RADIOLIGAND BINDING TO ANTI-DLL3 ANTIBODIES FOR PRETARGETED PET IMAGING AND THERAPEUTIC USES THEREOF
20240216557 ยท 2024-07-04
Assignee
- Memorial Sloan-Kettering Cancer Center (New York, NY, US)
- SLOAN-KETTERING INSTITUTE FOR CANCER RESEARCH (New York, NY, US)
- MEMORIAL HOSPITAL FOR CANCER AND ALLIED DISEASES (New York, NY, US)
- TRI-INSTITUTIONAL THERAPEUTICS DISCOVERY INSTITUTE, INC. (New York, NY, US)
Inventors
- John T. POIRIER (New York, NY, US)
- Charles Rudin (New York, NY)
- Jason LEWIS (New York, NY, US)
- Abdul KHAN (Cedar Park, TX, US)
- David Andrew (Sandyhook, CT, US)
- Xinlei CHEN (New York, NY, US)
- Ivo C. LORENZ (New York, NY, US)
- Kathryn M. Tully (New York, NY, US)
- Salomon Tendler (New York, NY, US)
Cpc classification
International classification
Abstract
The presently disclosed subject matter provides compositions and methods for in vivo diagnosis and treatment of diseases or disorders associated with DLL3. In particular, the presently disclosed subject matter provides novel anti-DLL3 antibodies-TCO conjugates, which can form a radioimmunoconjugate with a radioligand comprising a radioactive isotope.
Claims
1. An antibody-transcyclooctene (TCO) conjugate comprising an anti-DLL3 antibody or an antigen-binding fragment thereof comprising a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains; and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains, wherein the heavy chain variable region and light chain variable region CDR3 domains are selected from the group consisting of: a) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6 and a conservative modification thereof; b) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16 and a conservative modification thereof; c) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23 and a conservative modification thereof; d) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33 and a conservative modification thereof; e) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41 and a conservative modification thereof; f) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51 and a conservative modification thereof; g) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 and a conservative modification thereof; h) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65 and a conservative modification thereof; i) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75 and a conservative modification thereof; j) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 and a conservative modification thereof; k) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91 and a conservative modification thereof; l) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101 and a conservative modification thereof; m) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 and a conservative modification thereof; n) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112 and a conservative modification thereof; o) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118 and a conservative modification thereof; p) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 and a conservative modification thereof; q) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130 and a conservative modification thereof; r) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140 and a conservative modification thereof; s) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 and a conservative modification thereof; t) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 and a conservative modification thereof; u) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 and a conservative modification thereof; v) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162 and a conservative modification thereof; w) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171 and a conservative modification thereof; x) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179 and a conservative modification thereof; y) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189 and a conservative modification thereof; z) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196 and a conservative modification thereof; and aa) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204 and a conservative modification thereof.
2. The antibody-TCO conjugate of claim 1, wherein the heavy chain variable region and light chain variable region CDR2 domains are selected from the group consisting of: a) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; b) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15 and a conservative modification thereof; c) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32 and a conservative modification thereof; d) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; e) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 and a conservative modification thereof; f) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; g) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 and a conservative modification thereof; h) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; i) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210 and a conservative modification thereof; j) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 and a conservative modification thereof; k) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; l) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; m) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 and a conservative modification thereof; n) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; o) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139 and a conservative modification thereof; p) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146 and a conservative modification thereof; q) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 and a conservative modification thereof; and r) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170 and a conservative modification thereof; s) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 and a conservative modification thereof; t) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188 and a conservative modification thereof; u) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; and v) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof.
3. The antibody-TCO conjugate of claim 1 or claim 2, wherein the heavy chain variable region and light chain variable region CDR1 domains are selected from the group consisting of: a) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 and a conservative modification thereof; b) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14 and a conservative modification thereof; c) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 and a conservative modification thereof; d) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31 and a conservative modification thereof; e) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 and a conservative modification thereof; f) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 and a conservative modification thereof; g) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 and a conservative modification thereof; h) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 and a conservative modification thereof; i) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90 and a conservative modification thereof; j) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99 and a conservative modification thereof; k) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117 and a conservative modification thereof; l) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124 and a conservative modification thereof; m) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138 and a conservative modification thereof; n) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 and a conservative modification thereof; o) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 and a conservative modification thereof; p) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169 and a conservative modification thereof; q) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178 and a conservative modification thereof; r) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187 and a conservative modification thereof; s) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 and a conservative modification thereof; and t) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 and a conservative modification thereof.
4. The antibody-TCO conjugate of any one of claims 1-3, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; b) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13; c) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22; d) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; e) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; f) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; g) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; h) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64; i) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71 and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72; j) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81; k) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89; l) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98; m) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; n) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116; o) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; p) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137; q) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145; r) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152; s) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161; t) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168; u) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177; v) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186; w) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195; or x) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203.
5. The antibody-TCO conjugate of any one of claims 1-4, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6; b) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16; c) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23; d) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33; e) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41; f) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51; g) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; h) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65; i) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75; j) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; k) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210; and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91; l) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101; m) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112; n) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118; o) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; p) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130; q) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140; r) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; s) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; t) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162; u) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169, a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171; v) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179; w) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189; x) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196; or y) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204.
6. The antibody-TCO conjugate of any one of claims 1-5, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6; b) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 12, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16; c) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23; d) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33; e) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41; f) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51; g) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; h) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65; i) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75; j) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; k) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91; l) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101; m) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; n) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112; o) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118; p) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; q) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130; r) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140; s) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; t) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; u) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; v) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162; w) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171; x) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179; y) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 188; z) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196; or aa) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204.
7. The antibody-TCO conjugate of any one of claims 1-6, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6; b) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33; or c) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41.
8. The antibody-TCO conjugate of any one of claims 1-7, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205.
9. The antibody-TCO conjugate of any one of claims 1-8, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205.
10. The antibody-TCO conjugate of any one of claims 1-9, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
11. The antibody-TCO conjugate of any one of claims 1-10, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
12. The antibody-TCO conjugate of any one of claims 1-11, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205; and b) a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
13. The antibody-TCO conjugate of any one of claims 1-12, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205; and b) a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
14. The antibody-TCO conjugate of any one of claims 1-13, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8; b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 17, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 18; c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 24, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 25; d) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 34, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 35; e) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 42, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 43; f) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 52, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 53; g) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 60, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 61; h) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 66, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 67; i) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 76, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 77; j) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 83, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 84; k) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 92, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 93; l) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 102, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 103; m) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 108, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 109; n) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 108, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 113; o) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 120; p) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 126, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 127; q) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 132; r) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 141, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 142; s) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 147, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 148; t) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 153, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 154; u) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 157, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 158; v) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 163, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 164; w) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 172, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 173; x) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 180, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 181; y) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 190, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 191; z) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 197, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 198; or aa) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 205, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 206.
15. The antibody-TCO conjugate of any one of claims 1-14, comprising: a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8; b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 34, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 35; or c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 42, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 43.
16. The antibody-TCO conjugate of any one of claims 1-15, wherein the TCO has formula ##STR00007## and wherein R is N, C, or an ester.
17. The antibody-TCO conjugate of claim 16, wherein the TCO has formula ##STR00008##
18. A composition comprising the antibody-TCO conjugate of any one of claims 1-17.
19. The composition of claim 18, which is a pharmaceutical composition further comprising pharmaceutically acceptable carrier.
20. A radioimmunoconjugate comprising the antibody-TCO conjugate of any one of claims 1-17 and a radioligand comprising a tetrazine moiety (Tz) and a radiolabel.
21. The radioimmunoconjugate of claim 20, wherein the radiolabel comprises a radioactive isotope selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Rh, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra, and .sup.149Tb.
22. The radioimmunoconjugate of claim 20 or 21, wherein the radiolabel comprises a .sup.64Cu radioactive isotope.
23. The radioimmunoconjugate of claim 20 or 21, wherein the radiolabel comprises a .sup.225Ac radioactive isotope.
24. The radioimmunoconjugate of any one of claims 20-23, further comprising a chelator.
25. The radioimmunoconjugate of claim 24, wherein the chelator is a sarcophagine chelator.
26. The radioimmunoconjugate of claim 24, wherein the chelator is 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or 1,4,7-triazacyclononane-1,4-diacetate (NODA).
27. The radioimmunoconjugate of any one of claims 20-26, further comprising a linker attaching the tetrazine moiety (Tz) to the chelator.
28. The radioimmunoconjugate of claim 27, wherein the linker comprises is polyethylene glycol (PEG) or (poly)-L-lysine.
29. The radioimmunoconjugate of claim 28, wherein the polyethylene glycol (PEG) comprises from about 1 unit to about 100 units.
30. The radioimmunoconjugate of claim 28, wherein the (poly)-L-lysine comprises from about 1 unit to about 200 units.
31. The radioimmunoconjugate of any one of claims 24-30, wherein the tetrazine moiety (Tz) and the chelator form a compound selected from the group consisting of: a) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; b) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; c) 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; d) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; e) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; f) 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; g) 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; h) 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; i) 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; j) 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; k) 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; l) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and m) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
32. The radioimmunoconjugate of any one of claims 20-31, wherein the antibody-TCO conjugate and the radioligand bind together to form the radioimmunoconjugate via an in vivo click reaction.
33. A method of in vivo diagnosis of a disease or disorder associated with DLL3 in a subject, comprising: a) administering to the subject the antibody-TCO conjugate of any one of claims 1-17 or the composition of claim 18 or 19, wherein a portion of the antibody-TCO conjugate localizes at cells of the disease or disorder and unbound antibody-TCO conjugate is cleared from blood, from renal system, and/or from the subject after an accumulation interval, b) administering to the subject the a radioligand comprising a tetrazine moiety (Tz) and a radiolabel or a composition comprising the radioligand, wherein the antibody-TCO conjugate and the radioligand bind together to form a radioimmunoconjugate via an in vivo click reaction at the cells of the disease or disorder within a region of the subject; and c) imaging the radioimmunoconjugate accumulated in the region of the subject.
34. The method of claim 33, wherein the radioligand is delivered to the subject after the accumulation interval.
35. The method of claim 33 or 34, wherein the imaging occurs via positron emission tomography (PET).
36. The method of any one of claims 33-35, wherein the imaging occurs within a time period up to about 7 days from the administering of the radioligand.
37. The method of claim any one of claims 33-36, wherein the radiolabel comprises a radioactive isotope selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105R .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra and .sup.149Tb.
38. The method of claim any one of claims 33-37, wherein the radiolabel comprises a .sup.64Cu radioactive isotope.
39. The method of claim any one of claims 33-38, wherein the radiolabel comprises a .sup.18F radioactive isotope.
40. The method of any one of claims 33-39, wherein the radioligand further comprises a chelator.
41. The method of claim 40, wherein the chelator is a sarcophagine chelator.
42. The method of claim 40, wherein the chelator is 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or 1,4,7-triazacyclononane-1,4-diacetate (NODA).
43. The method of any one of claims 33-42, wherein the radioligand further comprises a linker attaching the tetrazine moiety (Tz) to the chelator.
44. The method of claim 43, wherein the linker comprises is polyethylene glycol (PEG) or (poly)-L-lysine.
45. The method of claim 44, wherein the polyethylene glycol (PEG) comprises from about 1 unit to about 100 units.
46. The method of claim 44, wherein the (poly)-L-lysine comprises from about 1 unit to about 200 units.
47. The method of any one of claims 33-46, wherein the tetrazine moiety (Tz) and the chelator form a compound selected from the group consisting of: a) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; b) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; c) 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; d) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; e) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; f) 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; g) 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; h) 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; i) 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; j) 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; k) 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; l) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and m) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
48. The method of any one of claims 33-47, wherein the imaging comprises detecting the radioactive levels emitted by the radioimmunoconjugate.
49. The method of claim 48, wherein the radioactive levels emitted by the radioimmunoconjugate are expressed as the percentage injected dose per gram tissue (% ID/g).
50. A method for treating a disease or disorder associated with DLL3 in a subject, comprising: a) administering to the subject the antibody-TCO conjugate of any one of claims 1-17 or the composition of claim 18 or 19, wherein a portion of the antibody-TCO conjugate localizes at cells of the disease or disorder and unbound antibody-TCO conjugate is cleared from blood, from renal system, and/or from the subject after an accumulation interval; and b) administering to the subject the a radioligand comprising a tetrazine moiety (Tz) and a radiolabel or a composition comprising the radioligand, wherein the antibody-TCO conjugate and the radioligand bind together to form a radioimmunoconjugate via an in vivo click reaction at the cells of the disease or disorder within a region of the subject, and wherein the radiolabel comprises a radioactive isotope selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, 90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Rh, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra and .sup.149Tb.
51. The method of claim 50, wherein the radioligand is delivered to the subject after the accumulation interval.
52. The method of claim 50 or 51, wherein the radioligand further comprises a chelator.
53. The method of claim 52, wherein the chelator is a sarcophagine chelator.
54. The method of claim 52, wherein the chelator is 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or 1,4,7-triazacyclononane-1,4-diacetate (NODA).
55. The method of any one of claims 50-54, wherein the radioligand further comprises a linker attaching the tetrazine moiety (Tz) to the chelator.
56. The method of claim 55, wherein the linker comprises is polyethylene glycol (PEG) or (poly)-L-lysine.
57. The method of claim 56, wherein the polyethylene glycol (PEG) comprises from about 1 unit to about 100 units.
58. The method of claim 56, wherein the (poly)-L-lysine comprises from about 1 unit to about 200 units.
59. The method of any one of claims 50-58, wherein the tetrazine moiety (Tz) and the chelator form a compound selected from the group consisting of: a) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; b) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; c) 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; d) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; e) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; f) 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; g) 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; h) 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; i) 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; j) 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; k) 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; l) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and m) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
60. The method of any one of claims 33-59, wherein the disease or disorder associated with DLL3 is a tumor.
61. The method of claim 60, wherein the tumor is a cancer.
62. The method of any one of claims 33-61, wherein the disease or disorder associated with DLL3 is selected from neuroendocrine tumors of the lung, extrapulmonary neuroendocrine carcinomas, melanoma, neuroendocrine prostate cancer, and breast cancer.
63. The method of claim 62, wherein the neuroendocrine tumors of the lung are selected from the group consisting of pulmonary neuroendocrine cancer, large cell neuroendocrine carcinoma, and small-cell lung cancer.
64. The method of any one of claims 33-63, wherein the subject is a human.
65. A kit for in vivo diagnosis and/or treatment of a disease or disorder associated with DLL3 in a subject, comprising the antibody-TCO conjugate of any one of claims 1-17 or the composition of claim 18 or 19, and a radioligand comprising a tetrazine moiety (Tz) and a radiolabel or a composition thereof.
66. The kit of claim 65, wherein the kit further comprises written instructions for using the antibody-TCO conjugate and the radioligand for in vivo diagnosis and/or treatment of a disease or disorder associated with DLL3 in a subject.
Description
4. BRIEF DESCRIPTION OF THE DRAWINGS
[0261] The following Detailed Description, given by way of example, but not intended to limit the invention to specific embodiments described, may be understood in conjunction with the accompanying drawings.
[0262]
[0263]
[0264]
[0265]
[0266]
[0267]
[0268]
5. DETAILED DESCRIPTION OF THE INVENTION
[0269] The presently disclosed subject matter relates generally to compositions and methods for in vivo diagnosis and treatment of diseases or disorders associated with DLL3. The presently disclosed subject matter provides novel anti-DLL3 antibodies-transcyclooctene (TCO) conjugates, which can form a radioimmunoconjugate with a radioligand comprising a radioactive isotope. The presently disclosed subject matter provides pretargeting strategies using anti-DLL3 antibody-TCO conjugates and radioligands comprising a radioactive isotope (e.g., a sarcophagine-based tetrazine) for radioimmunotherapy and pretargeted PET imaging with more rapid excretion of the excess radioligand through the bladder and kidneys. These strategies enable (i) targeted radioimmunotherapy, and (ii) delineation of cancer at earlier time points compared to other imaging strategies. Furthermore, these strategies decrease the radiation dose to healthy tissues compared to directly labeled antibodies.
[0270] The presently disclosed subject matter provides pretargeting strategies comprising two main components: the anti-DLL3 antibody-transcyclooctene conjugate (e.g., anti-DLL3 antibody-TCO conjugate) and the radioligand. In certain embodiments, the radioligand comprises a tetrazine. In certain embodiments, the tetrazine binds to the transcyclooctene via click chemistry reaction.
[0271] Non-limiting embodiments of the present disclosure are described by the present specification and Examples. For purposes of clarity of disclosure and not by way of limitation, the detailed description is divided into the following subsections: [0272] 5.1. Definitions; [0273] 5.2. Pretargeting Systems; [0274] 5.3. Pharmaceutical Compositions; and [0275] 5.4. Methods of Uses; [0276] 5.5. Kits; and [0277] 5.6. Exemplary Embodiments.
5.1. Definitions
[0278] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise.
[0279] In the description that follows, certain conventions will be followed as regards the usage of terminology. Generally, terms used herein are intended to be interpreted consistently with the meaning of those terms as they are known to those of skill in the art.
[0280] An antigen-binding protein is a protein or polypeptide that comprises an antigen-binding region or antigen-binding fragment, that is, has a strong affinity to another molecule to which it binds. Antigen-binding proteins encompass antibodies.
[0281] Antibody and antibodies as those terms are known in the art refer to antigen binding proteins of the immune system. The term antibody as referred to herein includes whole, full-length antibodies having an antigen-binding region, and any fragment thereof in which the antigen-binding fragment or antigen-binding region is retained, or single chains, for example, single-chain variable fragment (scFv), thereof. A naturally occurring antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant (CH) region. The heavy chain constant region is comprised of three domains, CH1, CH2, and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant C.sub.L region. The light chain constant region is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1 q) of the classical complement system.
[0282] The term human antibody, as used herein, is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences. The human antibodies of the presently disclosed subject matter may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
[0283] The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the presently disclosed subject matter may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
[0284] As used herein, an antibody that specifically binds to DLL3 is intended to refer to an antibody that binds to DLL3 (e.g., human DLL3) with a dissociation constant (K.sub.D) of about 1?10.sup.?8 M or less, about 5?10.sup.?9 M or less, about 1?10.sup.?9 M or less, about 5?10.sup.?10 M or less, about 1?10.sup.?10 M or less, about 5?10.sup.?11 M or less, about 1?10.sup.?11 M or less, about 5?10.sup.?12 M or less, or about 1?10.sup.?12 M or less.
[0285] The phrases an antibody recognizing an antigen and an antibody specific for an antigen are used interchangeably herein with the term an antibody which binds specifically to an antigen (e.g., a DLL3 polypeptide).
[0286] The term antigen-binding fragment or antigen-binding region of an antibody, as used herein, refers to that region or fragment of the antibody that binds to the antigen and which confers antigen specificity to the antibody; fragments of antigen-binding proteins, for example, antibodies including one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., a DLL3 polypeptide). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antigen-binding fragments encompassed within the term antibody fragments of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL, and CH1 domains; an F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., Nature 1989; 341:544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
[0287] Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules. These are known as single chain Fv (scFv); see e.g., Bird et al., Science (1988); 242:423-426; and Huston et al., Proc Natl Acad Sci (1998); 85:5879-5883. These antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
[0288] An antibody or antigen-binding protein is one which has been identified and separated and/or recovered from a component of its natural environment. Synthetic antibodies or recombinant antibodies are generally generated using recombinant technology or using peptide synthetic techniques known to those of skill in the art.
[0289] As used herein, the term single-chain variable fragment or scFv is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an immunoglobulin (e.g., mouse or human) covalently linked to form a VH::VL heterodimer. The heavy (VH) and light chains (VL) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N-terminus of the VH with the C-terminus of the VL, or the C-terminus of the VH with the N-terminus of the VL. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility. The linker can link the heavy chain variable region and the light chain variable region of the extracellular antigen-binding domain. Non-limiting examples of linkers are disclosed in Shen et al., Anal Chem (2008); 80(6):1910-1917 and WO 2014/087010, the contents of which are hereby incorporated by reference in their entireties.
[0290] As used herein, F(ab) refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have an Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
[0291] As used herein, F(ab).sub.2 refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab) (bivalent) regions, wherein each (ab) region comprises two separate amino acid chains, a part of an H chain and a light (L) chain linked by an SS bond for binding an antigen and where the remaining H chain portions are linked together. A F(ab).sub.2 fragment can be split into two individual Fab fragments.
[0292] CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e. g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987), or IMGT numbering system (Lefranc, The Immunologist (1999); 7:132-136; Lefranc et al., Dev. Comp. Immunol. (2003); 27:55-77). The term hypervariable region or HVR as used herein refers to each of the regions of an antibody variable domain which are hypervariable in sequence (complementarity determining regions or CDRs) and/or form structurally defined loops (hypervariable loops) and/or contain the antigen-contacting residues (antigen contacts). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope region. In certain embodiments, the CDRs are identified according to the IMGT system. In certain embodiments, the CDRs are identified using the IMGT numbering system accessible at http://www.imgt.org/IMGT_vquest/input.
[0293] The terms isolated denotes a degree of separation from original source or surroundings.
[0294] An isolated antibody is one which has been separated from a component of its natural environment. In certain embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC). For review of methods for assessment of antibody purity, see, e.g., Flatman et al., J. Chromatogr (2007); B 848:79-87.
[0295] As used herein, the term about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, about can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
[0296] By substantially identical or substantially homologous is meant a polypeptide or nucleic acid molecule exhibiting at least about 50% homologous or identical to a reference amino acid sequence (for example, any of the amino acid sequences described herein) or a reference nucleic acid sequence (for example, any of the nucleic acid sequences described herein). In certain embodiments, such a sequence is at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% homologous or identical to the sequence of the amino acid or nucleic acid used for comparison. Sequence identity can be measured by using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e-3 and e-100 indicating a closely related sequence.
[0297] As used herein, the percent homology between two amino acid sequences is equivalent to the percent identity between the two sequences. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=#of identical positions/total #of positions?100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. The percent homology between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent homology between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol. 48:444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. Additionally or alternatively, the amino acids sequences of the presently disclosed subject matter can further be used as a query sequence to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the XBLAST program (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the specified sequences (e.g., heavy and light chain variable region sequences of scFv m903, m904, m905, m906, and m900) disclosed herein. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.
[0298] As used herein, the term a conservative sequence modification refers to an amino acid modification that does not significantly affect or alter the binding characteristics of the presently disclosed antibodies (e.g., anti-DLL3 antibodies). Conservative modifications can include amino acid substitutions, additions and deletions. Amino acids can be classified into groups according to their physicochemical properties such as charge and polarity. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid within the same group. For example, amino acids can be classified by charge: positively-charged amino acids include lysine, arginine, histidine, negatively-charged amino acids include aspartic acid, glutamic acid, neutral charge amino acids include alanine, asparagine, cysteine, glutamine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. In addition, amino acids can be classified by polarity: polar amino acids include arginine (basic polar), asparagine, aspartic acid (acidic polar), glutamic acid (acidic polar), glutamine, histidine (basic polar), lysine (basic polar), serine, threonine, and tyrosine; non-polar amino acids include alanine, cysteine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, and valine. Thus, one or more amino acid residues within a CDR region can be replaced with other amino acid residues from the same group and the altered antibody can be tested for retained function (i.e., the functions set forth in (c) through (1) above) using the functional assays described herein. In certain embodiments, no more than one, no more than two, no more than three, no more than four, no more than five residues within a specified sequence or a CDR region are altered.
[0299] As used herein, the term administration refers to introducing a substance into a subject. In general, any route of administration may be utilized including, for example, parenteral (e.g., intravenous), oral, topical, subcutaneous, peritoneal, intraarterial, inhalation, vaginal, rectal, nasal, introduction into the cerebrospinal fluid, or instillation into body compartments. In certain embodiments, administration is oral. Additionally or alternatively, administration is parenteral. In certain embodiments, administration is intravenous.
[0300] The term biocompatible, as used herein is intended to describe materials that do not elicit a substantial detrimental response in vivo. In certain embodiments, the materials are biocompatible if they are not toxic to cells. In certain embodiments, materials are biocompatible if their addition to cells in vitro results in less than or equal to 20% cell death, and/or their administration in vivo does not induce inflammation or other such adverse effects. In certain embodiments, materials are biodegradable.
[0301] As used herein, biodegradable materials are those that, when introduced into cells, are broken down by cellular machinery (e.g., enzymatic degradation) or by hydrolysis into components that cells can either reuse or dispose of without significant toxic effects on the cells. In certain embodiments, components generated by breakdown of a biodegradable material do not induce inflammation and/or other adverse effects in vivo. In certain embodiments, biodegradable materials are enzymatically broken down. Alternatively or additionally, biodegradable materials are broken down by hydrolysis. In certain embodiments, biodegradable polymeric materials break down into their component polymers. In certain embodiments, breakdown of biodegradable materials (including, for example, biodegradable polymeric materials) includes hydrolysis of ester bonds. In certain embodiments, breakdown of materials (including, for example, biodegradable polymeric materials) includes cleavage of urethane linkages.
[0302] As used herein, biomolecule refers to bioactive, diagnostic, and prophylactic molecules. Biomolecules that can be used in the present invention include, but are not limited to, synthetic, recombinant or isolated peptides and proteins such as antibodies and antigens, receptor ligands, enzymes, and adhesion peptides; nucleotides and polynucleotides such as DNA and antisense nucleic acid molecule; activated sugars and polysaccharides; bacteria; viruses; and chemical drugs such as antibiotics, anti-inflammatories, and antifungal agents.
[0303] As used herein, carrier refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin.
[0304] As used herein, the term chelator refers to a chemical compound in the form of a heterocyclic ring or surrounding structure containing a metal ion attached by coordinate bonds to at least two nonmetal ions. Non-limiting examples of chelator include 1,4,7-Triazacyclononane-1,4,7-triacetic acid (NOTA), 2,2-(7-(1-carboxy-4-((4-isothiocyanatobenzyl)amino)-4-oxobutyl)-1,4,7-triazonane-1,4-diyl)diacetic acid (NODA), 2,2,2,2-(1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetrayl)tetraacetic acid (DOTA), Diethylenetriamine-N,N,N,N,N-pentaacetic acid, pentetic acid, (Carboxymethyl)imino]bis(ethylenenitrilo)-tetra-acetic acid (DTPA), 1-Hydroxy-2-pyridone; 2-Pyridinol-1-oxide (HOPO), N-(5-(3-((5-Aminopentyl)hydroxycarbamoyl)propionamido)pentyl)-3-((5-(N-hydroxyacetamido)pentyl)carbamoyl)propionohydroxamic acid (DFO), and 2-[1,4,7-Triazacyclononan-1-yl-4,7-bis(tBu-ester)]-1,5-pentanedioic acid (NODAGA).
[0305] As used herein, radiolabel refers to a moiety comprising a radioactive isotope of at least one element. Exemplary suitable radiolabels include but are not limited to those described herein. In certain embodiments, a radiolabel is one used in radioimmunotherapy. In certain embodiments, a radiolabel is one used in positron emission tomography (PET). In certain embodiments, a radiolabel is one used in single-photon emission computed tomography (SPECT). In certain embodiments, the radioactive isotope cam be .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Rh .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra, or .sup.149Tb.
[0306] An individual or subject herein is a vertebrate, such as a human or non-human animal, for example, a mammal. Mammals include, but are not limited to, humans, primates, farm animals, sport animals, rodents, and pets. Non-limiting examples of non-human animal subjects include rodents such as mice, rats, hamsters, and guinea pigs; rabbits; dogs; cats; sheep; pigs; goats; cattle; horses; and non-human primates such as apes and monkeys.
[0307] As used herein, the term small molecule can refer to a non-polymeric molecule, for example, or a species less than 5000 Da.
[0308] As used herein, the phrase therapeutic agent refers to any agent that has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect, when administered to a subject.
[0309] An effective amount is an amount sufficient to affect a beneficial or desired clinical result upon treatment. An effective amount can be administered to a subject in one or more doses. In certain embodiments, an effective amount can be an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease. The effective amount can be determined by a physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the cells administered.
[0310] As used herein, treatment refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. By preventing progression of a disease or disorder, a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
[0311] The terms comprises, comprising, and are intended to have the broad meaning ascribed to them in U.S. Patent Law and can mean includes, including and the like.
[0312] Other aspects of the presently disclosed subject matter are described in the following disclosure and are within the ambit of the presently disclosed subject matter.
5.2. Pretargeting Systems
[0313] In certain embodiments, the presently disclosed subject matter provides an anti-DLL3 antibody-TCO conjugate (e.g., an anti-DLL3 antibody bound to TCO) and a radioligand (e.g., a Tz-SarAr) for the visualization of cancers (e.g., DLL3-expressing cancers) and/or for the radioimmunotherapy of the same. It was found that the radioligand disclosed herein, in combination with the anti-DLL3 antibody-TCO conjugate, exhibited higher activity concentrations in the tumor and was rapidly cleared through the renal system allowing for higher tumor-to-background activity concentration ratios at early time points. In addition, the use of alternative radioactive isotopes (e.g., Ac.sup.225) allows the use of this system for radioimmunotherapy.
[0314] The presently disclosed subject matter provides a pretargeting system including (i) injection of the anti-DLL3 antibody-TCO conjugate; (ii) accumulation of the antibody at the target site and allowing unbound antibody to clear from the blood; (iii) injection of the radioligand; and (iv) an in vivo click ligation of the two components, followed by clearance of the excess radioligand (
5.2.1. Anti-DLL3 Antibodies
[0315] The presently disclosed anti-DLL3 antibodies bind specifically to DLL3 (e.g., human DLL3).
[0316] DLL3 (also known as Delta-like 3 or SCDO1) is a member of the Delta-like family of Notch DSL ligands. Aberrant DLL3 expression (genotypic and/or phenotypic) is associated with various tumorigenic cell subpopulations such as cancer stem cells and tumor initiating cells. Accordingly, the present disclosure provides DLL3 antibodies that can be particularly useful for the disclosed pretargeting strategies disclosed herein, thereby facilitating the treatment, management, prevention, or imaging of neoplastic disorders.
[0317] In certain embodiments, the presently disclosed anti-DLL3 antibody binds to a DLL3 polypeptide. In certain embodiments, the presently disclosed anti-DLL3 antibody binds to a human DLL3 polypeptide. In certain embodiments, the human DLL3 polypeptide comprises or consists of the amino acid sequence with a UniProt Reference No: Q9NYJ7-1 (SEQ ID NO: 209) or a fragment thereof. SEQ ID NO: 209 is provided below. In certain embodiments, the DLL3 comprises an extracellular domain, a transmembrane domain, and a cytoplasmic domain. In certain embodiments, the extracellular domain comprises or consists of amino acids 27 to 492 of SEQ ID NO: 209. In certain embodiments, the transmembrane domain comprises or consists of amino acids 493 to 513 of SEQ ID NO: 209. In certain embodiments, the cytoplasmic domain comprises or consists of amino acids 514 to 618 of SEQ ID NO: 209.
[0318] In certain embodiments, the extracellular domain of DLL3 comprises a DSL domain, an EGF-like 1 domain, an EGF-like 2 domain, an EGF-like 3 domain, an EGF-like 4 domain, and EGF-like 5 domain, and an EGF-like 6 domain. In certain embodiments, the DSL domain comprises or consists of amino acids 176 to 215 of SEQ ID NO: 209. In certain embodiments, the EGF-like 1 domain comprises or consists of amino acids 216 to 249 of SEQ ID NO: 209. In certain embodiments, the EGF-like 2 domain comprises or consists of amino acids 274 to 310 of SEQ ID NO: 209. In certain embodiments, the EGF-like 3 domain comprises or consists of amino acids 312 to 351 of SEQ ID NO: 209. In certain embodiments, the EGF-like 4 domain comprises or consists of amino acids 353 to 389 of SEQ ID NO: 209. In certain embodiments, the EGF-like 5 domain comprises or consists of amino acids 391 to 427 of SEQ ID NO: 209. In certain embodiments, the EGF-like 6 domain comprises or consists of amino acids 429 to 465 of SEQ ID NO: 209.
TABLE-US-00001 [SEQIDNO:209] MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPG PGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALG AALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWAR DIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRC GPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDG NPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGP CFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRAC ANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAH GGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGH SQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSS VDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA GQRQHLLFPYPSSILSVK
[0319] In certain embodiments, the DLL3 polypeptide comprises or consists of an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% identical to the amino acid sequence set forth in SEQ ID NO: 209 or a fragment thereof.
[0320] In certain embodiments, the anti-DLL3 antibodies or antigen-binding fragments thereof bind to a portion of human DLL3. In certain embodiments, the anti-DLL3 antibodies or antigen-binding fragments thereof bind to the extracellular domain of DLL3. In certain embodiments, the anti-DLL3 antibodies or antigen-binding fragments thereof bind to amino acids 27 to 492 of SEQ ID NO: 209.
[0321] In certain embodiments, the antigen recognizing receptor binds to EGF-like 3 domain of DLL3. In certain embodiments, the antigen recognizing receptor binds to amino acids 312 to 351 of SEQ ID NO: 209. In certain embodiments, the antigen recognizing receptor binds to EGF-like 4 domain of DLL3. In certain embodiments, the antigen recognizing receptor binds to amino acids 353 to 389 of SEQ ID NO: 209. In certain embodiments, the antigen recognizing receptor binds to EGF-like 5 domain of DLL3. In certain embodiments, the antigen recognizing receptor binds to amino acids 391 to 427 of SEQ ID NO: 209. In certain embodiments, the antigen recognizing receptor binds to EGF-like 6 domain of DLL3. In certain embodiments, the antigen recognizing receptor binds to amino acids 429 to 465 of SEQ ID NO: 209.
[0322] In certain embodiments, a presently disclosed antibody or antigen-binding fragment thereof binds to DLL3 (e.g., human DLL3) with a binding affinity, for example with a dissociation constant (K.sub.D) of about 1?10.sup.?8 M or less, about 5?10.sup.?9 M or less, about 1?10.sup.?9 M or less, about 5?10.sup.?10 M or less, about 1?10.sup.?10 M or less, about 5?10.sup.?11 M or less, or about 1?10.sup.?11 M or less, about 5?10.sup.?12 M or less, or about 1?10.sup.?12 M or less. In certain embodiments, extracellular antigen-binding domain (embodied, for example, an scFv) binds to DLL3 (e.g., human DLL3) with a binding affinity, for example with a dissociation constant (K.sub.D) of about 5?10.sup.?9 M or less. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to DLL3 (e.g., human DLL3) with a binding affinity, for example with a dissociation constant (K.sub.D) of about 1?10.sup.?9 M or less. In certain embodiments, extracellular antigen-binding domain (embodied, for example, an scFv) binds to DLL3 (e.g., human DLL3) with a binding affinity, for example with a dissociation constant (K.sub.D) of about 3.5?10.sup.?9 M. In certain embodiments, extracellular antigen-binding domain (embodied, for example, an scFv) binds to DLL3 (e.g., human DLL3) with a binding affinity, for example with a dissociation constant (K.sub.D) of about 1.5?10.sup.?9 M. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to DLL3 (e.g., human DLL3) with a binding affinity, for example with a dissociation constant (K.sub.D) of about 1?10.sup.?12 M.
[0323] The heavy and light chains of a presently disclosed antibody or antigen-binding fragment thereof can be full-length (e.g., an antibody can include at least one (e.g., one or two) complete heavy chains, and at least one (e.g., one or two) complete light chains) or can include an antigen-binding fragment (a Fab, F(ab).sub.2, Fv or a single chain Fv fragment (scFv)). In certain embodiments, the antibody heavy chain constant region is chosen from, e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE, particularly chosen from, e.g., IgG1, IgG2, IgG3, and IgG4. In certain embodiments, the immunoglobulin isotype is IgG1 (e.g., human IgG1). The choice of antibody isotype can depend on the immune effector function that the antibody is designed to elicit. In certain embodiments, the antibody light chain constant region is chosen from, e.g., kappa or lambda, particularly kappa.
[0324] In certain embodiments, the presently disclosed subject matter includes antibodies or antigen-binding fragments thereof that have the scFv sequence fused to one or more constant domains to form an antibody with an Fc region of a human immunoglobulin to yield a bivalent protein, increasing the overall avidity and stability of the antibody.
[0325] In constructing a recombinant immunoglobulin, appropriate amino acid sequences for constant regions of various immunoglobulin isotypes and methods for the production of a wide array of antibodies are known to those of skill in the art.
[0326] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 1. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 7. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 7 is set forth in SEQ ID NO: 9. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 8. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 8 is set forth in SEQ ID NO: 10. SEQ ID NO: 7-10 are provided in Table 1. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as J8.
[0327] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 7 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 8.
[0328] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3 or a conservative modification thereof. SEQ ID NOs: 1-3 are provided in Table 1.
[0329] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6 or a conservative modification thereof. SEQ ID NOs: 4-6 are provided in Table 1.
[0330] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6 or a conservative modification thereof.
[0331] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; and a V.sub.L Comprising CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6.
TABLE-US-00002 TABLE1 CDRs 1 2 3 V.sub.H GYTFTIY[SEQID NPSGGS[SEQID NDYVDYVTTDYYGMDV NO:1] NO:2] [SEQIDNO:3] V.sub.L RASQGISNYLA[SEQ AASSLQS[SEQID QQYNSSPYT[SEQ IDNO:4] NO:5] IDNO:6] FullV.sub.H QVHLVQSGAEVKKPGASVKVSCKASGYTFTIYYIHWVRQAPGQGLEWMGIINPS GGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCSGNDYVDYVTTD YYGMDVWGQGTTVTVSS[SEQIDNO:7] FullV.sub.L DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLIYAASSL QSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSSPYTFGQGTKLEIK [SEQIDNO:8] DNAfor CAGGTGCATCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCTTGCAAGGCATCTGGATACACCTTCACCATCTACTATATTCACTGG GTGCGACAGGCCCCTGGACAGGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTATATTACTGTTCGGGTAATGACTACGTTGACTACGTAACTACTGAC TACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA [SEQIDNO:9] DNAfor GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGCATCTGTAGGAGATAGA FullV.sub.L GTCACCATCACTTGTCGGGCGAGTCAGGGCATTAGCAATTATTTAGCCTGGTTT CAGCAGAAACCAGGGAAAGCCCCTAAGTCCCTGATCTATGCTGCATCCAGTTTG CAAAGTGGGGTCCCATCAAAGTTCAGCGGCAGTGGATCTGGGACAGATTTCACA CTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGCCAACAG TATAATAGTTCCCCGTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:10]
[0332] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 2. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 17, as shown in Table 2. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 17 is set forth in SEQ ID NO: 19. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 18. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 18 is set forth in SEQ ID NO: 20. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 17 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 18. SEQ ID NO: 17-20 are provided in Table 2. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as L22.
[0333] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13 or a conservative modification thereof. SEQ ID NOs: 11-13 are provided in Table 2.
[0334] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16 or a conservative modification thereof. SEQ ID NOs: 14-16 are provided in Table 2.
[0335] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16 or a conservative modification.
[0336] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16.
TABLE-US-00003 TABLE2 CDRs 1 2 3 V.sub.H GFTFSSY SGRGGD ERGLGFDY [SEQIDNO:11] [SEQIDNO:12] [SEQIDNO:13] V.sub.L RSSQSLLDSDDGNTYLD TLSYRAS MQHLEFPLT [SEQIDNO:14] [SEQIDNO:15] [SEQIDNO:16] FullV.sub.H EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQTPGKGLEWVSTISGR GGDTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCAKERGLGFDYWG QGTLVTVSS [SEQIDNO:17] FullV.sub.L DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLI YTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQHLEFPLTFGGGT KVEIK [SEQIDNO:18] DNAfor GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTG FullV.sub.H AGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCAGCTATGCCATGGGCTGG GTCCGCCAGACTCCAGGGAAGGGGCTGGAGTGGGTCTCAACTATTAGTGGTCGT GGTGGTGACACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGA GACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGAC ACGGCCATATATTACTGTGCGAAAGAGAGGGGACTGGGGTTTGACTACTGGGGC CAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:19] DNAfor GATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTAGTCAGAGCCTCTTGGATAGTGATGATGGAAAC ACCTATTTGGACTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATC TATACGCTTTCCTATCGGGCCTCTGGAGTCCCAGACAGGTTCAGTGGCAGTGGG TCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGGA GTTTATTACTGCATGCAACATCTAGAGTTTCCGCTCACTTTCGGCGGAGGGACC AAGGTGGAGATCAAA [SEQIDNO:20]
[0337] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 3. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 24, as shown in Table 3. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 24 is set forth in SEQ ID NO: 26. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 25. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 25 is set forth in SEQ ID NO: 27. SEQ ID NO: 24-27 are provided in Table 3. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as B2.
[0338] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 24 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 25.
[0339] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 22 are provided in Table 3.
[0340] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23 or a conservative modification thereof. SEQ ID NOs: 4, 5, and 23 are provided in Table 3.
[0341] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23 or a conservative modification thereof.
[0342] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a V.sub.H CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23.
TABLE-US-00004 TABLE3 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS GDYDILTDYYYNMDV [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:22] V.sub.L RASQGISNYLA AASSLQS LQHNSYPYT [SEQIDNO:4] [SEQIDNO:5] [SEQIDNO:23] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPS GGSTSYAQKFRGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGDYDILTDYY YNMDVWGQGTTVTVSS [SEQIDNO:24] FullV.sub.L DIQMTQSPSAMSASVGDRVTITCRASQGISNYLAWFQQKPGKVPKRLIYAASSL QSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPYTFGQGTKLEIK [SEQIDNO:25] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCGGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTTTATTACTGTGCGAGAGGGGATTACGATATTTTGACGGACTACTAC TACAATATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA [SEQIDNO:26] DNAfor GACATCCAGATGACCCAGTCTCCATCTGCCATGTCTGCATCTGTAGGAGACAGA FullV.sub.L GTCACCATCACTTGTCGGGCGAGTCAGGGCATTAGCAATTATTTAGCCTGGTTT CAGCAGAAACCAGGGAAAGTCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTG CAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACT CTCACAATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAG CATAATAGTTACCCGTACACTTTCGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:27]
[0343] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 4. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 34, as shown in Table 4. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 34 is set forth in SEQ ID NO: 36. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 35. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 35 is set forth in SEQ ID NO: 37. SEQ ID NO: 34-37 are provided in Table 4. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as A18.
[0344] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 34 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 35. SEQ ID NOs: 34 and 35 are provided in Table 4.
[0345] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30 or a conservative modification thereof. SEQ ID NOs: 28, 29, and 30 are provided in Table 4.
[0346] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33 or a conservative modification thereof. SEQ ID NOs: 31, 32, and 33 are provided in Table 4.
[0347] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33 or a conservative modification thereof.
[0348] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33.
TABLE-US-00005 TABLE4 CDRs 1 2 3 V.sub.H GFSLSTSGM DWDDN IRGYSGSYDAFDI [SEQIDNO:28] [SEQIDNO:29] [SEQIDNO:30] V.sub.L RSSQSLLHSNGYNYLD LGSNRAP MQALQTPFT [SEQIDNO:31] [SEQIDNO:32] [SEQIDNO:33] FullV.sub.H QVTLRESGPALVKSTQTLTLTCTFSGFSLSTSGMCVSWIRQTPGKALEWLALID WDDNKYYSTSLKTRLIISKDTSKNQVVLTMTNMEPVDTATYYCARIRGYSGSYD AFDIWGQGTMVTVSS [SEQIDNO:34] FullV.sub.L VDIKDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPHILLY LGSNRAPGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP FTFGPGTK [SEQIDNO:35] DNAfor CAGGTCACCTTGAGGGAGTCTGGTCCTGCGCTGGTGAAATCCACACAGACCCTC FullV.sub.H ACACTGACCTGCACCTTCTCTGGGTTCTCACTCAGTACTAGTGGAATGTGTGTG AGCTGGATCCGTCAGACCCCAGGGAAGGCCCTGGAGTGGCTTGCACTCATTGAT TGGGATGATAATAAATACTACAGCACATCTCTGAAGACCAGGCTCATCATCTCC AAGGACACCTCCAAAAACCAGGTGGTCCTTACAATGACCAATATGGAACCTGTG GACACAGCCACGTATTATTGTGCACGGATACGGGGGTATAGTGGGAGCTACGAT GCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:36] DNAfor GATATTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCATAGTAATGGATACAAC TATTTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTCCACACATCCTGCTCTAT TTGGGTTCTAATCGGGCCCCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATCA GGCACAGATTTTACACTGAAAATCAGCAGAGTGGAGGCTGAGGATGTTGGGGTT TATTACTGCATGCAAGCTCTACAAACTCCATTCACTTTCGGCCCTGGGACCAAA GTGGATATCAAA [SEQIDNO:37]
[0349] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 5. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 42, as shown in Table 5. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 42 is set forth in SEQ ID NO: 44. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 43. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 43 is set forth in SEQ ID NO: 45. SEQ ID NO: 42-45 are provided in Table 5. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as E9.
[0350] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 42 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 43.
[0351] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39 or a conservative modification thereof. SEQ ID NOs: 21, 38, and -39 are provided in Table 5.
[0352] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41 or a conservative modification thereof. SEQ ID NOs: 40, 5, and 41 are provided in Table 5.
[0353] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41 or a conservative modification thereof.
[0354] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41.
TABLE-US-00006 TABLE5 CDRs 1 2 3 V.sub.H GYTFTSY NSSGGS GYCTNGVYYDEDFDY [SEQIDNO:21] [SEQIDNO:38] [SEQIDNO:39] V.sub.L RASQGISHYLA AASSLQS QQYNSYPLT [SEQIDNO:40] [SEQIDNO:5] [SEQIDNO:41] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGVINSS GGSTSYAQKFQGRVTMTRDTSTSTVYMDLSSLRSEDTAVYYCARGYCTNGVYYD EDFDYWGQGTLVTVSS [SEQIDNO:42] FullV.sub.L DIQMTQSPSSLSASVGDRVTITCRASQGISHYLAWFQQKPGKAPTSLIYAASSL QSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPLTFGGGTKVEIK [SEQIDNO:43] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGTAATCAATTCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGACCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGAGGGTATTGTACTAATGGTGTTTACTATGAT GAGGACTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:44] DNAfor GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGCATCTGTAGGAGACAGA FullV.sub.L GTCACCATCACTTGTCGGGCGAGTCAGGGCATTAGCCATTATTTAGCCTGGTTT CAGCAGAAACCAGGGAAAGCCCCTACGTCCCTGATCTATGCTGCATCCAGTTTG CAAAGTGGGGTCCCATCAAAGTTCAGCGGCAGTGGATCTGGGACAGATTTCACT CTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGCCAACAG TATAATAGTTACCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA [SEQIDNO:45]
[0355] In certain embodiments, the anti-DLL antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 6. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 52, as shown in Table 6. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 52 is set forth in SEQ ID NO: 54. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 53. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 53 is set forth in SEQ ID NO: 55. SEQ ID NO: 52-55 are provided in Table 6. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as G3.
[0356] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 52 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 53.
[0357] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48 or a conservative modification thereof. SEQ ID NOs: 46-48 are provided in Table 6.
[0358] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51 or a conservative modification thereof. SEQ ID NOs: 49, 50, and 51 are provided in Table 6.
[0359] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51 or a conservative modification thereof.
[0360] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51.
TABLE-US-00007 TABLE6 CDRs 1 2 3 V.sub.H GGSISSY YTSGS EDWESWTFDI [SEQIDNO:46] [SEQIDNO:47] [SEQIDNO:48] V.sub.L RSGQSLVYSDGDTYLN KVSNRDS MQGTHWPLS [SEQIDNO:49] [SEQIDNO:50] [SEQIDNO:51] FullV.sub.H QVQLQESGPGLVKPSETLFLTCTVSGGSISSYYWTWIRQPAGKGLEWIGRIYTS GSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAREDWESWTFDIW GQGTMVTVSS [SEQIDNO:52] FullV.sub.L DVVMTQSPLSLPVTLGQPASISCRSGQSLVYSDGDTYLNWFQQRPGQSPRRLIY KVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPLSFGGGTK VEIK [SEQIDNO:53] DNAfor CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTG FullV.sub.H TTCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTACTGGACCTGG ATCCGGCAGCCCGCCGGGAAGGGACTGGAGTGGATTGGGCGTATCTATACCAGT GGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCATGTCAGTAGAC ACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGGACACG GCCGTGTATTACTGTGCGAGAGAGGACTGGGAATCGTGGACTTTTGATATCTGG GGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:54] DNAfor GATGTTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCTTGGACAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTGGTCAAAGCCTCGTTTACAGTGATGGAGACACC TACTTGAATTGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGGCGCCTAATTTAT AAGGTTTCTAACCGGGACTCTGGGGTCCCAGACAGATTCAGCGGCAGTGGGTCA GGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGGGGTT TATTACTGCATGCAAGGTACACACTGGCCGCTCTCTTTCGGCGGAGGGACCAAG GTGGAGATCAAA [SEQIDNO:55]
[0361] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 7. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 60, as shown in Table 7. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 60 is set forth in SEQ ID NO: 62. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 61. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 61 is set forth in SEQ ID NO: 63. SEQ ID NO: 60-63 are provided in Table 7. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as M11.
[0362] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 60 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 61.
[0363] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 56 are provided in Table 7.
[0364] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 or a conservative modification thereof. SEQ ID NOs: 57-59 are provided in Table 7.
[0365] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 or a conservative modification thereof.
[0366] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59.
TABLE-US-00008 TABLE7 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS QLELLGNAFDI [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:56] V.sub.L RASQSVSSSYLA GASSRAT QQYGSSPYT [SEQIDNO:57] [SEQIDNO:58] [SEQIDNO:59] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIINPS GGSKSYAQKFQGRVTMTRDTSTGTVYMELSSLRSEDTAVYYCAGQLELLGNAFD IWGQGTMVTVSS [SEQIDNO:60] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPYTFGQGTKLEIK [SEQIDNO:61] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATACACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGTAAAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGGGAACAGTCTATATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGGGACAACTGGAACTTTTGGGGAATGCTTTTGAT ATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:62] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC AGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGGTAGCTCACCGTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:63]
[0367] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 8. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 66, as shown in Table 8. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 66 is set forth in SEQ ID NO: 68. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 67. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 67 is set forth in SEQ ID NO: 69. SEQ ID NO: 66-69 are provided in Table 8. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as 024.
[0368] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 66 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 67.
[0369] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 64 are provided in Table 8.
[0370] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65 or a conservative modification thereof. SEQ ID NOs: 4, 5 and 65 are provided in Table 8.
[0371] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65 or a conservative modification thereof.
[0372] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65.
TABLE-US-00009 TABLE8 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS ERQQLDYYYFAMDV [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:64] V.sub.L RASQGISNYLA AASSLQS QQYNSYPPT [SEQIDNO:4] [SEQIDNO:5] [SEQIDNO:65] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYLHWVRQAPGHGLEWMAIINPS GGSTSYAQKFLGRVTMTRDTSTNTVYMELSSLRSEDTAVYYCARERQQLDYYYF AMDVWGQGTTVTVSS [SEQIDNO:66] FullV.sub.L DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLIYAASSL QSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPPTFGQGTKVEIK [SEQIDNO:67] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATTTGCACTGG GTGCGACAGGCCCCTGGACACGGGCTTGAGTGGATGGCAATAATCAACCCTAGT GGTGGTAGTACAAGCTACGCACAGAAGTTCCTGGGCAGAGTCACCATGACCAGG GACACGTCCACGAACACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGAGAACGGCAGCAGCTGGACTACTACTACTTC GCTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA [SEQIDNO:68] DNAfor GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGCATCTGTAGGAGACAGA FullV.sub.L GTCACCATCACTTGTCGGGCGAGTCAGGGCATTAGCAATTATTTAGCCTGGTTT CAGCAGAAACCAGGGAAAGCCCCTAAGTCCCTGATCTATGCTGCATCCAGTTTG CAAAGTGGGGTCCCATCAAAGTTCAGCGGCAGTGGATCTGGGACAGATTTCACT CTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGCCAACAG TATAATAGTTACCCTCCGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA [SEQIDNO:69]
[0373] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 9. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 76, as shown in Table 9. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 76 is set forth in SEQ ID NO: 78. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 77. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 77 is set forth in SEQ ID NO: 79. SEQ ID NO: 76-79 are provided in Table 9. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as P4.
[0374] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 76 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 77.
[0375] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72 or a conservative modification thereof. SEQ ID NOs: 70-72 are provided in Table 9.
[0376] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75 or a conservative modification thereof. SEQ ID NOs: 73-75 are provided in Table 9.
[0377] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75 or a conservative modification thereof.
[0378] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75.
TABLE-US-00010 TABLE9 CDRs 1 2 3 V.sub.H GFTFSFY SSSSSY NYDFWRGAFDI [SEQIDNO:70] [SEQIDNO:71] [SEQIDNO:72] V.sub.L RASQSVSSNLA GASTRAT QQYNNWPTWT [SEQIDNO:73] [SEQIDNO:74] [SEQIDNO:75] FullV.sub.H EVQLVESGGGLVKPGGSLRLSCAASGFTFSFYSMNWVRQAPGKGLEWVSSISSSSSYIY YADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARNYDFWRGAFDIWGQGTMVTV SS [SEQIDNO:76] FullV.sub.L EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIP ARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPTWTFGQGTKVEIK [SEQIDNO:77] DNAfor GAGGTGCAGCTGGTGGAGTCTGGGGGGGGCCTGGTCAAGCCTGGAGGGTCCCTGAGACT FullV.sub.H CTCCTGTGCAGCCTCTGGATTCACCTTCAGTTTCTATAGCATGAACTGGGTCCGCCAGG CTCCAGGGAAGGGGCTGGAGTGGGTCTCATCCATTAGTAGTAGTAGTAGTTACATATAC TACGCAGACTCAGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACT GTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAA ATTACGATTTTTGGAGAGGTGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTC TCTTCA [SEQIDNO:78] DNAfor GAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGAGCCAC FullV.sub.L CCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAACTTAGCCTGGTACCAGCAGAAAC CTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTATCCCA GCCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCA GTCTGAAGATTTTGCAGTTTATTACTGTCAGCAGTATAATAACTGGCCCACGTGGACGT TCGGCCAAGGGACCAAGGTGGAAATCAAA [SEQIDNO:79]
[0379] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 10. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 83, as shown in Table 10. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 83 is set forth in SEQ ID NO: 85. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 84. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 84 is set forth in SEQ ID NO: 86. SEQ ID NO: 83-86 are provided in Table 10. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as J23.
[0380] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 83 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 84.
[0381] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81 or a conservative modification thereof. SEQ ID NOs: 21, 80, and 81 are provided in Table 10.
[0382] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 or a conservative modification thereof. SEQ ID NOs: 57, 58, and 82 are provided in Table 10.
[0383] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 or a conservative modification thereof.
[0384] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82.
TABLE-US-00011 TABLE10 CDRs 1 2 3 V.sub.H GYTFTSY NYSGGS QGRYSGSYLDY [SEQIDNO:21] [SEQIDNO:80] [SEQIDNO:81] V.sub.L RASQSVSSSYLA GASSRAT QQYGSSP [SEQIDNO:57] [SEQIDNO:58] [SEQIDNO:82] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINYS GGSKSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTGVYYCARQGRYSGSYLD YWGQGTLVTVSS [SEQIDNO:83] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFGQGTKLEIK [SEQIDNO:84] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACTATAGT GGTGGTAGCAAAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCCGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGGCGTGTATTACTGTGCGAGACAGGGGCGGTATAGTGGGAGCTACCTTGAC TACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:85] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC AGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGGTAGCTCACCTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:86]
[0385] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 11. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 92, as shown in Table 1. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 92 is set forth in SEQ ID NO: 94. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 93. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 93 is set forth in SEQ ID NO: 95. SEQ ID NO: 92-95 are provided in Table 11. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as K19.
[0386] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 92 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 93.
[0387] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89 or a conservative modification thereof. SEQ ID NOs: 87-89 are provided in Table 11.
[0388] In certain embodiments, the anti-DDL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91 or a conservative modification thereof. SEQ ID NOs: 210, 90, and 91 are provided in Table 11.
[0389] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91 or a conservative modification thereof.
[0390] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91.
TABLE-US-00012 TABLE11 CDRs 1 2 3 V.sub.H GYTENSY NPSGGT DWGEQYGMDV [SEQIDNO:87] [SEQIDNO:88] [SEQIDNO:89] V.sub.L RSSQSLLHSNGYNYLD LGSNRAS MQALQTPLT [SEQIDNO:90] [SEQIDNO:210] [SEQIDNO:91] FullV.sub.H QVQLVQSGAEVKKPGASLKVSCKTSGYTFNSYYMHWVRQAPGQGLEWMGINNPS GGTTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDWGEQYGMDV WGQGTTVTVSS [SEQIDNO:92] FullV.sub.L DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIY LGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPLTFGGGTK VEIK [SEQIDNO:93] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCACTG FullV.sub.H AAGGTTTCCTGCAAGACATCTGGATACACCTTCAACAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAAACAACCCTAGT GGTGGTACCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGAGATTGGGGGGAGCAGTACGGTATGGACGTC TGGGGCCAAGGGACCACGGTCACCGTCTCCTCA [SEQIDNO:94] DNAfor GATATTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCATAGTAATGGATACAAC TATTTGGATTGGTACCTGCAGAAGCCAGGACAGTCTCCACAGCTCCTGATCTAT TTGGGTTCTAATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATCA GGCACAGATTTTACACTGAAAATCAGCAGAGTGGAGGCTGAGGATGTTGGGGTT TATTACTGCATGCAAGCTCTACAAACTCCGCTCACTTTCGGCGGAGGGACCAAG GTGGAGATCAAA [SEQIDNO:95]
[0391] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 12. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 102, as shown in Table 12. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 102 is set forth in SEQ ID NO: 104. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 103. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 103 is set forth in SEQ ID NO: 105. SEQ ID NO: 102-105 are provided in Table 12. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as N10.
[0392] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 102 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 103.
[0393] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98 or a conservative modification thereof. SEQ ID NOs: 96-98 are provided in Table 12.
[0394] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101 or a conservative modification thereof. SEQ ID NOs: 99-101 are provided in Table 12.
[0395] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101 or a conservative modification thereof.
[0396] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101.
TABLE-US-00013 TABLE12 CDRs 1 2 3 V.sub.H GYTFTGY NPHSGA DSSGWYGDAFDI [SEQIDNO:96] [SEQIDNO:97] [SEQIDNO:98] V.sub.L RSSQSLVHSDGNTYLS KISNRFS MQATQFPLT [SEQIDNO:99] [SEQIDNO:100] [SEQIDNO:101] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPH SGAPNSAQKFQVRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDSSGWYGDAF DIWGQGTMVTVSS [SEQIDNO:102] FullV.sub.L DIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIY KISNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATQFPLTFGGGTK VEIK [SEQIDNO:103] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCGGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACCCTCAC AGTGGTGCCCCAAACTCTGCACAGAAGTTTCAGGTCAGGGTCACCATGACCAGG GACACGTCCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGAC ACGGCCGTGTATTACTGTGCGAGGGATAGCAGCGGCTGGTACGGTGATGCTTTT GATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:104] DNAfor GATATTGTGATGACCCAGACTCCACTCTCCTCACCTGTCACCCTTGGACAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTAGTCAAAGCCTCGTACACAGTGATGGCAACACC TACTTGAGTTGGCTTCAGCAGAGGCCAGGCCAGCCTCCAAGACTCCTAATTTAT AAGATTTCTAACCGGTTCTCTGGGGTCCCAGACAGATTCAGTGGCAGTGGGGCA GGGACAGATTTCACACTGAAAATCAGCAGGGTGGAAGCTGAGGATGTCGGGGTT TATTACTGCATGCAAGCTACACAATTTCCGCTCACTTTCGGCGGAGGGACCAAG GTGGAGATCAAA [SEQIDNO:105]
[0397] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 13. In certain embodiments, the anti-DLL3 scFv comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 108, as shown in Table 13. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 108 is set forth in SEQ ID NO: 110. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 109. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 109 is set forth in SEQ ID NO: 111. SEQ ID NO: 108-111 are provided in Table 13. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as B16-v1.
[0398] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 108 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 109.
[0399] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 or a conservative modification thereof. SEQ ID NOs: 105-107 are provided in Table 13.
[0400] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 or a conservative modification thereof. SEQ ID NOs: 57, 58, and 82 are provided in Table 13.
[0401] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 or a conservative modification thereof.
[0402] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82.
TABLE-US-00014 TABLE13 CDRs 1 2 3 V.sub.H GYTFTSY DPSGGS QGRYVGSYLDY [SEQIDNO:21] [SEQIDNO:106] [SEQIDNO:107] V.sub.L RASQSVSSSYLA GASSRAT QQYGSSP [SEQIDNO:57] [SEQIDNO:58] [SEQIDNO:82] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGOGLEWMGIIDPS GGSTSYAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARQGRYVGSYLD YWGQGTLVTVSS [SEQIDNO:108] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS RATGIPDRESGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPFGQGTKLEIK [SEQIDNO:109] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCGACCCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAACACAGTCTACATGGACCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGACAGGGGCGGTATGTTGGGAGCTACCTTGAC TACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:110] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC AGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGGTAGCTCACCTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:111]
[0403] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 14. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 108, as shown in Table 14. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 108 is set forth in SEQ ID NO: 110. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 113. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 113 is set forth in SEQ ID NO: 114. SEQ ID NO: 108, 110, 113, and 114 are provided in Table 14. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as B16-v2.
[0404] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 108 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 113.
[0405] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 or a conservative modification thereof. SEQ ID NOs: 21, 106, and 107 are provided in Table 14.
[0406] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112 or a conservative modification thereof. SEQ ID NOs: 4, 5, and 112 are provided in Table 14.
[0407] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112 or a conservative modification.
[0408] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112.
TABLE-US-00015 TABLE14 CDRs 1 2 3 V.sub.H GYTFTSY DPSGGS QGRYVGSYLDY [SEQIDNO:21] [SEQIDNO:106] [SEQIDNO:107] V.sub.L RASQGISNYLA AASSLOS QQYNSYPYT [SEQIDNO:4] [SEQIDNO:5] [SEQIDNO:112] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIIDPSGGSTS YAQKFQGRVTMTRDTSTNTVYMDLSSLRSEDTAVYYCARQGRYVGSYLDYWGQGTLVTV SS [SEQIDNO:108] FullV.sub.L DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSVIYAASSLQSGVP SKFSGSGSGTDFTLTISSMOPEDFATYYCQQYNSYPYTFGQGTKLEIK [SEQIDNO:113] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGT FullV.sub.H TTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGGGTGCGACAGG CCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCGACCCTAGTGGTGGTAGCACAAGC TACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGGGACACGTCCACGAACACAGT CTACATGGACCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAC AGGGGCGGTATGTTGGGAGCTACCTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTC TCCTCA [SEQIDNO:110] DNAfor GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGCATCTGTAGGAGACAGAGTCAC FullV.sub.L CATCACTTGTCGGGCGAGTCAGGGCATTAGCAATTATTTAGCCTGGTTTCAGCAGAAAC CAGGGAAAGCCCCTAAGTCCGTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCA TCAAAGTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCATGCA GCCTGAAGATTTTGCAACTTATTACTGCCAACAGTATAATAGTTACCCGTACACTTTTG GCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:114]
[0409] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 15. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 119, as shown in Table 15. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 119 is set forth in SEQ ID NO: 121. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 120. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 120 is set forth in SEQ ID NO: 122. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 119 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 120. SEQ ID NO: 119-122 are provided in Table 15. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as E23.
[0410] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116 or a conservative modification thereof. SEQ ID NOs: 96, 115, and 116 are provided in Table 15.
[0411] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118 or a conservative modification thereof. SEQ ID NOs: 100, 117, and 118 are provided in Table 15.
[0412] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO:117 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118 or a conservative modification.
[0413] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118.
TABLE-US-00016 TABLE15 CDRs 1 2 3 V.sub.H GYTFTGY NSYSGG DGSGWYGSYFDE [SEQIDNO:96] [SEQIDNO:115] [SEQIDNO:116] V.sub.L RSSQSLVHSDGNTYLS KISNRFS IQTTQFPLT [SEQIDNO:117] [SEQIDNO:100] [SEQIDNO:118] FullV.sub.H QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINSY SGGANYAQKFQDRVTMTRDTSVSTASMELSRLRSDDTAVYYCARDGSGWYGSYF DFWGQGTLVTVSS [SEQIDNO:119] FullV.sub.L DIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIY KISNRFSGVPDRESGSGAGTDFTLKISRVEAEDVGFYYCIQTTQFPLTFGGGTK VEIK [SEQIDNO:120] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCGGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACTCTTAC AGTGGTGGCGCAAACTATGCACAGAAGTTTCAGGACAGGGTCACCATGACCAGG GACACGTCCGTCAGCACAGCCTCCATGGAGCTGAGCAGGCTGAGATCTGACGAC ACGGCCGTGTATTACTGTGCGAGAGATGGCAGTGGCTGGTACGGGTCCTACTTT GACTTCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:121] DNAfor GATATTGTGATGACCCAGACTCCACTCTCCTCACCTGTCACCCTTGGACAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTAGTCAAAGCCTCGTACACAGTGATGGAAACACC TACTTGAGTTGGCTTCAGCAGAGGCCAGGCCAGCCTCCAAGACTCCTAATTTAT AAGATTTCTAACCGGTTCTCTGGGGTCCCAGACAGATTCAGTGGCAGTGGGGCA GGGACAGATTTCACACTGAAAATCAGCAGGGTGGAAGCTGAGGATGTCGGGTTT TATTACTGCATACAAACTACACAATTTCCGCTCACTTTCGGCGGAGGGACCAAG GTGGAGATCAAA [SEQIDNO:122]
[0414] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 16. In certain embodiments, the anti-DLL3 scFv comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 126, as shown in Table 16. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 126 is set forth in SEQ ID NO: 128. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 127. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 127 is set forth in SEQ ID NO: 129. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 126 and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 127. SEQ ID NO: 126-129 are provided in Table 16. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as 1F9.
[0415] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 123 are provided in Table 16.
[0416] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 or a conservative modification thereof. SEQ ID NOs: 58, 124, and 125 are provided in Table 16.
[0417] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 or a conservative modification.
[0418] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125.
TABLE-US-00017 TABLE16 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS QGGAQWLVLAFDI [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:123] V.sub.L RASQSVSSYLA GASSRAT QQYDSSPYT [SEQIDNO:124] [SEQIDNO:58] [SEQIDNO:125] FullV.sub.H QVQLVQSGAEVKKPGASVQVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPS GGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARQGGAQWLVLA FDIWGQGTMVTVSS[SEQIDNO:126] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSYLAWYQQKPGQPPRLLIYGASSR ATGIPDRESGGGSGTDETLTISRLEPEDFAVYYCQQYDSSPYTFGQGTKLEIK [SEQIDNO:127] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H CAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGACAGGGGGGAGCCCAGTGGCTGGTACTTGCT TTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:128] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCTACTTAGCCTGGTAC CAGCAGAAACCTGGCCAGCCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGG GCCACTGGCATCCCAGACAGGTTCAGTGGCGGTGGGTCTGGGACAGACTTCACT CTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAG TATGATAGCTCACCGTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:129]
[0419] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 17. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 131, as shown in Table 17. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 131 is set forth in SEQ ID NO: 133. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 132. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 132 is set forth in SEQ ID NO: 134. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 131 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 132. SEQ ID NO: 131-134 are provided in Table 17. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as L12.
[0420] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 56 are provided in Table 17.
[0421] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130 or a conservative modification thereof. SEQ ID NOs: 57, 58, and 130 are provided in Table 17.
[0422] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130 or a conservative modification.
[0423] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; and a V.sub.L Comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130.
TABLE-US-00018 TABLE17 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS QLELLGNAFDI [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:56] V.sub.L RASQSVSSSYLA GASSRAT QQYGNSPYT [SEQIDNO:57] [SEQIDNO:58] [SEQIDNO:130] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPS GGSRSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARQLELLGNAFD IWGQGTMVTVSS [SEQIDNO:131] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS RATGIPDRESGSGSGTDFTLTISRLEPEDFAVYYCQQYGNSPYTFGQGTKLEIK [SEQIDNO:132] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGTAGAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACTATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGACAACTGGAACTTTTGGGGAATGCTTTTGAT ATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:133] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC AGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGGTAACTCGCCGTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:134]
[0424] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 18. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 141, as shown in Table 18. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 141 is set forth in SEQ ID NO: 143. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 142. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 142 is set forth in SEQ ID NO: 144. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 141 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 142. SEQ ID NO: 141-144 are provided in Table 18. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as B22.
[0425] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137 or a conservative modification thereof. SEQ ID NOs: 135-137 are provided in Table 18.
[0426] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140 or a conservative modification thereof. SEQ ID NOs: 138-140 are provided in Table 18.
[0427] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140 or a conservative modification.
[0428] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140.
TABLE-US-00019 TABLE18 CDRs 1 2 3 V.sub.H GFTENNF KQDGSE ESYFDL [SEQIDNO:135] [SEQIDNO:136] [SEQIDNO:137] V.sub.L RSSTGAVTTSNYAN GTNNRAP ALWYSNRWV [SEQIDNO:138] [SEQIDNO:139] [SEQIDNO:140] FullV.sub.H EVQLVESGGGLVQPGGSLRLSCAASGFTENNFWMSWVRQAPGKGLEWVANIKQD GSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARESYFDLWGRG TLVTVSS [SEQIDNO:141] FullV.sub.L QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTN NRAPGVPARESGSLIGDKAALTITGAQTEDEAIYFCALWYSNRWVEGGGTKLTV L[SEQIDNO:142] DNAfor GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTG FullV.sub.H AGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAATAACTTTTGGATGAGCTGG GTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCAACATAAAGCAAGAT GGAAGTGAGAAATACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGA GACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGAC ACGGCTGTGTATTACTGTGCGAGAGAGAGTTACTTCGATCTCTGGGGCCGTGGC ACCCTGGTCACTGTCTCCTCA [SEQIDNO:143] DNAfor CAGGCTGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAACAGTC FullV.sub.L ACACTCACTTGTCGCTCAAGTACTGGGGCTGTTACAACTAGTAACTATGCCAAC TGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTAATAGGTGGTACCAAC AACCGAGCTCCAGGTGTTCCTGCCAGATTCTCAGGCTCCCTGATTGGAGACAAG GCTGCCCTCACCATCACAGGGGCACAGACTGAGGATGAGGCAATATATTTCTGT GCTCTATGGTACAGCAACCGCTGGGTGTTCGGTGGAGGAACCAAACTGACTGTC CTA [SEQIDNO:144]
[0429] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 19. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 147, as shown in Table 19. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 147 is set forth in SEQ ID NO: 149. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 148. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 148 is set forth in SEQ ID NO: 150. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 147 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 148. SEQ ID NO: 147-150 are provided in Table 19. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as C22.
[0430] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 145 are provided in Table 19.
[0431] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 or a conservative modification thereof. SEQ ID NOs: 57, 125, and 146 are provided in Table 19.
[0432] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 or a conservative modification.
[0433] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125.
TABLE-US-00020 TABLE19 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS VADIVGATEDY [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:145] V.sub.L RASQSVSSSYLA GASSWAT QQYDSSPYT [SEQIDNO:57] [SEQIDNO:146] [SEQIDNO:125] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPS GGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARVADIVGATED YWGQGTLVTVSS [SEQIDNO:147] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS WATGIPDRESGSGSGTDETLTISRLEPEDFAVYYCQQYDSSPYTFGQGTKLEIK [SEQIDNO:148] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAAGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGCACTAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGAGTGGCGGACATAGTGGGAGCTACTTTTGAC TACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:149] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC TGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAACCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGATAGCTCACCCTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:150]
[0434] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 20. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 153, as shown in Table 20. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 153 is set forth in SEQ ID NO: 155. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 154. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 154 is set forth in SEQ ID NO: 156. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 153 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 154. SEQ ID NO: 153-156 are provided in Table 20. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as D8.
[0435] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152 or a conservative modification thereof. SEQ ID NOs: 2, 151, and 152 are provided in Table 20.
[0436] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 or a conservative modification thereof. SEQ ID NOs: 57, 58, and 82 are provided in Table 20.
[0437] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a V.sub.H CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 or a conservative modification.
[0438] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82.
TABLE-US-00021 TABLE20 CDRs 1 2 3 V.sub.H GYTFTTY NPSGGS QGHYIGNYLDY [SEQIDNO:151] [SEQIDNO:2] [SEQIDNO:152] V.sub.L RASQSVSSSYLA GASSRAT QQYGSSP [SEQIDNO:57] [SEQIDNO:58] [SEQIDNO:82] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTTYYMHWVRQAPGQGLEWMGIINPS GGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARQGHYIGNYLD YWGQGTLVTVSS [SEQIDNO:153] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS RATGIPDRESGSGSGTDETLTISRLEPEDFAVYYCQQYGSSPFGQGTKLEIK [SEQIDNO:154] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCACCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGACAGGGCCATTATATTGGGAACTACCTTGAC TACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:155] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC AGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGGTAGCTCACCTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:156]
[0439] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 21. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 157, as shown in Table 21. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 157 is set forth in SEQ ID NO: 159. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 158. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 158 is set forth in SEQ ID NO: 160. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 157 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 158. SEQ ID NO: 157-160 are provided in Table 21. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as G16.
[0440] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 or a conservative modification thereof. SEQ ID NOs: 2, 21, and 123 are provided in Table 21.
[0441] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 or a conservative modification thereof. SEQ ID NOs: 58, 59, and 124 are provided in Table 21.
[0442] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 or a conservative modification.
[0443] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59.
TABLE-US-00022 TABLE21 CDRs 1 2 3 V.sub.H GYTFTSY NPSGGS QGGAQWLVLAFDI [SEQIDNO:21] [SEQIDNO:2] [SEQIDNO:123] V.sub.L RASQSVSSYLA GASSRAT QQYGSSPYT [SEQIDNO:124] [SEQIDNO:58] [SEQIDNO:59] FullV.sub.H QVQLVQSGAEVKKPGASVQVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPS GGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARQGGAQWLVLA FDIWGQGTMVTVSS [SEQIDNO:157] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSR ATGIPDRESGGGSGTDFTLTISRLEPEDFAVYYCQQYGSSPYTFGQGTKLEIK [SEQIDNO:158] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H CAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGT GGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGACAGGGGGGAGCCCAGTGGCTGGTACTTGCT TTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCTTCA [SEQIDNO:159] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCTACTTAGCCTGGTAC CAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGG GCCACTGGCATCCCAGACAGGTTCAGTGGCGGTGGGTCTGGGACAGACTTCACT CTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAG TATGGTAGCTCACCGTACACTTTTGGCCAGGGGACCAAGCTGGAGATCAAA [SEQIDNO:160]
[0444] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 22. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 163, as shown in Table 22. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 163 is set forth in SEQ ID NO: 165. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 164. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 164 is set forth in SEQ ID NO: 166. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 163 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 164. SEQ ID NO: 163-166 are provided in Table 22. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as F21.
[0445] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161 or a conservative modification thereof. SEQ ID NOs: 11, 136, and 161 are provided in Table 22.
[0446] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162 or a conservative modification thereof. SEQ ID NOs: 73, 74, and 162 are provided in Table 22.
[0447] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162 or a conservative modification.
[0448] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162.
TABLE-US-00023 TABLE22 CDRs 1 2 3 V.sub.H GFTESSY KQDGSE EWLRFGGLVY [SEQIDNO:11] [SEQIDNO:136] [SEQIDNO:161] V.sub.L RASQSVSSNLA GASTRAT QQYNNWPLT [SEQIDNO:73] [SEQIDNO:74] [SEQIDNO:162] FullV.sub.H EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQD GSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREWLREGGLVY WGQGTLVTVSS [SEQIDNO:163] FullV.sub.L EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTR ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPLTFGGGTKVEIK [SEQIDNO:164] DNAfor GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTG FullV.sub.H AGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGTAGCTATTGGATGAGCTGG GTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCAACATAAAGCAAGAT GGAAGTGAGAAATACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGA GACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGAC ACGGCTGTGTATTACTGTGCGAGAGAGTGGCTACGATTTGGGGGCTTAGTGTAC TGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:165] DNAfor GAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAACTTAGCCTGGTAC CAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGG GCCACTGGTATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACT CTCACCATCAGCAGCCTGCAGTCTGAAGATTTTGCAGTTTATTACTGTCAGCAG TATAATAACTGGCCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA [SEQIDNO:166]
[0449] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 23. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 172, as shown in Table 23. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 172 is set forth in SEQ ID NO: 174. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 173. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 173 is set forth in SEQ ID NO: 175. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 172 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 173. SEQ ID NO: 172-175 are provided in Table 23. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as N12.
[0450] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168 or a conservative modification thereof. SEQ ID NOs: 96, 167, and 168 are provided in Table 23.
[0451] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171 or a conservative modification thereof. SEQ ID NOs: 169-171 are provided in Table 23.
[0452] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171 or a conservative modification.
[0453] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171.
TABLE-US-00024 TABLE23 CDRs 1 2 3 V.sub.H GYTFTGY NPNSGG DGVITSEDY [SEQIDNO:96] [SEQIDNO:167] [SEQIDNO:168] V.sub.L KSSQSVLYSSNIKTYLA WASTRES QQYYSAPYT [SEQIDNO:169] [SEQIDNO:170] [SEQIDNO:171] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPN SGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDGVITSFDYW GQGTLVTVSS[SEQIDNO:172] FullV.sub.L DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNIKTYLAWYQQKPGQPPKLLIY WASTRESGVPDRESGGGSGTDFTLTITSLQAEDVAVYYCQQYYSAPYTFGQGTKL EIK[SEQIDNO:173] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTCTCCTGCAAGGCTTCTGGATACACTTTCACCGGCTACTATATGCACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACCCTAAC AGTGGTGGCACAAACTATGCACAGAAGTTTCAGGGCAGGGTCACCATGACCAGG GACACGTCCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGAC ACGGCCGTGTATTACTGTGCGAGAGACGGGGTGATTACGTCTTTTGACTACTGG GGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:174] DNAfor GACATCGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGG FullV.sub.L GCCACCATCAACTGCAAGTCCAGCCAGAGTGTTTTATACAGCTCCAACATTAAG ACCTACTTAGCTTGGTACCAGCAGAAACCAGGACAGCCTCCTAAGCTGCTCATT TACTGGGCATCTACCCGGGAATCCGGAGTCCCTGACCGATTCAGTGGCGGCGGG TCTGGGACAGATTTCACTCTCACCATCACCAGCCTGCAGGCTGAAGATGTGGCA GTTTATTACTGTCAGCAGTATTATAGTGCTCCGTACACTTTTGGCCAGGGGACC AAGCTGGAGATCAAA [SEQIDNO:175]
[0454] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 24. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 180, as shown in Table 24. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 180 is set forth in SEQ ID NO: 182. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 181. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 181 is set forth in SEQ ID NO: 183. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 180 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 181. SEQ ID NO: 180-183 are provided in Table 24. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as G23.
[0455] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177 or a conservative modification thereof. SEQ ID NOs: 21, 176, and 177 are provided in Table 24.
[0456] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179 or a conservative modification thereof. SEQ ID NOs: 50, 178, and 179 are provided in Table 24.
[0457] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179 or a conservative modification.
[0458] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179.
TABLE-US-00025 TABLE24 CDRs 1 2 3 V.sub.H GYTFTSY DPSDGS DREYNYYGLDV [SEQIDNO:21] [SEQIDNO:176] [SEQIDNO:177] V.sub.L RSSQSLVYRDGNTYLN KVSNRDS MQGTHWPPT [SEQIDNO:178] [SEQIDNO:50] [SEQIDNO:179] FullV.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIHWVRQAPGQGLEWMGIIDPS DGSTNYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDREYNYYGLD VWGQGTTVTVSS [SEQIDNO:180] FullV.sub.L DVVMTQSPLSLPVTLGQPASISCRSSQSLVYRDGNTYLNWFQQRPGQSPRRLIY KVSNRDSGVPDRFRGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPTFGQGTK VEIK[SEQIDNO:181] DNAfor CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG FullV.sub.H AAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATACACTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCGACCCAAGT GATGGTAGCACAAACTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGG GACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTGTATTACTGTGCGAGAGATCGGGAATATAACTACTACGGTTTGGAC GTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA [SEQIDNO:182] DNAfor GATGTTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCTTGGACAGCCG FullV.sub.L GCCTCCATCTCCTGCAGGTCTAGTCAAAGCCTCGTATACCGTGATGGAAACACC TACTTGAATTGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGGCGCCTAATTTAT AAGGTTTCTAACCGGGACTCTGGGGTCCCAGACAGATTCCGCGGCAGTGGGTCA GGCACTGATTTCACACTGAAAATCAGCCGGGTGGAGGCTGAGGATGTTGGGGTT TATTACTGCATGCAAGGTACACACTGGCCTCCGACGTTCGGCCAAGGGACCAAG GTGGAAATCAAA SEQIDNO:183]
[0459] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 25. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 190, as shown in Table 25. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 190 is set forth in SEQ ID NO: 192. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 191. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 191 is set forth in SEQ ID NO: 193. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 190 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 191. SEQ ID NO: 190-193 are provided in Table 25. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as I1.
[0460] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186 or a conservative modification thereof. SEQ ID NOs: 184-186 are provided in Table 25.
[0461] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189 or a conservative modification thereof. SEQ ID NOs: 187-189 are provided in Table 25.
[0462] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189 or a conservative modification.
[0463] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189.
TABLE-US-00026 TABLE25 CDRs 1 2 3 V.sub.H GFTFSNTW IKSKSDGGTT TQYYWNSFDY [SEQIDNO:184] [SEQIDNO:185] [SEQIDNO:186] V.sub.L QASQDISNYLN DASNLET QQYDNLPLT [SEQIDNO:187] [SEQIDNO:188] [SEQIDNO:189] FullV.sub.H EVQLVESGGGLVKPGGSLRLSCAASGFTFSNTWMSWVRQAPGKGLEWVGRIKSK SDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTQYYWNSFDY WGQGTLVTVSS [SEQIDNO:190] FullV.sub.L DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNL ETGVPSRESGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPLTFGGGTKVEIK [SEQIDNO:191] DNAfor GAGGTGCAGCTGGTGGAGTCTGGGGGGGGCTTGGTAAAGCCTGGGGGGTCCCTT FullV.sub.H AGACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTAACACCTGGATGAGCTGG GTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTTGGCCGTATTAAAAGCAAA TCTGATGGTGGGACAACAGACTACGCTGCACCCGTGAAAGGCAGATTCACCATC TCAAGAGATGATTCAAAAAACACGCTGTATCTGCAAATGAACAGCCTGAAAACC GAGGACACAGCCGTGTATTACTGTACCCAGTATTATTGGAACTCCTTTGACTAC TGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:192] DNAfor GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGA FullV.sub.L GTCACCATCACTTGCCAGGCGAGTCAGGACATTAGCAACTATTTAAATTGGTAT CAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTACGATGCATCCAATTTG GAAACAGGGGTCCCATCAAGGTTCAGTGGAAGTGGATCTGGGACAGATTTTACT TTCACCATCAGCAGCCTGCAGCCTGAAGATATTGCAACATATTACTGTCAACAG TATGATAATCTCCCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA [SEQIDNO:193]
[0464] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 26. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 197, as shown in Table 26. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 197 is set forth in SEQ ID NO: 199. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 198. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 198 is set forth in SEQ ID NO: 200. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 197 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 198. SEQ ID NO: 197-200 are provided in Table 26. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as C8.
[0465] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195 or a conservative modification thereof. SEQ ID NOs: 11, 194, and 195 are provided in Table 26.
[0466] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196 or a conservative modification thereof. SEQ ID NOs: 4, 5, and 196 are provided in Table 26.
[0467] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196 or a conservative modification.
[0468] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196.
TABLE-US-00027 TABLE26 CDRs 1 2 3 V.sub.H GFTESSY KEDGSE DPGWAPEDY [SEQIDNO:11] [SEQIDNO:194] [SEQIDNO:195] V.sub.L RASQGISNYLA AASSLOS QQYNSFPYT [SEQIDNO:4] [SEQIDNO:5] [SEQIDNO:196] FullV.sub.H EVQLVESGGGLVQPGGSQRLSCAASGFTFSSYWMNWVRQAPGKGLEWVANIKED GSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDPGWAPFDYW GQGTLVTVSS [SEQIDNO:197] FullV.sub.L DIQMSQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLIYAASSL QSGVPSKFSGSGSGTDFTLAISSLQPEDFATYYCQQYNSFPYTFGQGTTLEIK [SEQIDNO:198] DNAfor GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCAG FullV.sub.H AGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGTAGCTATTGGATGAACTGG GTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCAACATAAAGGAAGAT GGAAGTGAGAAATACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGA GACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGAC ACGGCTGTGTATTACTGTGCGAGAGATCCGGGCTGGGCTCCCTTTGACTACTGG GGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:199] DNAfor GACATCCAGATGTCCCAGTCTCCATCCTCACTGTCTGCATCTGTAGGAGACAGA FullV.sub.L GTCACCATCACTTGTCGGGCGAGTCAGGGCATTAGCAATTATTTAGCCTGGTTT CAGCAGAAACCAGGGAAAGCCCCTAAGTCCCTGATCTATGCTGCATCCAGTTTG CAAAGTGGGGTCCCATCAAAGTTCAGCGGCAGTGGATCTGGGACAGATTTCACT CTCGCCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGCCAACAG TATAATAGTTTCCCGTACACTTTTGGCCAGGGGACCACGCTGGAGATCAAA [SEQIDNO:200]
[0469] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises V.sub.H and V.sub.L regions or CDRs selected from Table 27. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 205, as shown in Table 27. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 205 is set forth in SEQ ID NO: 207. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 206. An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 206 is set forth in SEQ ID NO: 208. In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 205 and a V.sub.L Comprising the amino acid sequence set forth in SEQ ID NO: 206. SEQ ID NO: 205-208 are provided in Table 27. In certain embodiments, the antibody or antigen-binding fragment thereof is designated as 018.
[0470] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203 or a conservative modification thereof. SEQ ID NOs: 201-203 are provided in Table 27.
[0471] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204 or a conservative modification thereof. SEQ ID NOs: 57, 58, and 204 are provided in Table 27.
[0472] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203 or a conservative modification thereof; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204 or a conservative modification.
[0473] In certain embodiments, the anti-DLL3 antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201 a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202, a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203; and a V.sub.L comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204.
TABLE-US-00028 TABLE27 CDRs 1 2 3 V.sub.H GGSINSY FYSGI IGVAGFYFDY [SEQIDNO:201] [SEQIDNO:202] [SEQIDNO:203] V.sub.L RASQSVSSSYLA GASSRAT QQYGTSPLT [SEQIDNO:57] [SEQIDNO:58] [SEQIDNO:204] FullV.sub.H QVQLQESGPGLVKPSETLSLTCTVSGGSINSYYWSWIRQPPGKGLEWIGYIFYS GITNYNPSLKSRVTISLDTSKNQFSLKLSSVTAADTAVYYCARIGVAGFYFDYW GQGTLVTVSS [SEQIDNO:205] FullV.sub.L EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS RATGIPDRESGSGSGTDETLTISRLEPEDFAVYYCQQYGTSPLTFGGGTKVEIK [SEQIDNO:206] DNAfor CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTG FullV.sub.H TCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAATAGTTACTACTGGAGCTGG ATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTTTTACAGT GGGATCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCATATCATTAGAC ACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACG GCCGTGTATTACTGTGCGAGAATCGGCGTGGCTGGTTTTTACTTTGACTACTGG GGCCAGGGAACCCTGGTCACCGTCTCCTCA [SEQIDNO:207] DNAfor GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGA FullV.sub.L GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGC AGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CAGTATGGTACCTCACCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA [SEQIDNO:208]
5.2.2. Antibody-TCO Conjugates and Radioligands
[0474] The presently disclosed subject matter is based, in part, on a rapid and selective in vivo biorthogonal reaction between trans-cyclooctene (TCO) and tetrazine (Tz). The use of antibody-TCO conjugates and small molecule tetrazine-based radioligands allows radioactive labeling of antibodies after accumulation at the target site in vivo.
[0475] In certain embodiments, an inverse electron demand Diels-Alder (IEDDA) reaction occurs between the tetrazine and transcyclooctene. The IEDDA cycloaddition as a click chemistry conjugation reaction has been shown to be extraordinarily rapid, with a second order rate constant greater than 30,000 M.sup.?1s.sup.?1. Furthermore, both components have been shown to be sufficiently stable in physiological settings, and amine-reactive variants (e.g., TCO-NHS and Tz-NHS) of both are commercially available.
[0476] In certain embodiments, the anti-DLL3 antibody-TCO conjugate comprises an anti-DLL3 antibody disclosed herein in Section 5.2.1. In certain embodiments, the anti-DLL3 antibody-TCO conjugate comprises a TCO moiety. In certain embodiments, the TCO moiety has formula:
##STR00003##
[0477] In certain embodiments, R is N, C, or an ester. In certain embodiments, R is a moiety capable of binding a biomolecule (e.g., an anti-DLL3 antibody disclosed herein). Non-limiting examples of moiety include NHS-ester, NCS, maleimide, PODS, DIBO, or DBCO. In certain embodiments, R comprises a linker. In certain embodiments, the linker attaches the TCO to the biomolecule (e.g., anti-DLL3 antibody). In certain embodiments, the linker comprises polyethylene glycol (PEG). In certain embodiments, the PEG comprises from about 1 unit to about 100 units. In certain embodiments, the linker comprises (poly)-L-lysine. In certain embodiments, the (poly)-L-lysine comprises from about 1 unit to about 200 units.
[0478] In certain embodiments, the TCO moiety has formula:
##STR00004##
[0479] Additional information on the synthesis and characterization of the TCOs used in the presently disclosed subject matter can be found in International Patent Publication No. WO2016/182804, the content of which is incorporated herein in its entirety.
[0480] In certain embodiments, the radioligand comprises a tetrazine moiety. A tetrazine is a compound that has a six-membered aromatic ring containing four nitrogen atoms with the molecular formula C.sub.2H.sub.2N.sub.4. In certain embodiments, tetrazine moieties are tetrazines modified with different electron withdrawing groups at the three and six position of the 1,2,4,5-tetrazine core to increase their reactivity and at the same time ensuring modest stability in aqueous solutions. Additional information on the synthesis and characterization of the tetrazines used in the presently disclosed subject matter can be found in International Patent Publication No. WO2016/182804, the content of which is incorporated herein in its entirety.
[0481] In certain embodiments, the radioligand comprises a radiolabel. In certain embodiments, the radiolabel comprises a radioactive isotope. In certain embodiments, the radioactive isotope is selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Ph, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra and .sup.149Tb. In certain embodiments, the radiolabel comprises a .sup.64Cu radioactive isotope. In certain embodiments, the radiolabel comprises a .sup.225Ac radioactive isotope. In certain embodiments, the radiolabel comprises a .sup.18F radioactive isotope. In certain embodiments, the radiolabel comprises a .sup.177Lu radioactive isotope. In certain embodiments, the radiolabel comprises a .sup.89Zr radioactive isotope.
[0482] In certain embodiments, the radiolabel has a decay energy in the range of 20 to 6,000 keV. Decay energies can be within the range of 60 to 200 keV for an Auger emitter, 100-2,500 keV for a beta emitter, and 4,000-6,000 keV for an alpha emitter. Maximum decay energies of useful beta-particle-emitting nuclides can range from 20-5,000 keV, 100-4,000 keV, or 500-2,500 keV. Decay energies of useful Auger-emitters can be <1,000 keV, <100 keV, or <70 keV. Decay energies of useful alpha-particle-emitting radionuclides can range from 2,000-10,000 keV, 3,000-8,000 keV, or 4,000-7,000 keV.
[0483] In certain embodiments, the radioligand comprises a chelator. In certain embodiments, the chelator is a sarcophagine-based chelator (SarAr). In certain embodiments, the chelator comprises sarcophagine or a derivative thereof. In certain embodiments, the chelator is a 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or a derivative thereof. In certain embodiments, the chelator is a 1,4,7-triazacyclononane-1,4-diacetate (NODA) or a derivative thereof.
[0484] In certain embodiments, the radioligand comprises a linker. In certain embodiments, the linker attaches the tetrazine moiety to the chelator. In certain embodiments, the linker comprises polyethylene glycol (PEG). In certain embodiments, the PEG comprises from about 1 unit to about 100 units. In certain embodiments, the linker comprises (poly)-L-lysine. In certain embodiments, the (poly)-L-lysine comprises from about 1 unit to about 200 units.
[0485] In certain embodiments, the tetrazine moiety and the chelator form a compound selected from the group consisting of: [0486] 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0487] 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0488] 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0489] 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0490] 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0491] 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0492] 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0493] 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0494] 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; [0495] 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0496] 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0497] 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and [0498] 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
[0499] Additional information on the synthesis and characterization of the radioligands used in the presently disclosed subject matter can be found in International Patent Publication No. WO2016/182804, the content of which is incorporated herein in its entirety.
5.3. Pharmaceutical Compositions
[0500] The presently disclosed subject matter provides compositions comprising a presently disclosed anti-DLL3 antibody-TCO conjugate (e.g., one disclosed in Section 5.2.2). The presently disclosed subject matter provides compositions comprising a presently disclosed radioligand (e.g., one disclosed in Section 5.2.2). In certain embodiments, the composition is a pharmaceutical composition further comprising a pharmaceutically acceptable carrier.
[0501] Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
[0502] Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the binding proteins. The compositions of the injection can, as is well known in the art, be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the mammal.
[0503] The presently disclosed antibody-TCO conjugates and the radioligands can be incorporated into pharmaceutical compositions suitable for administration. The pharmaceutical compositions generally comprise recombinant or substantially purified anti-DLL3 antibody-TCO conjugates and a pharmaceutically acceptable carrier in a form suitable for administration to a subject. The pharmaceutical compositions also comprise substantially purified radioligands and a pharmaceutically acceptable carrier in a form suitable for administration to a subject. Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions for administering the antibody compositions. The pharmaceutical compositions can be formulated as sterile, substantially isotonic and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug Administration.
[0504] The terms pharmaceutically acceptable, physiologically tolerable, and grammatical variations thereof, as they refer to compositions, carriers, diluents and reagents, are used interchangeably and represent that the materials are capable of administration to or upon a subject without the production of undesirable physiological effects to a degree that would prohibit administration of the composition. For example, pharmaceutically acceptable excipient means an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients can be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous. The term pharmaceutically acceptable salts and esters means salts and esters that are pharmaceutically acceptable and have the desired pharmacological properties. Such salts include salts that can be formed where acidic protons present in the composition are capable of reacting with inorganic or organic bases. Suitable inorganic salts include those formed with the alkali metals, e.g., sodium and potassium, magnesium, calcium, and aluminum. Suitable organic salts include those formed with organic bases such as the amine bases, e.g., ethanolamine, diethanolamine, triethanolamine, tromethamine, N-methylglucamine, and the like. Such salts also include acid addition salts formed with inorganic acids (e.g., hydrochloric and hydrobromic acids) and organic acids (e.g., acetic acid, citric acid, maleic acid, and the alkane- and arene-sulfonic acids such as methanesulfonic acid and benzenesulfonic acid). Pharmaceutically acceptable esters include esters formed from carboxy, sulfonyloxy, and phosphonoxy groups present in the antibody-TCO conjugates, e.g., C1-6 alkyl esters. When there are two acidic groups present, a pharmaceutically acceptable salt or ester can be a mono-acid-mono-salt or ester or a di-salt or ester; and similarly where there are more than two acidic groups present, some or all of such groups can be salified or esterified. An anti-DDL3 antibody-TCO conjugate named in this technology can be present in unsalified or unesterified form, or in salified and/or esterified form, and the naming of such anti-DDL3 antibody-TCO conjugate is intended to include both the original (unsalified and unesterified) compound and its pharmaceutically-acceptable salts and esters.
[0505] A presently pharmaceutical composition is formulated to be compatible with its intended and/or suitable route of administration. The presently disclosed antibody-TCO conjugates and the radioligands can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intradermal, transdermal, rectal, intracranial, intrathecal, intraperitoneal, intranasal; or intramuscular routes, or as inhalants.
5.4. Methods of Uses
[0506] The presently disclosed subject matter provides various methods of using the antibody-TCO conjugates, the radioligands, and compositions disclosed herein.
[0507] The presently disclosed subject matter provides methods of in vivo diagnosis of a disease or disorder in a subject. In certain embodiments, the method comprises administering to the subject the antibody-TCO conjugate disclosed herein or a composition comprising thereof. In certain embodiments, a portion of the antibody-TCO conjugate localizes at cells of the disease or disorder and unbound antibody-TCO conjugate is cleared from blood, from renal system, and/or from the subject after an accumulation interval. In certain embodiments, the method further comprises administering to the subject the radioligand disclosed herein or a composition comprising thereof, wherein the radioligand comprises a tetrazine moiety and a radiolabel. In certain embodiments, the antibody-TCO conjugate and the radioligand bind together to form a radioimmunoconjugate via an in vivo click reaction at the cells of the disease or disorder within a region of the subject. In certain embodiments, the method further comprises imaging the radioimmunoconjugate accumulated in the region of the subject. In certain embodiments, the imaging occurs via positron emission tomography (PET). In certain embodiments, the imaging occurs via single photon emission computed tomography. In certain embodiments, the imaging occurs within a time period of about 4 hours, about 8 hours, about 12 hours, about 24 hours, about 48 hours, up to about 72 hours, up to about 4 days, up to about 5 days, up to about 6 days, or up to about 7 days from the administering of the radioligand. In certain embodiments, the imaging occurs within a time period of between about 24 hours and up to about 7 days from the administering of the radioligand. In certain embodiments, the imaging occurs within a time period of less than about 9 hours from the administering of the radioligand.
[0508] In certain embodiments, the radioligand is administered to the subject after an accumulation interval. In certain embodiments, the accumulation interval is up to and including one day, up to and including two days, up to and including three days, up to and including four days, up to and including five days, up to and including six days, up to and including seven days, up to and including eight days, up to and including nine days, up to and including ten days, up to and including eleven days, up to and including twelve days, up to and including thirteen days, up to and including fourteen days, or up to and including fifteen days after administration of the antibody-TCO targeting probe. In certain embodiments, the accumulation interval is between about one day and about two days, between about one day and about three days, between about one day and about four days, between about one day and about five days, between about one day and about six days, between about one day and about seven days, between about one and about ten days, or between about one and about fourteen days after administration of the antibody-TCO conjugate. In certain embodiments, the accumulation interval depends on the body clearance and half-life of the antibody-TCO conjugate.
[0509] In certain embodiments, the radiolabel comprises a radioactive isotope that is selected from the group consisting of .sup.64Cu, .sup.18F, .sup.44Sc, .sup.72As, .sup.52Mn, .sup.124I, .sup.11C, .sup.13N, .sup.15O, .sup.86Y, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, and .sup.152Tb. In certain embodiments, the radiolabel comprises a .sup.64Cu radioactive isotope. In certain embodiments, the imaging comprises detecting the radioactive levels emitted by the radioimmunoconjugate. In certain embodiments, the radioactive levels emitted by the radioimmunoconjugate are expressed as the percentage injected dose per gram tissue (% ID/g).
[0510] Furthermore, the presently disclosed subject matter provides radiotherapies for treating a disease or disorder in a subject. In certain embodiments, the method comprises administering to the subject the antibody-TCO conjugate disclosed herein or a composition comprising thereof. In certain embodiments, a portion of the antibody-TCO conjugate localizes at cells of the disease or disorder and unbound antibody-TCO conjugate is cleared from blood, from renal system, and/or from the subject after an accumulation interval. In certain embodiments, the method further comprises administering to the subject the radioligand disclosed herein or a composition comprising thereof, wherein the radioligand comprises a tetrazine moiety and a radiolabel. In certain embodiments, the antibody-TCO conjugate and the radioligand bind together to form a radioimmunoconjugate via an in vivo click reaction at the cells of the disease or disorder within a region of the subject. In certain embodiments, the radioligand is administered to the subject after an accumulation interval. In certain embodiments, the accumulation interval is up to and including one day, up to and including two days, up to and including three days, up to and including four days, up to and including five days, up to and including six days, up to and including seven days, up to and including eight days, up to and including nine days, up to and including ten days, up to and including eleven days, up to and including twelve days, up to and including thirteen days, up to and including fourteen days, or up to and including fifteen days after administration of the antibody-TCO targeting probe. In certain embodiments, the accumulation interval is between about one day and about two days, between about one day and about three days, between about one day and about four days, between about one day and about five days, between about one day and about six days, between about one day and about seven days, between about one day and about ten days, or between about one day and about fourteen days after administration of the antibody-TCO conjugate. In certain embodiments, the accumulation interval depends on the body clearance and half-life of the antibody-TCO conjugate.
[0511] In certain embodiments, the radiolabel comprises an alpha-particle emitter radioactive isotope. In certain embodiments, the radiolabel comprises a beta-particle emitter radioactive isotope. In certain embodiments, the radiolabel comprises an auger emitter radioactive isotope. In certain embodiments, the radiolabel comprises a radioactive isotope that is selected from the group consisting of .sup.225Ac, .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Ph, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra and .sup.149Tb. In certain embodiments, the radiolabel comprises a .sup.225Ac radioactive isotope. In certain embodiments, the radiolabel is an alpha-particle emitter. Since certain tumors are generally radio-resistant, alpha-particle radiotherapy (e.g., using alpha-particle emitter radioligands such as .sup.225Ac) results in highly potent cell-killing activity with minimal collateral damage via high linear energy transfer alpha particle emissions with a range of 50-80 microns and 5-8 MeV energy. Unlike beta-particles that can deposit their energy over a longer distance, alpha-particle radiotherapy has a high therapeutic potential against small-volume tumors, including minimal residual disease which can be a major cause of cancer relapse.
[0512] In certain embodiments, the disease or disorder is associated with DLL3. In certain embodiments, the disease or disorder is associated with overexpression of DLL3. In certain embodiments, the disease or disorder is tumor. In certain embodiments, the tumor is cancer. In certain embodiments, the disease or disorder is selected from neuroendocrine tumors of the lung, extrapulmonary neuroendocrine carcinomas, melanoma, neuroendocrine prostate cancer, and breast cancer. In certain embodiments, the neuroendocrine tumors of the lung are selected from the group consisting of pulmonary neuroendocrine cancer (including typical carcinoid tumors, and atypical carcinoid tumors), large cell neuroendocrine carcinoma (LCNEC), and small-cell lung cancer. In certain embodiments, the melanoma is uveal melanoma. In certain embodiments, the breast cancer is triple negative breast cancer.
5.5. Kits
[0513] The presently disclosed subject matter provides kits for performing various methods disclosed herein (e.g., those disclosed in Section 5.4). In certain embodiments, the kit comprises the anti-DLL3 antibody-TCO conjugates (e.g., those disclosed in Section 5.2.2) or compositions comprising thereof disclosed herein (e.g., these disclosed in Section 5.3). In certain embodiments, the kit comprises the radioligands (e.g., one disclosed in Section 5.2.2) or compositions thereof disclosed herein. In certain embodiments, the kit comprises a sterile container which contains an anti-DDL3 antibody-TCO conjugate. In certain embodiments, the kit further comprises a sterile container which contains radioligand. Such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
[0514] In certain embodiments, the kit further comprises instructions for administering the antibody-TCO conjugates and the radioligands disclosed herein to a subject. The instructions can generally include information about the use of the antibody-TCO conjugates and the radioligands disclosed herein for in vivo diagnosis of a disease or disorder in a subject. In certain embodiments, instructions can include information about the use of the antibody-TCO conjugates and the radioligands disclosed herein for radiotherapies for treating a disease or disorder disclosed herein. In certain non-limiting embodiments, the instructions include at least one of the following: description of the therapeutic agents; dosage schedule and administration for treatment and/or prevention of a disease or disorder or symptoms thereof; precautions; warnings; indications; counter-indications; overdosage information; adverse reactions; animal pharmacology; clinical studies; and/or references. The instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
5.6. Exemplary Embodiments
[0515] A1. In certain embodiments, the presently disclosed subject matter provides an antibody-transcyclooctene (TCO) conjugate comprising an anti-DLL3 antibody or an antigen-binding fragment thereof comprising a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains; and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains, wherein the heavy chain variable region and light chain variable region CDR3 domains are selected from the group consisting of: [0516] a) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6 and a conservative modification thereof; [0517] b) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16 and a conservative modification thereof; [0518] c) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23 and a conservative modification thereof; [0519] d) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33 and a conservative modification thereof; [0520] e) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41 and a conservative modification thereof; [0521] f) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51 and a conservative modification thereof; [0522] g) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 and a conservative modification thereof; [0523] h) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65 and a conservative modification thereof; [0524] i) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75 and a conservative modification thereof; [0525] j) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 and a conservative modification thereof; [0526] k) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91 and a conservative modification thereof; [0527] l) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101 and a conservative modification thereof; [0528] m) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 and a conservative modification thereof; [0529] n) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112 and a conservative modification thereof; [0530] o) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118 and a conservative modification thereof; [0531] p) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 and a conservative modification thereof; [0532] q) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130 and a conservative modification thereof; [0533] r) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140 and a conservative modification thereof; [0534] s) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125 and a conservative modification thereof; [0535] t) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82 and a conservative modification thereof; [0536] u) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59 and a conservative modification thereof; [0537] v) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162 and a conservative modification thereof; [0538] w) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171 and a conservative modification thereof; [0539] x) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179 and a conservative modification thereof; [0540] y) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189 and a conservative modification thereof; [0541] z) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196 and a conservative modification thereof; and [0542] aa) a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203 and a conservative modification thereof; and a light chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204 and a conservative modification thereof.
[0543] A2. The foregoing antibody-TCO conjugate of A1, wherein the heavy chain variable region and light chain variable region CDR2 domains are selected from the group consisting of: [0544] a) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; [0545] b) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15 and a conservative modification thereof; [0546] c) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32 and a conservative modification thereof; [0547] d) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; [0548] e) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 and a conservative modification thereof; [0549] f) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; [0550] g) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 and a conservative modification thereof; [0551] h) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; [0552] i) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210 and a conservative modification thereof; [0553] j) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 and a conservative modification thereof; [0554] k) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; [0555] l) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; [0556] m) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100 and a conservative modification thereof; [0557] n) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58 and a conservative modification thereof; [0558] o) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139 and a conservative modification thereof; [0559] p) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146 and a conservative modification thereof; [0560] q) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74 and a conservative modification thereof; and [0561] r) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170 and a conservative modification thereof; [0562] s) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 and a conservative modification thereof; [0563] t) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188 and a conservative modification thereof; [0564] u) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof; and [0565] v) a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202 and a conservative modification thereof; and a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5 and a conservative modification thereof.
[0566] A3. The foregoing antibody-TCO conjugate of A1 or A2, wherein, wherein the heavy chain variable region and light chain variable region CDR1 domains are selected from the group consisting of: [0567] a) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 and a conservative modification thereof; [0568] b) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14 and a conservative modification thereof; [0569] c) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 and a conservative modification thereof; [0570] d) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31 and a conservative modification thereof; [0571] e) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 and a conservative modification thereof; [0572] f) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 and a conservative modification thereof; [0573] g) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 and a conservative modification thereof; [0574] h) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 and a conservative modification thereof; [0575] i) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90 and a conservative modification thereof; [0576] j) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99 and a conservative modification thereof; [0577] k) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117 and a conservative modification thereof; [0578] l) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124 and a conservative modification thereof; [0579] m) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138 and a conservative modification thereof; [0580] n) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 and a conservative modification thereof; [0581] o) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73 and a conservative modification thereof; [0582] p) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169 and a conservative modification thereof; [0583] q) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178 and a conservative modification thereof; [0584] r) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187 and a conservative modification thereof; [0585] s) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4 and a conservative modification thereof; and [0586] t) a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201 and a conservative modification thereof; and a light chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57 and a conservative modification thereof.
[0587] A4. The foregoing antibody-TCO conjugate of any one of A1-A3, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0588] a) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; [0589] b) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 12, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13; [0590] c) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22; [0591] d) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; [0592] e) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; [0593] f) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; [0594] g) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; [0595] h) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64; [0596] i) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71 and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72; [0597] j) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81; [0598] k) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89; [0599] l) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98; [0600] m) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; [0601] n) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116; [0602] o) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; [0603] p) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137; [0604] q) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145; [0605] r) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152; [0606] s) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161; [0607] t) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168; [0608] u) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177; [0609] v) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186; [0610] w) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195; or [0611] x) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203.
[0612] A5. The foregoing antibody-TCO conjugate of any one of A1-A4, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0613] a) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6; [0614] b) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16; [0615] c) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23; [0616] d) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33; [0617] e) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41; [0618] f) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51; [0619] g) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; [0620] h) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65; [0621] i) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75; [0622] j) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; [0623] k) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210; and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91; [0624] l) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101; [0625] m) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112; [0626] n) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118; [0627] o) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; [0628] p) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130; [0629] q) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140; [0630] r) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; [0631] s) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; [0632] t) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162; [0633] u) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169, a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171; [0634] v) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179; [0635] w) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 189; [0636] x) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196; or [0637] y) a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204.
[0638] A6. The foregoing antibody-TCO conjugate of any one of A1-A5, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0639] a) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6; [0640] b) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 12, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 14, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 15, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 16; [0641] c) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 22; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23; [0642] d) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33; [0643] e) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41; [0644] f) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 46, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 47, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51; [0645] g) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; [0646] h) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2 and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 64; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 65; [0647] i) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 70, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 71, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 72; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 75; [0648] j) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 80, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 81; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; [0649] k) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 87, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 88, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 89; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 90, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 210, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 91; [0650] l) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 97, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 98; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 99, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 101; [0651] m) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; [0652] n) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 106, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 107; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 112; [0653] o) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 115, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 116; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 117, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 100, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 118; [0654] p) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; [0655] q) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 56; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 130; [0656] r) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 135, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 137; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 138, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 139, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 140; [0657] s) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 145; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 146, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 125; [0658] t) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 151, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 152; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 82; [0659] u) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 123; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 124, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 59; [0660] v) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 136, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 161; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 73, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 74, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 162; [0661] w) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 96, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 167, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 168; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 169, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 170, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 171; [0662] x) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 176, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 177; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 178, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 179; [0663] y) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 184, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 185, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 186; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 187, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 188, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 188; [0664] z) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 11, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 194, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 195; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 196; or aa) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 201, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 202, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 203; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 57, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 58, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 204.
[0665] A7. The foregoing antibody-TCO conjugate of any one of A1-A6, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0666] a) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 1, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 2, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 3; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 4, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 6; [0667] b) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 28, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 29, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 30; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 31, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 32, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 33; or [0668] c) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 21, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 5, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41.
[0669] A8. The foregoing antibody-TCO conjugate of any one of A1-A7, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205.
[0670] A9. The foregoing antibody-TCO conjugate of any one of A1-A8, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205.
[0671] A10. The foregoing antibody-TCO conjugate of any one of A1-A9, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
[0672] A11. The foregoing antibody-TCO conjugate of any one of A1-A10, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
[0673] A12. The foregoing antibody-TCO conjugate of any one of A1-A11, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0674] a) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205; and [0675] b) a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
[0676] A13. The foregoing antibody-TCO conjugate of any one of A1-A12, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0677] a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, SEQ ID NO: 17, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 42, SEQ ID NO: 52, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 76, SEQ ID NO: 83, SEQ ID NO: 92, SEQ ID NO: 102, SEQ ID NO: 108, SEQ ID NO: 119, SEQ ID NO: 126, SEQ ID NO: 131, SEQ ID NO: 141, SEQ ID NO: 147, SEQ ID NO: 153, SEQ ID NO: 157, SEQ ID NO: 163, SEQ ID NO: 172, SEQ ID NO: 180, SEQ ID NO: 190, SEQ ID NO: 197, or SEQ ID NO: 205; and [0678] b) a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 25, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 77, SEQ ID NO: 84, SEQ ID NO: 93, SEQ ID NO: 103, SEQ ID NO: 109, SEQ ID NO: 113, SEQ ID NO: 120, SEQ ID NO: 127, SEQ ID NO: 132, SEQ ID NO: 142, SEQ ID NO: 148, SEQ ID NO: 154, SEQ ID NO: 158, SEQ ID NO: 164, SEQ ID NO: 173, SEQ ID NO: 181, SEQ ID NO: 191, SEQ ID NO: 198, or SEQ ID NO: 206.
[0679] A14. The foregoing antibody-TCO conjugate of any one of A1-A13, wherein the anti-DLL3 antibody or antigen-binding fragment thereof comprises: [0680] a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8; [0681] b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 17, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 18; [0682] c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 24, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 25; [0683] d) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 34, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 35; [0684] e) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 42, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 43; [0685] f) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 52, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 53; [0686] g) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 60, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 61; [0687] h) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 66, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 67; [0688] i) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 76, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 77; [0689] j) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 83, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 84; [0690] k) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 92, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 93; [0691] l) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 102, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 103; [0692] m) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 108, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 109; [0693] n) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 108, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 113; [0694] o) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 120; [0695] p) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 126, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 127; [0696] q) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 132; [0697] r) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 141, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 142; [0698] s) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 147, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 148; [0699] t) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 153, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 154; [0700] u) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 157, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 158; [0701] v) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 163, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 164; [0702] w) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 172, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 173; [0703] x) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 180, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 181; [0704] y) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 190, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 191; [0705] z) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 197, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 198; or aa) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 205, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 206.
[0706] A15. The foregoing antibody-TCO conjugate of any one of A1-A14, comprising: [0707] a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 7, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8; [0708] b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 34, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 35; or [0709] c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 42, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 43.
[0710] A16. The foregoing antibody-TCO conjugate of any one of A1-A15, wherein the TCO has formula
##STR00005##
[0711] and wherein R is N, C, or an ester.
[0712] A17. The foregoing antibody-TCO conjugate of A16, wherein the TCO has formula
##STR00006##
[0713] B1. In certain non-limiting embodiments, the presently disclosed subject matter provides a composition comprising the antibody-TCO conjugate of any one of A1-A17.
[0714] B2. The foregoing composition of B1, which is pharmaceutical composition further comprising pharmaceutically acceptable carrier.
[0715] C1. In certain non-limiting embodiments, the presently disclosed subject matter provides a radioimmunoconjugate comprising the antibody-TCO conjugate of any one of A1-A17 and a radioligand comprising a tetrazine moiety (Tz) and a radiolabel.
[0716] C2. The foregoing radioimmunoconjugate of C1, wherein the radiolabel comprises a radioactive isotope selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Ph, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac .sup.212Bi, .sup.213Bi .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra, and .sup.149Tb.
[0717] C3. The foregoing radioimmunoconjugate of C1 or C2, wherein the radiolabel comprises a .sup.64Cu radioactive isotope.
[0718] C4. The foregoing radioimmunoconjugate of C1 or C2, wherein the radiolabel comprises a .sup.225Ac radioactive isotope.
[0719] C5. The foregoing radioimmunoconjugate of any one of C1-C4, further comprising a chelator.
[0720] C6. The foregoing radioimmunoconjugate of C5, wherein the chelator is a sarcophagine chelator.
[0721] C7. The foregoing radioimmunoconjugate of C5, wherein the chelator is 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or 1,4,7-triazacyclononane-1,4-diacetate (NODA).
[0722] C8. The foregoing radioimmunoconjugate of any one of C1-C7, further comprising a linker attaching the tetrazine moiety (Tz) to the chelator.
[0723] C9. The foregoing radioimmunoconjugate of C8, wherein the linker comprises is polyethylene glycol (PEG) or (poly)-L-lysine.
[0724] C10. The foregoing radioimmunoconjugate of C9, wherein the polyethylene glycol (PEG) comprises from about 1 unit to about 100 units.
[0725] C11. The foregoing radioimmunoconjugate of C9, wherein the (poly)-L-lysine comprises from about 1 unit to about 200 units.
[0726] C12. The foregoing radioimmunoconjugate of any one of C1-C11, wherein the tetrazine moiety (Tz) and the chelator form a compound selected from the group consisting of: [0727] a) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0728] b) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0729] c) 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0730] d) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0731] e) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0732] f) 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0733] g) 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0734] h) 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0735] i) 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; [0736] j) 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0737] k) 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0738] l) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and [0739] m) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
[0740] C13. The foregoing radioimmunoconjugate of any one of C1-C12, wherein the antibody-TCO conjugate and the radioligand bind together to form the radioimmunoconjugate via an in vivo click reaction.
[0741] D1. In certain embodiments, the presently disclosed subject matter provides a method of in vivo diagnosis of a disease or disorder associated with DLL3 in a subject, comprising: [0742] a) administering to the subject the antibody-TCO conjugate of any one of A1-A17 or the composition of B1 or B2, wherein a portion of the antibody-TCO conjugate localizes at cells of the disease or disorder and unbound antibody-TCO conjugate is cleared from blood, from renal system, and/or from the subject after an accumulation interval, [0743] b) administering to the subject the a radioligand comprising a tetrazine moiety (Tz) and a radiolabel or a composition comprising the radioligand, wherein the antibody-TCO conjugate and the radioligand bind together to form a radioimmunoconjugate via an in vivo click reaction at the cells of the disease or disorder within a region of the subject; and [0744] c) imaging the radioimmunoconjugate accumulated in the region of the subject.
[0745] D2. The foregoing method of D1, wherein the radioligand is delivered to the subject after the accumulation interval.
[0746] D3. The foregoing method of D1 or D2, wherein the imaging occurs via positron emission tomography (PET).
[0747] D4. The foregoing method of any one of D1-D3, wherein the imaging occurs within a time period up to about 7 days from the administering of the radioligand.
[0748] D5. The foregoing method of claim any one of D1-D4, wherein the radiolabel comprises a radioactive isotope selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Ph, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra, and .sup.149Tb.
[0749] D6. The foregoing method of any one of D1-D5, wherein the radiolabel comprises a .sup.64Cu radioactive isotope.
[0750] D7. The foregoing method of any one of D1-D5, wherein the radiolabel comprises a 18F radioactive isotope.
[0751] D8. The foregoing method of any one of D1-D7, wherein the radioligand further comprises a chelator.
[0752] D9. The foregoing method of D8, wherein the chelator is a sarcophagine chelator.
[0753] D10. The foregoing method of D9, wherein the chelator is 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or 1,4,7-triazacyclononane-1,4-diacetate (NODA).
[0754] D11. The foregoing method of any one of D1-D10, wherein the radioligand further comprises a linker attaching the tetrazine moiety (Tz) to the chelator.
[0755] D12. The foregoing method of D11, wherein the linker comprises is polyethylene glycol (PEG) or (poly)-L-lysine.
[0756] D13. The foregoing method of D12, wherein the polyethylene glycol (PEG) comprises from about 1 unit to about 100 units.
[0757] D14. The foregoing method of D12, wherein the (poly)-L-lysine comprises from about 1 unit to about 200 units.
[0758] D15. The foregoing method of D1-D14, wherein the tetrazine moiety (Tz) and the chelator form a compound selected from the group consisting of: [0759] a) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0760] b) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0761] c) 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0762] d) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0763] e) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0764] f) 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0765] g) 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0766] h) 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0767] i) 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; [0768] j) 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0769] k) 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0770] l) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and [0771] m) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
[0772] D16. The foregoing method of any one of D1-D15, wherein the imaging comprises detecting the radioactive levels emitted by the radioimmunoconjugate.
[0773] D17. The foregoing method of D16, wherein the radioactive levels emitted by the radioimmunoconjugate are expressed as the percentage injected dose per gram tissue (% ID/g).
[0774] E1. In certain non-limiting embodiments, the presently disclosed subject matter provides a method for treating a disease or disorder associated with DLL3 in a subject, comprising: [0775] a) administering to the subject the antibody-TCO conjugate of any one of A1-A17 or the composition of B1 or B2, wherein a portion of the antibody-TCO conjugate localizes at cells of the disease or disorder and unbound antibody-TCO conjugate is cleared from blood, from renal system, and/or from the subject after an accumulation interval; and [0776] b) administering to the subject the a radioligand comprising a tetrazine moiety (Tz) and a radiolabel or a composition comprising the radioligand, wherein the antibody-TCO conjugate and the radioligand bind together to form a radioimmunoconjugate via an in vivo click reaction at the cells of the disease or disorder within a region of the subject, and wherein the radiolabel comprises a radioactive isotope selected from the group consisting of .sup.99mTc, .sup.111In, .sup.44Sc, .sup.47Sc, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.77As, .sup.52Mn, .sup.186Re, .sup.153Sm, .sup.177Lu, .sup.67Cu, .sup.123I, .sup.124I, .sup.125I, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.166Ho, .sup.149Pm, .sup.90Y, .sup.86Y, .sup.213Bi, .sup.103Pd, .sup.109Pd, .sup.159Gd, .sup.140La, .sup.198Au, .sup.199Au, .sup.175Yb, .sup.169Yb, .sup.165Dy, .sup.166Dy, .sup.105Ph, .sup.111Ag, .sup.89Zr, .sup.192Ir, .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.76Br, .sup.55Co, .sup.60Cu, .sup.61Cu, .sup.62Cu, .sup.66Ga, .sup.90Nb, .sup.212Pb, .sup.152Tb, .sup.77Br, .sup.211At, .sup.227Th, .sup.224Ra, and .sup.149Tb.
[0777] E2. The foregoing method of E1, wherein the radioligand is delivered to the subject after the accumulation interval.
[0778] E2. The foregoing method of E1 or E2, wherein the radioligand further comprises a chelator.
[0779] E3. The foregoing method of E2, wherein the chelator is a sarcophagine chelator.
[0780] E4. The foregoing method of E2, wherein the chelator is 1,4,7-triazonane-1,4,7-triyl-triacetic acid (NOTA) or 1,4,7-triazacyclononane-1,4-diacetate (NODA).
[0781] E5. The foregoing method of any one of E1-E4, wherein the radioligand further comprises a linker attaching the tetrazine moiety (Tz) to the chelator.
[0782] E6. The foregoing method of E5, wherein the linker comprises is polyethylene glycol (PEG) or (poly)-L-lysine.
[0783] E7. The foregoing method of E6, wherein the polyethylene glycol (PEG) comprises from about 1 unit to about 100 units.
[0784] E8. The foregoing method of E6, wherein the (poly)-L-lysine comprises from about 1 unit to about 200 units.
[0785] E9. The foregoing method of any one of E1-E8, wherein the tetrazine moiety (Tz) and the chelator form a compound selected from the group consisting of: [0786] a) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23-heptaoxa-2-azapentacosan-25-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0787] b) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0788] c) 2,2-(7-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-1-oxo-5,8,11,14,17,20,23,26,29,32,35-undecaoxa-2-azaheptatriacontan-37-yl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0789] d) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29-heptaoxa-2,8-diazahentriacontan-31-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0790] e) 2,2,2-(3-(4-(3-(1-(4-(1,2,4,5-tetrazin-3-yl)phenyl)-3,7-dioxo-11,14,17,20,23,26,29,32,35,38,41-undecaoxa-2,8-diazatritetracontan-43-yl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0791] f) 2,2,2-(3-(4-(3-(25,28-dioxo-28-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21-heptaoxa-24-azaoctacosyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0792] g) 2,2,2-(3-(4-(3-(37,40-dioxo-40-((6-(6-(pyridin-2-yl)-1,2,4,5-tetrazin-3-yl)pyridin-3-yl)amino)-3,6,9,12,15,18,21,24,27,30,33-undecaoxa-36-azatetracontyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0793] h) 2,2,2-(3-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)-3-oxo-6,9,12,15,18,21,24-heptaoxa-2-azaheptacosan-27-amido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0794] i) 2,2,2-(2-(4-(1-(4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenoxy)-3,6,9,12,15,18,21,24,27,30,33-undecaoxahexatriacontan-36-amido)benzyl)-1,4,7-triazonane-1,4,7-triyl)triacetic acid; [0795] j) 2,2,2-(3-(4-(3-(5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; [0796] k) 2,2-(7-(4-(3-(5-amino-6-((4-6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-1,4-diyl)diacetic acid; [0797] l) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid; and [0798] m) 2,2,2-(3-(4-(3-(5-amino-6-((5-amino-6-((5-amino-6-((4-(6-methyl-1,2,4,5-tetrazin-3-yl)benzyl)amino)-6-oxohexyl)amino)-6-oxohexyl)amino)-6-oxohexyl)thioureido)benzyl)-1,4,7-triazonane-2,5,8-triyl)triacetic acid.
[0799] E10. The foregoing method of any one of E1-E9, wherein the disease or disorder associated with DLL3 is a tumor.
[0800] E11. The foregoing method of E10, wherein the tumor is a cancer.
[0801] E12. The foregoing method of any one of E1-E11, wherein the disease or disorder associated with DLL3 is selected from neuroendocrine tumors of the lung, extrapulmonary neuroendocrine carcinomas, melanoma, neuroendocrine prostate cancer, and breast cancer.
[0802] E13. The method of E12, wherein the neuroendocrine tumors of the lung are selected from the group consisting of pulmonary neuroendocrine cancer, large cell neuroendocrine carcinoma, and small-cell lung cancer.
[0803] E14. The method of any one of E1-E13, wherein the subject is a human.
[0804] F1. In certain non-limiting embodiments, the presently disclosed subject matter provides a kit for in vivo diagnosis and/or treatment of a disease or disorder associated with DLL3 in a subject, comprising the antibody-TCO conjugate of any one of A1-A17 or the composition of B1 or B2, and a radioligand comprising a tetrazine moiety (Tz) and a radiolabel or a composition thereof.
[0805] F2. The foregoing kit of F1, wherein the kit further comprises written instructions for using the antibody-TCO conjugate and the radioligand for in vivo diagnosis and/or treatment of a disease or disorder associated with DLL3 in a subject.
6. EXAMPLES
[0806] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the antibodies, multi-specific antibodies, compositions comprising thereof, screening, and therapeutic methods of the presently disclosed subject matter, and are not intended to limit the scope of what the inventors regard as their presently disclosed subject matter. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1Generation of the Presently Disclosed Anti-DLL3 Antibodies and scFvs
[0807] The extracellular domain (ECD) of DLL3 (GenBank accession number Q9NY J7-1) corresponding to amino acids Ala27-Ala479 with a C-terminal 6?His tag produced in HEK293T cells stably expressing full length DLL3 were used as immunogens. Ablexis AlivaMAb Kappa Mice (Ablexis, San Diego, CA) harboring a human immunoglobulin repertoire were immunized either with soluble DLL3-ECD following standard immunization techniques over a period of 3 weeks. Splenocytes and draining lymph node cells from mice with high serum titers specific for DLL3 were harvested and fused with mouse myeloma cells to generate hybridomas using electrofusion. These hybridomas were then screened to identify the presence of antibodies that bound specifically to soluble DLL3-ECD by ELISA and full-length DLL3 protein on stably expressing 293 cells by flow cytometry versus parental 293 cells. In addition, these hybridomas were screened for reactivity with HEK293 cells stably expressing cynomolgus DLL3 or mouse DLL3. Hybridomas were selected for further investigation by ranking in flow cytometry for staining intensity on 293 DLL3 transfectants along with 4? C./37? C. staining to evaluate the internalization of the antibodies.
Example 2Epitope Binning of Panel of the Presently Disclosed Anti-DLL3 Monoclonal Antibodies
[0808] The panel of purified anti-DLL3 monoclonal antibodies and the reference monoclonal antibody were subjected to pairwise epitope binning on a Carterra? array surface plasmon resonance (SPR) assay platform (Carterra*Inc., Salt Lake City UT) where each monoclonal antibody was tested for the capture of Histidine-tagged DLL3 antigen (DLL3-His), and also for competing with every other antibody in the panel for the binding to DLL3-His. The antibodies were immobilized on a HC200M chip (ligand) through standard amine coupling techniques by the print array method. Then in each cycle antigen was injected across the entire array followed by a single antibody (analyte). At the end of each cycle the surface was regenerated to remove antigen and analyte before a new cycle started. As shown in the Table 28 below. These results demonstrate that the anti-DLL3-antibodies disclosed herein bind to distinct epitopes present in DLL3 protein. Accordingly, the anti-DLL3-antibodies disclosed herein can be used in combination with each other for delivering multiple therapeutic agents to tumor cells expressing DLL3
TABLE-US-00029 TABLE 28 Monoclonal Antibodies Epitope Bin E23 7 F9 4 E9 4 B22 2 N12 8 N10 7 B16-v1 4 B16-v2 4 L22 8 A18 6 D8 2 G16 4 K19 5 G3 1 J23 2 J8 4 L12 4 B2 4 C22 9 F21 5 O24 4 M11 2 P4 5
Example 3Binding Affinities of the Presently Disclosed Anti-DLL3 Antibodies
[0809] Binding affinities of the anti-DDL3 antibodies disclosed herein were determined by biolayer interferometry (BLI) using the Octet HTX instrument at 25? C. using PBS 0.1% BSA 0.02% Tween 20 as the binding buffer and 10 mM Glycine pH 1.7 as the regeneration buffer. The 23 purified monoclonal antibodies (5 ?g/mL each) were loaded onto anti-mouse Fc sensors. Loaded sensors were dipped into a serial dilutions of Recombinant Human DLL3 Protein, (amino acids Ala27-Ala479, cat #9749-DL, R&D Systems) at a 200 nM starting concentration, with 7 serial 1:3 dilutions. The binding affinities of all the monoclonal antibodies are shown in Table 29 below.
[0810] These results demonstrate that the anti-DLL3 antibodies disclosed herein specifically bind DLL3 with high affinity.
TABLE-US-00030 TABLE 29 Monoclonal antibodies Kd (nM) E23 0.511 F9 3.010 E9 0.300 B22 1.840 N12 0.467 N10 1.940 L22 3.550 A18 0.236 D8 0.438 G16 4.880 K19 1.890 G3 0.908 J23 0.998 J8 0.001 L12 3.100 B2 1.460 C22 0.431 F21 6.120 O24 1.280 M11 2.760 P4 6.500
[0811] Next, affinity, binding domain, and specificity of antibodies including scFv designated as J8, B2, and L22 were analyzed. Affinity, binding domain and specificity of novel human anti-DLL3 antibodies are depicted in Table 30 below.
TABLE-US-00031 TABLE 30 Affinity Binding ELISA ELISA ELISA Name hDLL3 domain hDLL3 hDLL1 hDLL4 B2 3.55 nM EGF-like 5 1.205 0.4 0.043 and EGF-like 6 J8 <0.001 nM EGF-like 5 1.377 0.095 0.085 and EGF-like 6 L22 1.46 nM EGF-like 3 1.639 0.105 0.056 and EGF-like 4
Example 4Screening of Novel Anti-DLL3 Antibodies for Pretargeted Imagining and Radioimmunotherapy
[0812] Small cell lung cancer (SCLC) is a particularly lethal form of lung cancer, accounting for roughly 15% of new lung cancer cases (Saunders et al., Sci Transl Med 2015; 7(302):302ra136). Delta-like ligand 3 (DLL3) has recently emerged as a therapeutic target in SCLC, in part because DLL3 cell surface expression is restricted almost exclusively to malignant tissue. Multiple DLL3-targeted therapies have been tested clinically, including the antibody-drug conjugate rovalpituzumab teserine (Rova-T); the bispecific T-cell engager AMG 757; and the CAR-T cell AMG 119 (Owen et al., J Hematol Oncol 2019; 12(1):61). As a companion diagnostic to evaluate DLL3 expression, an immunoPET strategy was developed by directly radiolabeling the DLL3-targeting SC16 antibody component of Rova-T with Zr-89 (Sharma et al., Cancer Res 2017; 77(14):3931-41). While the immunoPET tracer was able to clearly delineate subcutaneous, orthotopic, and metastatic SCLC xenografts in mice, optimal imaging was not achieved until 120 post-injection of the [.sup.89Zr]Zr-DFO-SC16 because of the antibody's slow pharmacokinetics.
[0813] Pretargeting strategies that combine antibodies with small molecule radioligands have recently gained popularity for both in vivo imaging and radioimmunotherapy of cancer (Zeglis et al., Mol Pharm 2015; 12(10):3575-87). Pretargeting, as illustrated in
[0814] The presently disclosed subject matter reports the preclinical imaging of anti-DLL3 monoclonal antibodies to find the antibody clone best suited for pretargeted immunoPET imaging and radioimmunotherapy. After in vitro screening of 27 anti-DLL3 antibodies for low internalization rates, three monoclonal IgG4 antibodies were further evaluated in vivo: A18, E9, and J8. To ensure adequate binding to DLL3 in vivo, the three antibodies were first bioconjugated to p-SCN-Bn-DFO chelators and then radiolabeled with Zr-89 for injection via tail vein into athymic female mice bearing right flank subcutaneous H82 xenografts (250-300 Ci, 30 ?g). ImmunoPET imaging was performed every 24 h until 120 h, when a terminal ex vivo biodistribution study was performed. The immunoPET images and ex vivo biodistribution profiles indicated strong tumor uptake of the antibodies in the xenografts, ranging from 20-50% ID/g, confirming that these antibodies have sufficient binding to DLL3 in vivo (see
[0815] Pilot pretargeting experiments were then performed using the bioorthogonal IEDDA chemistry between trans-cyclooctene (TCO, see
[0816] For pretargeted radioimmunotherapy, after allowing the antibody-TCO conjugates to accumulate at the tumor site and clear from non-target tissue for 72 h, a [.sup.177Lu]Lu-DOTA-Tz or a [.sup.225Ac]Ac-DOTA-Tz is injected.
Embodiments of the Presently Disclosed Subject Matter
[0817] From the foregoing description, it will be apparent that variations and modifications may be made to the presently disclosed subject matter to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.
[0818] The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or sub-combination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
[0819] All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.