are representative only and the claims are not limited by the dimensions of the figures. In some embodiments, descriptions of the inventions described herein using the phrase comprising includes embodiments that could be described as consisting essentially of or consisting of, and as such the written description requirement for claiming one or more embodiments of the present invention using the phrase consisting essentially of or consisting of is met.