Composition For Delivery Of Genetic Material

20190153445 ยท 2019-05-23

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to exosomes, loaded with genetic material and methods of producing them and to the use of such exosomes for delivering genetic material in vivo, in particular the use of such exosomes in methods of gene therapy or gene silencing.

    Claims

    1. A composition comprising exosomes comprising electroporated exogenous genetic material, wherein the electroporated exogenous genetic material is unnatural modified oligonucleotide.

    2. The composition of claim 1, wherein the unnatural modified oligonucleotide may be anyone or more of the following: a transplicing oligonucleotide, a morpholino (PMO), an antisense oligonucleotide (ASO), a peptide nucleic acid (PNA), an miRNA, an shRNA or an siRNA.

    3. The composition according to claim 1, wherein, the modification of the oligonucleotide is selected from any one or more of the following list: thio-nucleotide, phosphodiester, 2O-methyl, 2 methoxy-ethyl, phosphoramidate, methylphosphonate, phosphorothioate backbone chemistry, morpholino (PMO) or peptide nucleic acid (PNA).

    4. The composition according to claim 1, wherein the oligonucleotide is single-stranded or double stranded.

    5. The composition according to claim 1, wherein the exosomes comprise a targeting moiety expressed on the surface of the exosome.

    6. The composition according to claim 1, wherein the exosomes comprise an exosomal transmembrane protein which has been modified to incorporate the targeting moiety.

    7. The composition according to claim 6 wherein the exosomal transmembrane protein is selected from: Lamp-1, Lamp-2, CD13, CD86, Flotillin, Syntaxin-3, CD2, CD36, CD40, CD4.0L, CD41a, CD44, CD45, ICAM-I, Integrin alpha* L1CAM, LFA-I, Mac-1 alpha and beta, Vti-1 A and B, CD3 epsilon and zeta, CD9, CDl 8, CD37, CD53, CD63, CD81, CD82, CXCR4, FcR, GiuR2/3, HLA-DM (MHC II), immunoglobulins, MHC-I or MHC-II components, TCR beta or tetraspanins.

    8. A method of delivering an unnatural oligonucleotide in vivo comprising delivering the composition of claim 1 to a selected tissue or cell type.

    9. A method of loading exosomes with an unnatural modified oligonucleotide by electroporation.

    10. The method of loading exosomes according to claim 9 wherein the unnatural modified oligonucleotide may be any one or more of the following: a transplicing oligonucleotide, a morpholino (PMO), an antisense oligonucleotide (ASO), a peptide nucleic acid (PNA), an miRNA, an shRNA or an siRNA.

    11. The method of loading exosomes according to claim 9, wherein the modification of the oligonucleotide is selected from any one or more of the following list: thio-nucleotides, phosphodiester, 2O-methyl, 2 methoxy-ethyl, phosphoramidate, methylphosphonate, phosphorothioate backbone chemistry, morpholino (PMO) or peptide nucleic acid (PNA).

    12. The method of loading exosomes according to claim 9, wherein the oligonucleotide is single-stranded or double stranded.

    13. The method of loading exosomes according to claim 9, wherein at least 20% of the oligonucleotide is loaded into the exosomes.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0019] FIGS. 1A-1C. Characterization of exosomes from immature dendritic cells: FIG. 1A: Electron micrographs of exosomes stained with 2% uranyl acetate (exosomes negatively stained); FIG. 1B: Western blot of exosomes probed with anti-Lamp2, a membrane protein present in exosomes; FIG. 1C: Dynamic light scattering size measurements of purified dendritic cell exosomes in PBS from 5 different purifications

    [0020] FIGS. 2A-2E. Transfection of dendritic cells: FIG. 2A: Modification of Lamp-2b for transfection into dendritic cells. (SP=Signal Peptide; TP=targeting peptide; TM=transmembrane; CT=cytoplasmic tail); FIG. 2B: Western blot with anti-FLAG or anti-Lamp2 in untransfected dendritic cells (CTRL) or cell transfected with pLamp2b-FLAG (FLAG-Lamp2b) and the exosomes harvested from these cells; FIG. 2C: qRT-PCR of dendritic cells transfected with pLamp2b-MSP, -RVG or nothing using primers specific for MSP and RVG sequences; FIG. 2D: Western blot with anti-Lamp l after incubation of normal exosomes and FLAG exosomes with anti-FLAG beads or anti-AGO1 beads (non-binding control) in an exosome pulldown assay; FIG. 2E: Dynamic light scattering size measurements of purified MSP-exosomes.

    [0021] FIGS. 3A-3D. Electroporation of plasmid with exosome followed by DNase protection assay: FIG. 3A: DNase protection assay on various treatments of exosomes and the pEGFP-NAD plasmid. Linear DNA was made by cutting pEGFP-NAD with EcoRI. (Pre=exosomes pre-electroporated before addition of plasmid); FIG. 3B: Comparison of DNase degradation by DNase with circular plasmid at different electroporation settings; FIG. 3C: DNase protection assay after transfection of pEGFP-NAD with different transfection reagents; FIG. 3D: DNase protection assay after transfection of exosomes with transfection reagents 1-3 and pEGFP-NAD (see materials and methods).

    [0022] FIGS. 4A-4C. Exosome-mediated delivery of pEGFP-NAD into cells: FIG. 4A: Transfection of Neuro2A cells with wild-type exosomes and exosomes expressing RVG-Lamp2b (RVG-exosomes) transfected with pEGFP-NAD compared to plasmid alone after DNase treatment. FIGS. 4B and 4C: qRT-PCR quantification of fold change of eGFP after transfection with normal, RVG- or MSP-exosomes over transfection reagent alone.

    [0023] FIGS. 5A-5D. Knockdown of GAPDH with exosome-mediated siRNA delivery: FIGS. 5A and 5B: Representative images of Cy5-labelled GAPDH siRNA applied on to Neuro2A (FIG. 5A) and C2C12 (FIG. 5B) cells with normal or modified exosomes. Unelectroporated exosomes and siRNA were added as controls. FIGS. 5C and 5D: qPCR of GAPDH levels in Neuro2A cells and C2C12 cells harvested 2 days after transfection with siRNA alone (siRNA), siRNA with lipofectamine 2000 (Invitrogen) (siRNA+LP), normal exosomes (Exosomes), MSP exosomes (MSP exos) and RVG exosomes (RVG exos). (* p<0.05) Representative Western blots of GAPDH levels after similar transfections were performed (data not shown).

    [0024] FIGS. 6A-6B. Knockdown of cyclophilin B with exosome-mediated siRNA delivery: FIGS. 6A and 6B: qPCR of cyclophilin B levels in Neuro2A cells and C2C12 cells harvested 2 days after transfection with siRNA alone (siRNA), siRNA with lipofectamine 2000 (Invitrogen) (siRNA+LP), normal exosomes (Exosomes), MSP exosomes (MSP exos) and RVG exosomes (RVG exos). (* p<0.05) Representative Western blots of cyclophilin B levels after similar transfections were performed (data not shown).

    [0025] FIGS. 7A-7C. Retention of Cy3 and Cy5 labeled siRNA after electroporation with exosomes: FIG. 7A: Fluorescence correlates linearly to siRNA mass. FIGS. 7B and 7C: Absolute mass of labeled siRNA retained after FIG. 7B, 3 g of siRNA was electroporated with 3 g p.e. of RVG-exosomes in 200 l of buffer at the settings shown on the x-axis; FIG. 7C: 3 g of siRNA was electroporated with 3 g p.e. of RVG-exosomes at 400V 125 F in the volume of buffer shown on the x-axis. All experiments were performed in duplicate.

    [0026] FIGS. 8A and 8B. Delivery of 2-OMe oligonucleotide and morpholinos with normal exosomes: Fluorescence imaging of C2C12 cells 24 hours after Cy3-labelled (FIG. 8A) 2-OMe oligonucleotides or (FIG. 8B) PMO transfection with or without exosomes.

    [0027] FIGS. 9A-9J. In vivo delivery of siRNA with targeted exosomes results in CNS-specific gene knockdown: FIGS. 9A-9D: GAPDH qPCR in the striatum, midbrain, cortex, quadriceps muscle, spleen, liver, kidney and heart of mice 3 days after intravenous injection of 150 g naked GAPDH siRNA or siRNA encapsulated in unmodified exosomes, MSP-exosomes or RVG-exosomes normalised to untreated controls (100%). FIG. 9E: GAPDH qPCR of RNA extracted from the striatum, cortex and midbrain of untreated mice (control) or mice injected with empty RVG-exosomes intravenously twice on Day 1 and Day 8 then with RVG-exosome-encapsulated GAPDH siRNA (150 g) on Day 22 before sacrificing the mice on Day 25 (3 injections). FIGS. 9F and 9G: GAPDH qPCR and representative Western blot of mice injected with RVG-exosome encapsulated siRNA (150 g) on 2 separate occasions 6 and 3 days before sacrifice. Mice were injected intravenously with 150 g each of two BACE-1 siRNAs encapsulated in 150 g of RVG-exosomes 3 days before sacrifice and cortical sections were assayed with BACE-1 qPCR (FIG. 9I), BACE-1 Western blot (FIG. 9H) and, -amyloid 1-42 ELISA (FIG. 9J). All qPCR was normalised to 18S RNA levels. * indicates p <0.05 vs. untreated control. 3 mice were injected in each sample group and all error bars reflect standard deviation (n=3).

    DETAILED DESCRIPTION OF THE INVENTION

    [0028] The present invention is directed to exosomes, and their use as gene delivery vehicles. Exosomes are small membrane-bound vesicles of endocytic origin that are released into the extracellular environment following fusion of multivesicular bodies with the plasma membrane. Thus, the present application is directed to a composition comprising such exosomes. Typically, the exosomes are between 30 and 100 nm in diameter but can include membrane particles of similar origin up to 200 nm. Exosomes as used herein refers to nanoparticles of endosomal origin that are secreted from multivesicular bodies.

    [0029] Exosomes are produced by many different types of cells including immune cells such as B lymphocytes, T lymphocytes, dendritic cells (DCs) and most cells. Exosomes are also produced, for example, by glioma cells, platelets, reticulocytes, neurons, intestinal epithelial cells and tumour cells. Exosomes for use in accordance with the present application can be derived from any suitable cell, including the cells identified above. Exosomes have also been isolated from physiological fluids, such as plasma, urine, amniotic fluid and malignant effusions.

    [0030] In a preferred aspect of the present invention, exosomes are derived from DCs, preferably immature DCs. Exosomes produced from immature DCs do not express MHC-II, MHC-I or CD86. As such, such exosomes do not stimulate nave T cells to a significant extent and are unable to induce a response in a mixed lymphocyte reaction. Thus exosomes produced from immature dendritic cells are ideal candidates for use in delivery of genetic material, particularly for in vivo use, for example, in gene therapy.

    [0031] Thus, in accordance with the first aspect of the present invention, exosomes derived from dendritic cells are provided for use in in vivo delivery of genetic material.

    [0032] In an alternative aspect of the present invention, exosomes can be obtained from any autologous patient-derived, heterologous haplotype-matched or heterologous stem cells so to reduce or avoid the generation of an immune response in a patient to whom the exosomes are delivered. Any exosome-producing cell can be utilized for this specific purpose.

    [0033] As outlined above, exosomes are produced by many different types of cell and have also been isolated from physiological fluids. Thus, in accordance with the present invention, exosomes can be obtained from any suitable cell type as discussed above, or by isolation from physiological fluids. Typically, the methods of the present invention comprise isolation of the exosomes from cell culture medium or tissue supernatant.

    [0034] Exosomes produced from cells can be collected from the culture medium by any suitable method. Typically a preparation of exosomes can be prepared from cell culture or tissue supernatant by centrifugation, filtration or combinations of these methods. For example, exosomes can be prepared by differential centrifugation, that is low speed (<20000 g) centrifugation to pellet larger particles followed by high speed (>100000 g) centrifugation to pellet exosomes, size filtration with appropriate filters (for example, 0.22 m filter), gradient ultracentrifugation (for example, with sucrose gradient) or a combination of these methods.

    [0035] In accordance with the present invention, the exosomes are loaded with exogenous genetic material. In particular, in accordance with the present invention, exosomes are prepared and then loaded with the desired genetic material for delivery.

    [0036] Suitable genetic material for delivery includes exogenous DNA plasmid and siRNA. Suitable genetic material also includes modified oligonucleotides and other RNA interference effector moieties such as miRNA and shRNA. In accordance with one aspect of the present invention, the genetic material loaded into the exosome is not genetic material that is typically associated with the exosomes, for example, the nucleic acid is preferably not an mRNA or a miRNA which is incorporated into an exosome on its production from a cell. In particular, the present invention is concerned with the ability to load genetic material into an exosome preparation that has already been isolated from cells. Thus exogenous genetic material refers to genetic material inclusive of nucleic acids that is not normally associated with exosomes. In particularly preferred embodiments, the nucleic acid material is plasmid DNA or other nucleic acids such as siRNA and modified oligonucleotides which are not typically found in exosomes.

    [0037] Nucleic acids for incorporation into the exosomes may be single or double stranded. Single-stranded nucleic acids include those with phosphodiester, 2O-methyl, 2 methoxy-ethyl, phosphoramidate, methylphosphonate, and/or phosphorothioate backbone chemistry. Typically double-stranded nucleic acids are introduced including for example plasmid DNA and small interfering RNAs (siRNAs).

    [0038] The genetic material to be loaded into the exosomes is chosen on the basis of the desired effect of that genetic material on the cell into which it is intended to be delivered and the mechanism by which that effect is to be carried out. For example, the nucleic acid may be useful in gene therapy, for example in order to express a desired gene in a cell or group of cells. Such nucleic acid is typically in the form of plasmid DNA or viral vector encoding the desired gene and operatively linked to appropriate regulatory sequences such as promoters, enhancers and the like such that the plasmid DNA is expressed once it has been delivered to the cells to be treated. Examples of diseases susceptible to gene therapy include haemophilia B (Factor IX), cystic fibrosis (CTFR) and spinal muscular atrophy (SMN-1).

    [0039] Nucleic acid can also be used for example in immunisation to express one or more antigens against which it is desired to produce an immune response. Thus, the nucleic acid to be loaded into the exosome can encode one or more antigens against which is desired to produce an immune response, including but not limited to tumour antigens, antigens from pathogens such as viral, bacterial or fungal pathogens.

    [0040] Nucleic acid can also be used in gene silencing. Such gene silencing may be useful in therapy to switch off aberrant gene expression or in animal model studies to create single or more genetic knock outs. Typically such nucleic acid is provided in the form of siRNAs. For example, RNAi molecules including siRNAs can be used to knock down DMPK with multiple CUG repeats in muscle cells for treatment of myotonic dystrophy. In other examples, plasmids expressing shRNA that reduces the mutant Huntington gene (htt) responsible for Huntington's disease can be delivered with neuron specific exosomes. Other target genes include BACE-1 for the treatment of Alzheimer's disease. Some cancer genes may also be targeted with siRNA or shRNAs, such as ras, c-myc and VEGFR-2. Brain targeted siRNA loaded exosomes may be particularly useful in the silencing of BACE-1 in Alzheimer's disease, silencing of alpha-synuclein in Parkinson's disease, silencing of htt in Huntingdon's disease and silencing of neuronal caspase-3 used in the treatment of stroke to reduce ischaemic damage.

    [0041] Antisense modified oligonucleotides including 2-O-Me compounds and PNA can be used. For example, such oligonucleotides can be designed to induce exon-skipping for example the mutant dystrophin gene can be delivered to muscle cells for the treatment of Duchenne Muscular Dystrophy, antisense oligonucleotides which inhibit hairpin loops, for example in the treatment of myotonic dystrophy and trans-splicing oligonucleotides, for example for the treatment of spinal muscular atrophy.

    [0042] The exogenous genetic material can be introduced into the exosomes by a number of different techniques. In particularly preferred embodiments of the invention, the exosomes are loaded by electroporation or the use of a transfection reagent. The present inventors have identified that despite the small size of exosomes, it is still possible to use electroporation to load the exosomes with the exogenous genetic material. This is surprising in view of the small size of the exosomes compared to cells. Extrapolation of the voltages used for electroporation of cells to take into account the size of the exosomes would suggest that excessively high voltages would be required for electroporation of exosomes. Surprisingly however, the present inventors have identified that it is possible to use electroporation to load exosomes with plasmid DNA and siRNA. Typical voltages are in the range of 20V/cm to 1000V/cm, such as 20V/cm to 100V/cm with capacitance typically between 25 F and 250 F, such as between 25 F and 125 F.

    [0043] In an alternative aspect of the present invention, the inventors have also identified that it is possible to load exosomes using transfection agents. Despite the small size of the exosomes, conventional transfection agents can be used for transfection of exosomes with genetic material. Preferred transfection reagents for use in accordance with the present invention include cationic liposomes.

    Targeting

    [0044] The present invention also relates to the targeting of exosomes to a desired cell type or tissue. This targeting is achieved by expressing on the surface of the exosome a targeting moiety which binds to a cell surface moiety expressed on the surface of the cell to be targeted. Typically the targeting moiety is a peptide which is expressed as a fusion protein with a transmembrane protein typically expressed on the surface of the exosome.

    [0045] In more detail, the exosomes can be targeted to particular cell types or tissues by expressing on their surface a targeting moiety such as a peptide. Suitable peptides are those which bind to cell surface moieties such as receptors or their ligands found on the cell surface of the cell to be targeted. Examples of suitable targeting moieties are short peptides, scFv and complete proteins, so long as the targeting moiety can be expressed on the surface of the exosome and does not interfere with insertion of the membrane protein into the exosome. Typically the targeting peptide is heterologous to the transmembrane exosomal protein. Peptide targeting moieties may typically be less than 100 amino acids in length, for example less than 50 amino acids in length, less than 30 amino acids in length, to a minimum length of 10, 5 or 3 amino acids.

    [0046] Targeting moieties can be selected to target particular tissue types such as muscle, brain, liver, pancreas and lung for example, or to target a diseased tissue such as a tumour. In a particularly preferred embodiment of the present invention, the exosomes are targeted to brain tissue.

    [0047] Specific examples of targeting moieties include muscle specific peptide, discovered by phage display, [33] to target skeletal muscle, a 29 amino acid fragment of Rabies virus glycoprotein that binds to the acetylcholine receptor [36] or a fragment of neural growth factor that targets its receptor [37] to target neurons and secretin peptide that binds to the secretin receptor can be used to target biliary and pancreatic epithelia [38]. As an alternative, immunoglobulins and their derivatives, including scFv antibody fragments can also be expressed as a fusion protein to target specific antigens, such as VEGFR for cancer gene therapy. As an alternative, natural ligands for receptors can be expressed as fusion proteins to confer specificity, such as NGF which binds NGFR and confers neuron-specific targeting.

    [0048] The peptide targeting moiety is expressed on the surface of the exosome by expressing it as a fusion protein with an exosomal transmembrane protein. A number of proteins are known to be associated with exosomes; that is they are incorporated into the exosome as it is formed. The preferred proteins for use in accordance with the present invention are those which are transmembrane proteins. Examples include but are not limited to Lamp-1, Lamp-2, CD13, CD86, Flotillin, Syntaxin-3, CD2, CD36, CD40, CD40L, CD41a, CD44, CD45, ICAM-1, Integrin alpha4, L1CAM, LFA-1, Mac-1 alpha and beta, Vti-1A and B, CD3 epsilon and zeta, CD9, CD18, CD37, CD53, CD63, CD81, CD82, CXCR4, FcR, GluR, HLA-DM (MHC II), immunoglobulins, MHC-I or MHC-II components, TCR beta and tetraspanins. In particularly preferred embodiments of the present invention, the transmembrane protein is selected from Lamp-1, Lamp-2, CD13, CD86, Flotillin, Syntaxin-3. In a particularly preferred embodiment the transmembrane protein is Lamp-2. The sequence of Lamp-2 is set out in SEQ ID No 1.

    [0049] The following section relates to general features of all polypeptides of the invention, and in particular to variations, alterations, modifications or derivatisations of amino acid sequence which are included within the polypeptides of the invention. It will be understood that such variations, alterations, modifications or derivatisations of polypeptides as are described herein are subject to the requirement that the polypeptides retain any further required activity or characteristic as may be specified subsequent sections of this disclosure.

    [0050] Variants of polypeptides of the invention may be defined by particular levels of amino acid identity which are described in more detail in subsequent sections of this disclosure. Amino acid identity may be calculated using any suitable algorithm. For example the PILEUP and BLAST algorithms can be used to calculate homology or line up sequences (such as identifying equivalent or corresponding sequences (typically on their default settings), for example as described in Altschul S. F. (1993) J Mol Evol 36:290-300; Altschul, S, F et al (1990) J Mol Biol 215:403-10. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov). This algorithm involves first identifying high scoring sequence pair (HSPs) by identifying short words of length W in the query sequence that either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighbourhood word score threshold (Altschul et al, supra). These initial neighbourhood word hits act as seeds for initiating searches to find HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Extensions for the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a word length (W) of 11, the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1992) Proc. Natl. Acad. Sci. USA 89: 10915-10919) alignments (B) of 50, expectation (E) of 10, M=5, N=4, and a comparison of both strands.

    [0051] The BLAST algorithm performs a statistical analysis of the similarity between two sequences; see e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5787. One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two polynucleotide or amino acid sequences would occur by chance. For example, a sequence is considered similar to another sequence if the smallest sum probability in comparison of the first sequence to the second sequence is less than about 1, preferably less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001. Alternatively, the UWGCG Package provides the BESTFIT program which can be used to calculate homology (for example used on its default settings) (Devereux et al (1984) Nucleic Acids Research 12, 387-395).

    [0052] It will be understood that variants of polypeptides of the invention also includes substitution variants. Substitution variants preferably involve the replacement of one or more amino acids with the same number of amino acids and making conservative amino acid substitutions. For example, an amino acid may be substituted with an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid. Some properties of the 20 main amino acids which can be used to select suitable substituents are as follows:

    TABLE-US-00001 Ala aliphatic, hydrophobic, Met hydrophobic, neutral neutral Cys polar, hydrophobic, Asn polar, hydrophilic, neutral neutral Asp polar, hydrophilic, Pro hydrophobic, neutral charged () Glu polar, hydrophilic, Gln polar, hydrophilic, neutral charged () Phe aromatic, hydrophobic, Arg polar, hydrophilic, charged (+) neutral Gly aliphatic, neutral Ser polar, hydrophilic, neutral His aromatic, polar, Thr polar, hydrophilic, neutral hydrophilic, charged (+) Ile aliphatic, hydrophobic, Val aliphatic, hydrophobic, neutral neutral Lys polar, hydrophilic, Trp aromatic, hydrophobic, neutral charged (+) Leu aliphatic, hydrophobic, Tyr aromatic, polar, hydrophobic neutral

    [0053] The amino acid sequence of polypeptides for use in the invention may be modified to include non-naturally occurring chemistries or to increase the stability and targeting specificity of the compound. When the polypeptides are produced by synthetic means, such amino acids may be introduced during production. The polypeptides may also be modified following either synthetic or recombinant production.

    [0054] A number of side chain modifications are known in the art and may be made to the side chains of the polypeptides, subject to the polypeptides retaining any further required activity or characteristic as may be specified herein.

    [0055] Variant polypeptides as described in this section are those for which the amino acid sequence varies from that in SEQ ID NO: 1, but which retain the ability to be inserted into the membrane of an exosome.

    [0056] The variant sequences typically differ by at least 1, 2, 3, 5, 10, 20, 30, 50, 100 or more mutations (which may be substitutions, deletions or insertions of amino acids). For example, from 1 to 100, 2 to 50, 3 to 30 or 5 to 20 amino acid substitutions, deletions or insertions may be made, provided the modified polypeptide is inserted into the membrane of an exosome.

    [0057] Typically, polypeptides which are variants of Lamp-2 have more than about 50%, 55% or 65% identity, preferably at least 70%, at least 80%, at least 90% and particularly preferably at least 95%, at least 97% or at least 99% identity, with the amino acid sequence of SEQ ID NO: 1. The identity of variants of SEQ ID NO: 1 may be measured over a region of at least 30, 50, 100, 200, 250, 300, 350 or more contiguous amino acids of the sequence shown in SEQ ID NO: 1, or more preferably over the full length of SEQ ID NO: 1, excluding the signal sequence.

    [0058] The fragment of the Lamp-2 polypeptide used in the invention is typically at least 55 amino acids, 100, 150, 200, or 250 amino acids in length.

    [0059] The exosomal transmembrane protein is modified to incorporate a targeting moiety. Thus the exosomal transmembrane protein is expressed as a fusion protein comprising the targeting moiety. The targeting moiety is incorporated into the transmembrane protein such that it is positioned in the portion of the transmembrane protein present on the surface of the exosomes. In a preferred aspect of the present invention, the exosomal transmembrane protein is Lamp-2 and the targeting moiety is expressed as a fusion protein, wherein the targeting moiety is present near the N-terminus of Lamp-2 protein for example within 30, or within 20 amino acids of the Lamp-2 N terminal amino acid, not including the signal sequence.

    [0060] Spacer or linker sequences may be provided between the targeting moiety and the remainder of the transmembrane protein for example to avoid interference from the targeting moiety in the folding of the transmembrane protein.

    [0061] Linker or spacer sequences are typically 1 to 10 amino acids in length, typically 1 to 8 amino acids in length such as 2, 3 or 4 amino acids in length. Suitable amino acids for incorporation in linkers are alanine, arginine, serine or glycine. Suitable linkers include Ala-Arg and Ser-Gly-Gly.

    [0062] In a particularly preferred aspect of the present invention, the transmembrane protein is Lamp-2 and the targeting moiety is present at or near the N-terminus of the protein, separated from Lamp-2 with linker sequences.

    [0063] In the practice of the present invention, the targeting moiety is introduced into the exosome by expressing the fusion protein comprising the targeting moiety and exosomal transmembrane protein within a cell used to produce the exosomes. Expression of this fusion protein in the cell, allows for the fusion protein to be incorporated into the exosome as it is produced from the cell.

    [0064] For example, a polynucleotide construct such as a DNA plasmid, which expressed the fusion protein is transfected into the cell. Any suitable method can be used for introduction of the polynucleotide construct into the cell. The polynucleotide construct includes suitable promoter sequences so that the encoded fusion protein is expressed in the cell. Signal peptide sequences are also included so that the protein is incorporated into the membrane of the endoplasmic reticulum as it is produced. The membrane protein is then subsequently exported to the exosomal/lysomal compartment before incorporation into the exosome. The signal sequence is typically a signal peptide sequence for an exosomal transmembrane protein. For example the signal peptide sequence is preferably derived from Lamp-2, for example as shown in the Examples.

    [0065] Preferred cells for production of exosomes are discussed in more detail above. Typically a preferred cell, such as an immature dendritic cells is transfected with a polynucleotide construct as described above, such that the fusion protein of the invention is expressed in the cell. Exosomes produced by the cell can then be collected. Such exosomes have the fusion protein inserted into the membrane such that the exosomes are targeted to the desired tissue or cell type through the targeting moiety.

    [0066] Exosomes produced from cells can be collected from the culture medium by any suitable method. Typically a preparation of exosomes can be prepared from cell culture or tissue supernatant by centrifugation, filtration or combinations of these methods. For example, exosomes can be prepared by differential centrifugation, that is low speed (<20000 g) centrifugation to pellet larger particles followed by high speed (>100000 g) centrifugation to pellet exosomes, size filtration with appropriate filters (for example, 0.22 m filter), gradient ultracentrifugation (for example, with sucrose gradient) or a combination of these methods.

    [0067] In accordance with a preferred aspect of the present invention, the targeted exosomes are loaded with exogenous genetic material. In particular, in accordance with the present invention, exosomes are prepared with a targeting moiety as described herein and then loaded with the desired genetic material for delivery or described above.

    [0068] In other embodiments of the invention, a specific targeting moiety does not need to be included in the exosome. For example, exosomes may be administered directly to the site where therapy is required. Alternatively, for example, where exosomes contain genetic material encoding immunogens, direct targeting to a specific site may not be required and delivery, for example, intradermal or muscular delivery may be sufficient to generate the desired immune response without targeting exosomes to any specific cell type.

    [0069] In some embodiments of the invention, no targeting moiety is included on the surface of the exosomes. However, the exosomes are selected such that they are more likely to target a specific tissue type. For example, exosomes derived from different cells may have natural affinities for specific cell subtypes as required by their physiological function such as the well-established affinity of mature dendritic cell-derived exosomes to T-cells. This affinity may be utilized to specifically deliver above-mentioned cargo to a tissue.

    Delivery/Administration

    [0070] The constructs of the invention may be administered by any suitable means. Administration to a human or animal subject may be selected from parenteral, intramuscular, intracerebral, intravascular, subcutaneous, or transdermal administration. Typically the method of delivery is by injection. Preferably the injection is intramuscular or intravascular (e.g. intravenous). A physician will be able to determine the required route of administration for each particular patient.

    [0071] The constructs are preferably delivered as a composition. The composition may be formulated for parenteral, intramuscular, intracerebral, intravascular (including intravenous), subcutaneous, or transdermal administration. Compositions for parenteral administration may include sterile aqueous solutions which may also contain buffers, diluents and other suitable additives. The constructs of the invention may be formulated in a pharmaceutical composition, which may include pharmaceutically acceptable carriers, thickeners, diluents, buffers, preservatives, and other pharmaceutically acceptable carriers or excipients and the like in addition to the exosomes.

    [0072] A pharmaceutically acceptable carrier (excipient) is a pharmaceutically acceptable solvent, suspending agent or any other pharmacologically inert vehicle for delivering one or more nucleic acids to a subject. Typical pharmaceutically acceptable carriers include, but are not limited to, binding agents (e.g. pregelatinised maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose, etc); fillers (e.g. lactose and other sugars, microcrystalline cellulose, pectin, gelatin, calcium sulfate, ethyl cellulose, polyacrylates or calcium hydrogen phosphate, etc); lubricants (e.g. magnesium stearate, talc, silica, colloidal silicon dioxide, stearic acid, metallic stearates, hydrogenated vegetable oils, corn starch, polyethylene glycols, sodium benzoate, sodium acetate, etc); disintegrates (e.g. starch, sodium starch glycolate, etc); or wetting agents (e.g. sodium lauryl sulphate, etc).

    [0073] The compositions provided herein may additionally contain other adjunct components conventionally found in pharmaceutical compositions. Thus, for example, the compositions may contain additional compatible pharmaceutically-active materials or may contain additional materials useful in physically formulating various dosage forms of the composition of present invention, such as dyes, flavouring agents, preservatives, antioxidants, opacifiers, thickening agents and stabilizers. However, such materials, when added, should not unduly interfere with the biological activities of the components of the compositions provided herein.

    [0074] A therapeutically effective amount of composition is administered. The dose may be determined according to various parameters, especially according to the severity of the condition, age, and weight of the patient to be treated; the route of administration; and the required regimen. A physician will be able to determine the required route of administration and dosage for any particular patient. Optimum dosages may vary depending on the relative potency of individual constructs, and can generally be estimated based on EC50s found to be effective in vitro and in in vivo animal models. In general, dosage is from 0.01 mg/kg to 100 mg per kg of body weight. A typical daily dose is from about 0.1 to 50 mg per kg, preferably from about 0.1 mg/kg to 10 mg/kg of body weight, according to the potency of the specific construct, the age, weight and condition of the subject to be treated, the severity of the disease and the frequency and route of administration. Different dosages of the construct may be administered depending on whether administration is by intramuscular injection or systemic (intravenous or subcutaneous) injection. Preferably, the dose of a single intramuscular injection is in the range of about 5 to 20 g. Preferably, the dose of single or multiple systemic injections is in the range of 10 to 100 mg/kg of body weight.

    [0075] Due to construct clearance (and breakdown of any targeted molecule), the patient may have to be treated repeatedly, for example once or more daily, weekly, monthly or yearly. Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the construct in bodily fluids or tissues. Following successful treatment, it may be desirable to have the patient undergo maintenance therapy, wherein the construct is administered in maintenance doses, ranging from 0.01 mg/kg to 100 mg per kg of body weight, once or more daily, to once every 20 years.

    [0076] The invention is hereinafter described in more detail with reference to the following Examples.

    EXAMPLES

    [0077] We aimed to determine if exosomes can be reproducibly produced from dendritic cells harvested from murine bone marrow. Using a protocol modified from Quah et al. [28], bone marrow cells were harvested from femurs of C57BL/6 mice, dissociated with gentle mashing and cultured in the presence of DC medium (refer materials and methods) with 10 ng/ml GM-CSF, which stimulates proliferation of progenitor cells. Non-adherent cells were removed after 4 days, leaving dendritic cells in culture. After 7 days, GM-CSF is removed and fresh DC medium without GM-CSF is added to isolate exosomes. Exosomes are harvested daily over the next 2 days by centrifugation of culture supernatant, first at 10,000 g to remove cellular debris, then at 120,000 g to pellet exosomes. The exosomes are then resuspended in an appropriate amount of 0.1M ammonium acetate buffer.

    [0078] The exosomes produced were consistent and physically homogenous, with a size distribution peaking at 80nm in diameter as determined by electron microscopy (FIG. 1A), Western with an antibody against an exosomal protein (Lamp2b) (FIG. 1B) and dynamic light scattering (FIG. 1C).

    [0079] Transfection of a targeting ligand is required to alter the specificity of the exosomes in order to effectively target desired cell types. FIG. 2A illustrates how a targeting ligand is inserted into Lamp2b. As it is a type I membrane protein with an N-terminus predicted to protrude out of the exosome, the targeting ligand needs to be attached to the N-terminus after the signal peptide. The signal peptide is required for membrane insertion but is cleaved off in the mature protein. In addition, the targeting peptide is flanked by linkers (Ala-Arg-{Targeting Peptide}-Ser-Gly-Gly) to prevent the targeting peptide from influencing the folding of the Lamp2b protein. Ultimately, the targeting peptide should be located on the external surface of the exosomes, hence conferring targeting capabilities to the exosomes. Three different peptidesthe neuron-specific rabies viral glycoprotein (RVG) peptide (YTIWMPENPRPGTPCDIFTNSRGKRASNG (SEQ ID No: 6)) [32], a muscle-specific peptide (MSP) identified by in vivo phage display (ASSLNIA) (SEQ ID No: 9) [33], and a FLAG epitopewere separately cloned into Lamp2b and transfected into the dendritic cells 4 days before exosome purification. Both MSP and RVG were selected for organ specificity while the FLAG epitope in the targeting ligand site was used to differentiated modified Lamp2b and unmodified exogenous Lamp2b. A major hindrance to the ability to express targeting ligands on the surface of exosomes is that primary dendritic cells are difficult to transfect and can potentially differentiate after transfection. Infection with viral vectors is not ideal either as dendritic cells are likely to be activated by the virus [30], hence producing immunostimulatory molecules that will be incorporated into the resultant exosomes. Hence, a number of transfection reagents were tested and Minis Bio's TransIT-LT1 reagent was selected as it appeared to efficiently transduce dendritic cells, with a 49900 fold increase in eGFP mRNA normalized to murine GAPDH over the addition by pEGFP-NAD, an eGFP-expressing plasmid, alone without transfection reagents. More importantly, this transfection does not appear to significantly activate dendritic cells based on observation of cell morphology. Immature dendritic cells are compact rounded cells with low surface area-to-volume ratios while activated dendritic cells have characteristic dendritic extensions and large surface area-to-volume ratios [31].

    [0080] Meanwhile, Western blot against the FLAG ligand clearly demonstrates that FLAG-Lamp2b (115 kDa) is expressed in dendritic cells and corresponding exosomes after transfection of pLamp2b-FLAG but not in normal cells and exosomes (FIG. 2B). Expression of MSP-Lamp2b and RVG-Lamp2b was verified with qRT-PCR of dendritic cells transfected with pLamp2b-MSP and pLamp2b-RVG using specific primers for the MSP and RVG sequences (FIG. 2C).

    [0081] As the topology of Lamp2b on exosomes was unknown, a pulldown assay with anti-FLAG beads was designed to establish the orientation of the targeting epitope. Anti-FLAG antibody or a non-specific antibody (Agol) was bound to protein-A Sepharose beads (Sigma). These beads were then incubated with unmodified or FLAG-exosomes before 3 washes to remove non-binders. If the FLAG epitope was exclusively internal and inaccessible to the antibody, neither unmodified nor FLAG-exosomes should be retained on the beads; if the FLAG epitope was external, FLAG-exosomes would be retained but not unmodified exosomes. Following pulldown, the retained exosomes were denatured and detected by Western blot against LAMP-1, another exosomal protein that serves as a marker for the presence of exosomes. Western blot for Lamp 1, another exosome-specific protein, showed increased retention of FLAG-exosomes by anti-FLAG beads but not by control anti-Ago-1 (non-specific) beads (FIG. 2D). This result demonstrates that the targeting moiety is localized to the external exosomal surface and validating its targeting potential. These modifications do not appear to affect the physical properties of the modified exosomes based on dynamic light scattering of MSP-exosomes (FIG. 2E).

    PROTOCOL: Transfection of Dendritic Cells

    [0082] Transfection of dendritic cells was performed with 5 g of pEGFP-NAD or pLamp2b derivatives and 5 l of TransIT LT1 transfection reagent (Mirus Bio) in a 6-well plate with 10.sup.6 cells on Day 4 after harvesting. Medium is changed on Day 7 and exosomes are isolated from culture supernatant on Day 8.

    PROTOCOL: Transfection and Electroporation with Exosomes and DNase Protection Assay

    [0083] For the following experiments, an EGFP-expressing plasmid, pEGFP-NAD, was used as DNA cargo, Cy5-labeled anti-GAPDH siRNA and unlabelled anti-mouse cyclophilin B were used as RNA cargo and a Cy3-labeled 2-OMe oligonucleotide and a Cy3-labelled morpholino designed for exon skipping in mdx mice (gift from Haifang Yin) were used.

    [0084] Circular and linearized pEGFP-NAD were electroporated with exosomes and then exposed to DNase I for 10 minutes. If the DNA was successfully loaded in to the exosomes, the DNase will be unable to digest the DNA as it is unable to access the interior of the exosomes; conversely, if the DNA was not located within the exosomes, the presence of DNase will result in DNA degradation and the loss of a plasmid signal. When a DNase protection assay was performed on plasmid DNA, electroporation with exosomes appear to protect circular DNA plasmid from degradation but not linear DNA (FIG. 3A) and that lower capacitance appears to increase uptake of DNA into exosomes (FIG. 3B). To exclude the possibility that factors released from the exosomes by electroporation inhibited DNase activity, DNA was added to pre-electroporated exosomes as a control. In addition to that, it appears the super-coiled fraction is preferentially protected (higher band). This may be because exosomes are themselves 20-30nm yet an open circular plasmid 1868 nt in length can be over 100 nm in diameter, while a supercoiled plasmid is more compact and takes up significant less volume [34], hence supercoiled plasmids are preferentially protected.

    [0085] The difficulty of coming up with a suitable electroporation protocol is highlighted by inconsistent results and often low level of protection even when successful (results not shown). Artificially condensing DNA with spermine resulted in reduced DNase protection (results not shown), possibly because the concentration of spermine used is extremely critical in producing condensates of the right size [35]. Too little and no condensation occurs, but too much and large aggregates form, which may be the reason why the addition of spermine actually decreased the levels of DNase protection.

    [0086] A separate approach utilizing transfection instead of electroporation resulted in significant DNase protection for open circular plasmids. 1 g of the pEGFP-NAD plasmid was mixed with 1 l of the transfection reagent, exosomes (3 g) and topped up to 100 l with DMEM. The solution was incubated for 3 hours at 37 C. and then subjected to DNase treatment for 10 minutes at 37 C. with the addition of 1 l of RQ DNase I (Promega) and 10 l of RQ DNase buffer. The DNase was inactivated by 10 l of STOP buffer (Promega) before the DNase protection assay or the direct addition of the entire solution to Neuro2A or C2C12 cells in a 24-well format. Three different transfection reagents (1:Lipofectamine 2000 (Invitrogen); 2:TranslT LT1 (Minis Bio) 3: TurboFect (Fermantas)) were used to deliver open circular pEGFP-NAD into exosomes and preliminary results suggest that Reagent 3 resulted in significant DNase protection (FIG. 3D), suggesting that transfection reagents can be used to load genetic cargo into exosomes. The control experiments with transfection reagent alone seem to indicate the transfection reagent does not confer protection by itself (FIG. 3C). Despite the fact that open circular plasmids are predicted to be too large for exosomes, the addition of transfection reagent may serve to condense the plasmids as well as provide additional hydrophobic molecules to increase the size of the exosomes.

    [0087] For the DNase protection Assay, 20 l of the electroporated solution was added to 70 l of distilled water, 10 l of RQ DNase Buffer and 1 l RQ DNase I (Promega) and incubated at 37 C. for 10 min before inhibiting the reaction with 10 l of STOP buffer. 10 l of each sample was run on each lane in a 0.8% agarose TAE gel.

    PROTOCOL: Delivery of Genetic Material by Exosomes into Neuro2A and C2C12 cells

    [0088] Since exosomes were found to take up DNA plasmids readily upon electroporation and transfection, we hypothesized that exosomes loaded with pEGFP-NAD would be able to transfect cells in vitro. We added transfection reagent 3 (FIG. 3C) to pEGFP-NAD without exosomes, with wild type exosomes, or with exosomes harvested from dendritic cells transfected with pLamp2b-RVG (RVG-exosomes) or pLamp2b-MSP (MSP-exosomes) and DNase treated the mixture after incubation, including the sample with pEGFP-NAD and transfection reagent alone. The cells were then transfected directly with the mixture for 2 days and results suggest that both at the RNA level through qRT-PCR (FIGS. 4B and 4C) and at the protein level through GFP fluorescence (FIG. 4A), exosomes efficiently transferred pEGFP-NAD into target cells. In addition, results suggest that RVG and MSP peptides improve the uptake of pEGFP-NAD by increasing affinity to Neuro2A and C2C12 cells exclusively and this phenomenon is cell type-dependent.

    [0089] Given that exosomes were able to take up DNA plasmids and contain RNA naturally [26], siRNAs should also be readily taken up by exosomes. We hypothesized that exosomes would also be able to deliver siRNAs. Hence, a well characterized Cy5-labeled siRNA against GAPDH (Ambion) was electroporated into wild type, RVG- and MSP-exosomes and applied directly to Neuro2A and C2C12 cells. The cells were then imaged after 2 days and showed higher fluorescence when compared to control cells treated with siRNA and unelectroporated exosomes alone (FIG. 5A and 5B). Similar protocols were followed for the transfection of cells with exosomes and qRT-PCR of GAPDH normalised to 18S RNA (FIG. 5C and 5D) demonstrated significant knockdown in targeted exosomes compared to controls after 2 days, suggesting that the siRNAs were released into the cytoplasm after transfection to actively repress the endogenous target and that the targeting moiety effectively delivered the siRNA to the desired cell type i.e. neuron-specific RVG to neuronal Neuro2A cells and muscle specific MSP to C2C12 myoblasts. This knockdown was further confirmed with Western blot of the GAPDH protein (FIG. 5E and 5F).

    [0090] As further evidence of specific delivery, a second siRNA against murine cyclophilin B (PPIB) (Ambion) was also transfected similarly and demonstrated similar patterns of knockdown (FIG. 6) as measured by qPCR and Western blots.

    [0091] In order to quantify the loading efficiency of different electroporation protocols, 3 g of murine PPIB siRNA labelled with a Cy3 and a Cy5 fluorophore on either strand was mixed with 3 g p.e. of RVG-exosomes, added to an electroporation buffer based on Eppendorf Hypoosmolar Buffer and electroporated on a Biorad GenePulsar II in a 4 mm cuvette. The mixture was then diluted with PBS and spun down at 120,000 g for 60 minutes to purify the exosomes. The resultant pellet was resuspended in 100 l of double distilled water, which is predicted to lyse the exosomes via osmotic pressure and release the encapsulated siRNA within. The siRNA content was then measured with a fluorescence plate reader with 560 nm excitation and 610nm emission and the retained siRNA quantified against a standard curve of pure siRNA in water. As shown in FIG. 7, over 20% of initial siRNA (0.73 g) was retained after electroporation at 400V and 125 F, the optimum electroporation setting. Furthermore, concentrating the mixture by decreasing the amount of electroporation buffer appeared to increase the loading up to a certain level.

    [0092] Finally, transfection of labeled 2-OMe oligonucleotide (100 pmoles) and PMO (100 pmoles) were attempted with normal exosomes in C2C12 cells and imaged a day after application. Of the two types of small oligonucleotide species, 2-OMe oligonucleotide appears to be effectively delivered into C2C12 cells (FIG. 8A) while morpholino (PMO) delivery does not appear to be improved by exosome-mediated delivery with unmodified exosomes (FIG. 8B). From this experiment, we believe it is possible for us to load a variety of unnatural oligonucleotides into the exosome for delivery, including 2-OMe, morpholino, thio-nucleotides, chemically modified siRNAs and peptide nucleic acids.

    Materials

    [0093] Unless otherwise stated, all chemicals were obtained from Sigma-Aldrich UK and all enzymes used were obtained from New England Biolabs.

    Cell Culture

    [0094] Dendritic cells were cultured in DC medium (DMEM Glutamax, 10% FBS, non-essential amino acids # and antibiotics). C2C12 cells were cultured in DMEM Glutamax supplemented with 20% FBS and antibiotics. Neuro2A cells were cultured in EMEM supplemented with 10% FBS. All cells were incubated at 37 C. in 5% CO.sub.2.

    Plasmids

    [0095] Lamp2b was cloned with cDNA from C2C12 cells and Xhol and BspEI restriction sites were inserted after the signal peptide sequence together with glycine linkers. The full construct was then cloned downstream of the CMV promoter with NheI and HindIII restriction sites into a pEGFP-C1 vector, removing the eGFP in the process. Primers designed to encode RVG [32], MSP [33] and FLAG tag were used to introduce the targeting ligands between Xhol and BspEI at the N-terminus of Lamp2b (FIG. 6A). Primer sequences for the peptides were

    [0096] RVG (YTIWMPENPRPGTPCDIFTNSRGKRASNG) (SEQ ID No: 6):

    TABLE-US-00002 Forward (SEQIDNo:7) 5-tcgatacaccatttggatgcccgagaatccgagaccagggacacct tgtgacatttttaccaatagcagagggaagagagcatccaacgggt-3 Reverse (SEQIDNo:8) 5-ccggacccgttggatgctctcttccctctgctattggtaaaaatgt cacaaggtgtccctggtctcggattctcgggcatccaaatggtgta-3

    [0097] MSP (ASSLNIA) (SEQ ID No: 9):

    TABLE-US-00003 Forward (SEQIDNo:10) 5-tcgagccagcagcctgaacatcgcct-3 Reverse (SEQIDNo:11) 5-ccggaggcgatgttcaggctgctggc-3

    [0098] FLAG (DYKDDDDK): (SEQ ID No: 12)

    TABLE-US-00004 Forward (SEQIDNo:13) 5-tcgagattacaaggatgacgatgacaagt-3 Reverse (SEQIDNo:14) 5-ccggacttgtcatcgtcatccttgtaatc-3

    [0099] Murine Lysosome-associated membrane glycoprotein 2 (Lamp 2) isoform 2

    TABLE-US-00005 Unmodifiedaminoacidsequence (SEQIDNO1) MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMNFTITYETTNQIN <--Signalpeptide--> KTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSY NTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQA FVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNY <--hingeregion--> SIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIK YLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVL SVSRAFQINTFNLKVQPFNVTKGQYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVI <--Transmembrane AYLIGRRKTYAGYQTL --> Modifiedaminoacidsequence(addedsequenceunderlined) MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYA<peptidetag> GGAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFA...(depicts residues1-39ofSEQIDNO:1,followedbypeptidetag,andresidues 4-91ofSEQIDNO:1) Unmodifiednucleotidesequence (SEQIDNo:2) atgtgcctctctccggttaaaggcgcaaagctcatcctgatctttctgttcctaggagccgttc agtccaatgcattgatagttaatttgacagattcaaagggtacttgcctttatgcagaatggga gatgaatttcacaataacatatgaaactacaaaccaaaccaataaaactataaccattgcagta cctgacaaggcgacacacgatggaagcagttgtggggatgaccggaatagtgccaaaataatga tacaatttggattcgctgtctcttgggctgtgaattttaccaaggaagcatctcattattcaat tcatgacatcgtgctttcctacaacactagtgatagcacagtatttcctggtgctgtagctaaa ggagttcatactgttaaaaatcctgagaatttcaaagttccattggatgtcatctttaagtgca atagtgttttaacttacaacctgactcctgtcgttcagaaatattggggtattcacctgcaagc ttttgtccaaaatggtacagtgagtaaaaatgaacaagtgtgtgaagaagaccaaactcccacc actgtggcacccatcattcacaccactgccccgtcgactacaactacactcactccaacttcaa cacccactccaactccaactccaactccaaccgttggaaactacagcattagaaatggcaatac tacctgtctgctggctaccatggggctgcagctgaacatcactgaggagaaggtgcctttcatt tttaacatcaaccctgccacaaccaacttcaccggcagctgtcaacctcaaagtgctcaactta ggctgaacaacagccaaattaagtatcttgactttatctttgctgtgaaaaatgaaaaacggtt ctatctgaaggaagtgaatgtctacatgtatttggctaatggctcagctttcaacatttccaac aagaaccttagcttctgggatgcccctctgggaagttcttatatgtgcaacaaagagcaggtgc tttctgtgtctagagcgtttcagatcaacacctttaacctaaaggtgcaaccttttaatgtgac aaaaggacagtattctacagcccaggagtgttcgctggatgatgacaccattctaataccaatt atagttggtgctggtctttcaggcttgattatcgttatagtgattgcttacctaattggcagaa gaaagacctatgctggatatcagactctgtaa Modifiednucleotidesequence(addedsequenceinitalicsandrestrictions sitesusedforcloninginunderlined) (SEQIDNo:25) atgtgcctctctccggttaaaggcgcaaagctcatcctgatctttctgttcctaggagccgttc agtccaatgcattgatagttaatttgacagattcaaagggtacttgcctttatGCTCGAGGTCA CATCCGGAGGTgcagaatgggagatgaatttcacaataacatatgaaactacaaaccaaaccaa taaaactataaccattgcagtacctgacaaggcgacacacgatggaagcagtt...

    Transfection

    [0100] Transfection of dendritic cells was performed with 5 g of pEGFP-NAD or pLamp2b derivatives and 5 l of TransIT LT1 transfection reagent (Mirus Bio) in a 6-well plate with 10.sup.6 cells on Day 4 after harvesting and isolation of exosomes is done on Day 8.

    Reverse Transcription qPCR

    [0101] Reverse transcription was performed with 500 ng of RNA and random primer using Precision Reverse Transcription Kit (Primer Design) as per manufacturer's instruction. qPCR experiments were performed on an ABI7000 thermal cycler in 20 l reactions, with 0.5 nM of each primer and 2 l of each cDNA preparation, using Precision qPCR Mastermix (Primer Design) as per manufacturer's instructions.

    TABLE-US-00006 qPCRprimersequences Cyclophilin-Bhuman Forward (SEQIDNo:15) 5-AAAGTCACCGTCAAGGTGTATTT-3 Reverse (SEQIDNo:16) 5-TCACCGTAGATGCTCTTTCCTC-3 GAPDHhuman Forward (SEQIDNo:17) 5-AAGGTGAAGGTCGGAGTCAA-3 Reverse (SEQIDNo:18) 5-GAAGATGGTGATGGGATTTC-3 GAPDHmouse Forward (SEQIDNo:19) 5-CAATGTGTCCGTCGTGGATCT-3 Reverse (SEQIDNo:20) 5-TAGCCCAAGATGCCCTTCAGT-3 eGFP Forward (SEQIDNo:21) 5-TCTTCAAGTCCGCCATGCC-3 Reverse (SEQIDNo:22) 5-TGTCGCCCTCGAACTTCAC-3 18S Forward (SEQIDNo:23) 5-GTAACCCGTTGAACCCCATT-3 Reverse (SEQIDNo:24) 5-CCATCCAATCGGTAGTAGCG-3

    [0102] Mouse cyclophilin B: Mm_PPM_1_SG_Quantitect Primer Assay (Qiagen)

    Western Blotting

    [0103] Cell samples and exosomes were lysed in a 10mM Tris pH 7.4 buffer containing 0.1% SDS, a protease inhibitor cocktail and DNase. Samples were separated on NuPAGE Novex 4-12% Bis-Tris Gel (Invitrogen), and transfered to a PVDF membrane (Amersham Biosciences). The membrane was then blocked with 10% milk in PBS for 1 hour, incubated with primary antibody for 90 min at a dilution of 1:5000 for anti-Lamp2 antibody (Abcam), 1:10000 for anti-GAPDH (Abcam) and anti-cyclophilin B (Abcam). Membranes were incubated with HRP-conjugated secondary antibody 1:5000 dilution for 45 minutes at room temperature before film exposure. All steps were followed by 3 washes with PBST for 10 min each.

    Transfection and Electroporation with Exosomes and DNase Protection Assay

    [0104] 1 g of the pEGFP-NAD plasmid was mixed with 1 l of the transfection reagent, 3 g of exosomes and topped up to 100 l with DMEM. The solution was incubated for 3 hours at 37 C. and then subjected to DNase treatment for 10 minutes at 37 C. with the addition of 1 l of RQ DNase I (Promega) and 10 l of RQ DNase buffer. The DNase was inactivated by 10 l of STOP buffer (Promega) before the direct addition of the entire solution to Neuro2A cells in a 24-well format.

    [0105] Exosomes were loaded to a protein concentration of 6 g in 200 l of electroporation buffer (1.15 mM potassium phosphate pH 7.2, 25 mM KCl, 21% Optiprep) and 2 g of pEGFP-NAD or 100 pmol of cyclophilin siRNA was added, mixed and electroporated in a 4 mm cuvette. For the DNase protection Assay, 20 l of the electroporated solution was added to 70 l of distilled water, 10 l of RQ DNase Buffer and 1 l RQ DNase I (Promega) and incubated at 37 C. for 10 min before inhibiting the reaction with 10 l of STOP buffer. 10 l of each sample was run on each lane in a 0.8% agarose TAE gel.

    Transfection of Cells with Exosomes

    [0106] 100 l (electroporation) or the entire mixture (transfection) was added to Neuro2A cells in complete medium. For siRNAs, the medium is changed after 24 hours. The cells were harvested 48 hours after addition of the exosomes.

    Exosome Pulldown Assay

    [0107] 20 l of Protein-A Sepharose beads (Sigma P9424) were incubated overnight at 4 C. in 500 l PBS and 2 mg/ml BSA. In the protocol, beads were pelleted during the steps by centrifugation at 100 g for 2 minutes at 4 C. The beads were subsequently washed 3 times with 1 ml PBS for 5 minutes each wash. 1 l Rabbit anti-FLAG (Sigma F2555) or 1 l of Rabbit anti-Agol (Upstate 07-599) was loaded onto the beads in 100 l of PBS with 2 mg/ml BSA for 4 hours at 4 C. and the beads were subsequently washed 3 times as described above. Normal exosomes and FLAG-exosomes were spun at 200 g for 10 min to remove contaminating debris and added to the beads to a protein concentration of 10 g/ml in 200 l of PBS. After incubation, the beads were subsequently washed 3 times as described above, then eluted in 0.1% SDS and the entire supernatant was loaded onto a polyacrylamide gel. A Western blot against Lamp-1, an exosomal protein was used to detect the presence of exosomes pulled down by the antibodies.

    Statistics

    [0108] All experiments, unless otherwise stated, were all performed in triplicates. All error bars used in this report are standard deviations. Statistical analyses of the data were performed using SPSS program 16.0 by using the non-parametric Krusckal Wallis test followed by the Mann-Whitney U test.

    Exosome-Mediated Targeted Systemic Delivery of siRNA to the Brain

    [0109] Immunologically inert exosomes were harvested from murine bone marrow-derived dendritic cells and targeting moietiesmuscle-specific peptide (MSP) and neuron-specific rabies viral glycoprotein (RVG), were genetically engineered onto Lamp2b, an exosomal membrane protein, to alter tissue specificity of these exosomes, as described above. To investigate the potential for exosome-mediated systemic siRNA delivery in vivo and characterize the tissue distribution, the ubiquitously highly-expressed housekeeping GAPDH gene was chosen as a target. We electroporated 150 g of optimized GAPDH siRNA with 150 g of either unmodified, RVG- or MSP-exosomes, then purified the exosomes by ultracentrifugation and removed unencapsulated siRNA in the supernatant. Exosomes were resuspended in 80 l of 5% glucose before intravenous injection in C57BL/6 mice. Injection of naked siRNA (150g) resulted in detectable GAPDH silencing in the spleen, liver and kidney, corresponding to reported siRNA sequestration after tail vein delivery [42] (FIG. 9A). In contrast, exosome-encapsulated siRNAs appeared to have no natural affinity to these organs and were resistant to non-specific uptake. Systemic administration of unmodified exosomes did not induce GAPDH silencing in any organ analyzed (FIG. 9b). Injection of MSP-exosomes produced a slight, but non-significant GAPDH silencing in brain and kidney (FIG. 9C), whereas injection of RVG-exosomes resulted in significant knockdown of GAPDH mRNA in several brain regions (FIG. 9D), a tissue expressing the target of RVG ligandnicotinic acetylcholine receptors [32]. We also observed a non-significant decrease of GAPDH mRNA level in kidney 3 days after injection. Although in vivo tissue specificity was not seen with MSP-exosomes, the relatively weak targeting capabilities of MSP [43] and the abundance of muscle tissue may have resulted in much lower average siRNA concentration within muscle cells and hence, correspondingly lower gene knockdown.

    [0110] We next investigated if re-administration of exosomes leads to decreased transgene delivery efficiency previously described in viruses [44, 45] and liposomes. We designed two different experiments to assess this question. First, we studied if pre-innoculating the animals with empty RVG-exosomes would reduce the efficacy of delivery. The animals were injected with empty RVG-exosomes at the same dose 3 and 2 weeks before injection of electroporated RVG-exosomes containing GAPDH siRNA. The animals were then sacrificed 3 days later and brain GAPDH knockdown was assessed. Results indicated a minimal decrease in silencing efficacy between unprimed and primed mice (FIG. 9D and 9E), demonstrating that targeted exosomes can be readministered multiple times without loss in delivery efficacy. Finally, to confirm the results, we injected three mice with two doses of RVG-exosomes containing GAPDH siRNA at the same concentration. Animals were injected 7 and 3 days before harvesting the tissues and GAPDH mRNA and protein knockdown were assessed in the brain. Knockdown was observed with GAPDH mRNA (50.2%9.1%, p<0.05) and protein levels (19.6%2.3%, not significant) in the cortex (FIG. 9F and 9G). These experiments validated the previous results and demonstrated that RVG-exosomes can be re-administered multiple times without loss of delivery efficacy allowing for long-term target silencing.

    [0111] Given the success of knockdown with GAPDH, BACE-1, a key enzyme in the pathogenesis of Alzheimer's disease (AD), was targeted to evaluate the therapeutic potential of this technology. Previous studies in transgenic APP over-expressing [46, 47] and normal [48] mice suggested that BACE-1 is a strong candidate for anti-AD therapeutic intervention. We delivered two BACE-1 siRNAs, previously validated in vitro, to normal C57BL/6 mice. 150 g of RVG-exosomes and 150 g of each BACE-1 siRNA were electroporated, purified and resuspended in 5% glucose before delivery. Significant mRNA (72%18%) and protein (60%13%) knockdown in cortex 3 days after administration (FIG. 9H and 9I). Moreover we demonstrated a decrease of 20% in the total content of (3-amyloid 1-42, a main component of the amyloid plaques in the Alzheimer's pathology (FIG. 9J). This result was comparable to the -amyloid 1-40 decrease demonstrated in normal mice after intraventricular injection of BACE-1 inhibitors [48]. This experiment demonstrated the therapeutic potential of this technology, which is potentially ideally suited for long-term silencing of genes related with neurodegenerative diseases. [0112] .sup.1 Smith A J, Schlichtenbrede F C, Tschernutter M, Bainbridge J W, Thrasher A J, Ali R R (2003), AAV-Mediated gene transfer slows photoreceptor loss in the RCS rat model of retinitis pigmentosa, Mol Ther 8(2): 188-95. [0113] .sup.2 Ely A, Naidoo T, Mufamadi S, Crowther C, Arbuthnot P (2008), Expressed anti-HBV primary microRNA shuttles inhibit viral replication efficiently in vitro and in vivo,Mol Ther 16(6):1105-12. [0114] .sup.3 White M D, Farmer M, Mirabile I, Brandner S, Collinge J, Mallucci G R (2008), Single treatment with RNAi against prion protein rescues early neuronal dysfunction and prolongs survival in mice with prion disease, Proc Natl Acad Sci USA 105(29):10238-43. [0115] Reynolds A, Leake D, Boese Q, Scaringe S, Marshall W S, Khvorova A (2004), Rational siRNA design for RNA interference, Nat Biotechnol 22(3):326-30. [0116] .sup.5 Takakura Y, Nishikawa M, Yamashita F, Hashida M (2001), Development of gene drug delivery systems based on pharmacokinetic studies, Eur J Pharm Sci 13(1):71-76. [0117] .sup.6 Kawabata K, Takakura Y, Hashida M (1995), The fate of plasmid DNA after intravenous injection in mice: involvement of scavenger receptors in its hepatic uptake, Pharm Res 12(6):825-30. [0118] .sup.7 www.wiley.co.uldgenmed/clinical/ Retrieved on 9 Sep. 2008. [0119] .sup.8 Lowenstein P R, Mandel R J, Xiong W D, Kroeger K, Castro M G (2007), Immune responses to adenovirus and adeno-associated vectors used for gene therapy of brain diseases: the role of immunological synapses in understanding the cell biology of neuroimmune interactions, Curr Gene Ther 7(5):347-60. [0120] .sup.9 Alexander I E, Cunningham S C, Logan G J, Christodoulou J (2008), Potential of AAV vectors in the treatment of metabolic disease, Gene Ther. ;15(11):831-9. [0121] .sup.10 Hasbrouck N C, High K A (2008), AAV-mediated gene transfer for the treatment of hemophilia B: problems and prospects, Gene Ther 15(11):870-5. [0122] .sup.11 Daniel R, Smith J A (2008), Integration site selection by retroviral vectors: molecular mechanism and clinical consequences, Hum Gene Ther 19(6):557-68. [0123] .sup.12 Zhang J S, Liu F, Huang L (2005), Implications of pharmacokinetic behavior of lipoplex for its inflammatory toxicity, Adv Drug Deliv Rev 57(5):689-98. [0124] .sup.13 Ishida T, Masuda K, Ichikawa T, Ichihara M, Irimura K, Kiwada H (2005), Accelerated clearance of a second injection of PEGylated liposomes in mice, Int J Pharm 255:167-74. [0125] .sup.14 Ishida T, Ichihara M, Wang X, Yamamoto K, Kimura J, Majima E, Kiwada H. (2006), Injection of PEGylated liposomes in rats elicits PEG-specific IgM, which is responsible for rapid elimination of a second dose of PEGylated liposomes, J Control Release 112:15-25. [0126] .sup.15 Ishida T, Ichihara M, Wang X, Yamamoto K, Kimura J, Majima E, Kiwada H (2006), Injection of PEGylated liposomes in rats elicits PEG-specific IgM, which is responsible for rapid elimination of a second dose of PEGylated liposomes, J Control Release 112:15-25. [0127] .sup.16 Jiang H, Couto L B, Patarroyo-White S, Liu T, Nagy D, Vargas J A, et al (2006), Effects of transient immunosuppression on adenoassociated, virus-mediated, liver-directed gene transfer in rhesus macaques and implications for human gene therapy, Blood 108(10):3321-8. [0128] .sup.17 Wang Z, Kuhr C S, Allen J M, Blankinship M, Gregorevic P, Chamberlain J S, et al (2007), Sustained AAV-mediated dystrophin expression in a canine model of Duchenne muscular dystrophy with a brief course of immunosuppression, Mol Ther 15(6):1160-6. [0129] .sup.17 Li J Z, Li H, Hankins G R, Dunford B, Helm G A (2005), Local immunomodulation with CD4 and CD8 antibodies, but not cyclosporine A, improves osteogenesis induced by ADhBMP9 gene therapy, Gene Ther 12(16):1235-41. [0130] .sup.19 Zaiss A K, Muruve D A (2005), Immune responses to adeno-associated viral vectors, Curr Gene Ther 5(3):323-31. [0131] .sup.20 Taylor N, Uribe L, Smith S, Jahn T, Kohn D B, Weinberg K (1996), Correction of interleukin-2 receptor function in X-SCID lymphoblastoid cells by retrovirally mediated transfer of the gamma-c gene, Blood 87(8):3103-7. [0132] .sup.21 Oh Y K, Sohn T, Park J S, Kang M J, Choi H G, Kim J A, et al (2004), Enhanced mucosal and systemic immunogenicity of human papillomavirus-like particles encapsidating interleukin-2 gene adjuvant, Virology 328(2):266-73. [0133] .sup.22 Williams D A (2007), RAC reviews serious adverse event associated with AAV therapy trial, Mol Ther 15(12):2053-4. [0134] .sup.23 Raposo G, Nijman H W, Stoorvogel W, Liejendekker R, Harding C V, Melief D J Geuze H J (1996), B lymphocytes secrete antigen-presenting vesicles, J Exp Med 183:1161-1172. [0135] .sup.24 Zitvogel L, Regnault A, Lozier A, Wolfers J, Flament C, Tenza D, Ricciardi-Castagnoli P, Raposo G, Amigorena S (1998), Eradication of established murine tumors using a novel cell-five vaccine: dendritic cell-derived exosomes, Nat Med 4:594-600. [0136] .sup.25 Hao S, Moyana T, Xiang J (2007), Review: cancer immunotherapy by exosome-based vaccines, Cancer Biother Radiopharm 22:692-703. [0137] .sup.26 Valadi H, Ekstrom K, Bossios A, Sjstrand M, Lee J J, Lotvall J O (2007), Exosome-mediated transfer of mRNAs and microRNAs is a novel mechanism of genetic exchange between cells, Nat Cell Biol 9(6):654-9. [0138] .sup.27 Skog J, Wiirdinger T, van Rijn S, Meijer D H, Gainche L, Sena-Esteves M, Curly W T Jr, Carter B S, Krichevsky A M, Breakefield X O (2008), Glioblastoma microvesicles transport RNA and proteins that promote tumour growth and provide diagnostic biomarkers, Nat Cell Biol 10(12):1470-6. [0139] .sup.28 Quah B J, O'Neill H C (2005), The immunogenicity of dendritic cell-derived exosomes, Blood Cells Mol Dis 35:94-110. [0140] .sup.29 Thry C, Zitvogel L, Amigorena S (2002), Exosomes: composition, biogenesis and function, Nat Rev Immunol 2(8):569-79. [0141] .sup.30 Jooss K, Yang Y, Fisher K J, Wilson J M (1998), Transduction of dendritic cells by DNA viral vectors directs the immune response to transgene products in muscle fibers, J Virol 72(5):4212-23. [0142] .sup.31 Reis e Sousa C (2006), Dendritic cells in a mature age, Nat Rev Immunol 6(6):476-83. [0143] .sup.32 Kumar P, Wu H, McBride J L, Jung K E, Kim M H, Davidson B L, Lee S K, Shankar P, Manjunath N (2007), Transvascular delivery of small interfering RNA to the central nervous system, Nature 448(7149):39-43. [0144] .sup.33 Flint P W, Li Z B, Lehar M, Saito K, Pai S I (2005), Laryngeal muscle surface receptors identified using random phage library, Laryngoscope 115(11):1930-7. [0145] .sup.34 Rippe K, Miicke N, Langowski J (1997), Superhelix dimensions of a 1868 base pair plasmid determined by scanning force microscopy in air and in aqueous solution, Nucleic Acids Res 25(9):1736-44. [0146] .sup.35 Vijayanathan V, Thomas T, Shirahata A, Thomas T J (2001), DNA condensation by polyamines: a laser light scattering study of structural effects, Biochemistry 40(45):13644-51. [0147] .sup.36 Lentz, T. L. Rabies virus binding to an acetylcholine receptor alpha-subunit peptide (1990). J. Mol. Recognit. 3, 82-88. [0148] .sup.37 Zeng J, Too H P , Ma Y , Luo ESE , Wang S . A synthetic peptide containing loop 4 of nerve growth factor for targeted gene delivery (2004). J Gene Med.;6:1247-1256. [0149] .sup.38 McKay T , Reynolds P , Jezzard S , Curiel D , Coutelle C . Secretin-mediated gene delivery, a specific targeting mechanism with potential for treatment of biliary and pancreatic disease in cystic fibrosis (2002). Mol Ther;5:447-454. [0150] .sup.39 C. Thery, S. Amigorena, G. Raposo, A. Clayton, Isolation and characterization of exosomes from cell culture supernatants and biological fluids. Curr Protoc Cell Biol Ed. (Wiley, N.Y., April 2006) Chapter 3, Unit 3.22 (2006). [0151] 40 V. R. Simhadri, K. S. Reiners, H. P. Hansen, D. Topolar, V. L. Simhadri et al., Dendritic cells release HLA-B-associated transcript-3 positive exosomes to regulate natural killer function. PLoS One. 3(10), e3377 (2008), doi:10.1371/ journal.pone.0003377. [0152] .sup.41 Y. C. Wang, X. B. Hu, F. He, F. Feng, L. Wang et al., Lipopolysaccharide-induced maturation of bone marrow-derived dendritic cells is regulated by notch signaling through the up-regulation of CXCR4. J Biol Chem. 284(23), 15993-6003 (2009). [0153] .sup.42 S. D. Larson, L. N. Jackson, L. A. Chen, P. G. Rychahou, B. M. Evers, Effectiveness of siRNA uptake in target tissues by various delivery methods. Surgery. 142(2):262-9 (2007). [0154] .sup.43 H. Yin, H. M. Moulton, C. Betts, Y. Seow, J. Boutilier et al., A fusion peptide directs enhanced systemic dystrophin exon skipping and functional restoration in dystrophin-deficient mdx mice. Hum Mol Genet. 18(22):4405-14 (2009). [0155] .sup.44 F. A. Nunes, E. E. Furth, J. M. Wilson, S. E. Raper, Gene transfer into the liver of nonhuman primates with E1-deleted recombinant adenoviral vectors: safety of readministration. Hum Gene Ther. 10(15), 2515-26 (1999). [0156] .sup.45 S. C. Gonzalez, M. M. McMenamin, H M Charlton, J. Goodman, T Lantos, Readministration of adenoviral gene delivery to dopamine neurons. Neuroreport. 18(15), 1609-14 (2007). [0157] .sup.46F. M. Laird, H. Cai, A. V. Savonenko A. V. M. H. Farah, K. He et al., BACE1, a major determinant of selective vulnerability of the brain to amyloid-beta amyloidogenesis, is essential for cognitive, emotional, and synaptic functions. J. Neurosci. 25(50), 11693-11709 (2005). [0158] .sup.47 0. Singer, R. A. Man, E. Rockenstein, L. Crews, N. G. Coufal et al., Targeting BACE1 with siRNAs ameliorates Alzheimer disease neuropathology in a transgenic model. Nat. Neurosci. 8(10), 1343-1349 (2005). [0159] .sup.48 K. Nishitomi, G. Sakaguchi, Y. Horikoshi, A. J. Gray, M. Maeda et al., BACE1 inhibition reduces endogenous Abeta and alters APP processing in wild-type mice. J. Neurochem. 99(6), 1555-63 (2006).