Single-domain antibodies with improved thermal stability under cytoplasmic expression
10294283 · 2019-05-21
Assignee
Inventors
- Daniel Zabetakis (Brandywine, MD, US)
- George P. Anderson (Bowie, MD, US)
- Ellen R. Goldman (Germantown, MD)
- Kendrick Turner (Washington, DC, US)
- P. Audrey Brozozog Lee (Washington, DC, US)
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
C07K16/1271
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
International classification
Abstract
Methods of producing a single-domain antibody (sdAb) include causing a bacteria to express the sdAb into cytoplasm of the bacteria, wherein the sdAb is expressed as a fusion protein with the acid tail of -synuclein; and then purifying the sdAb, wherein the fusion protein is expressed free of a periplasmic location tag. Such antibodies have the unexpected ability to refold after thermal denaturation.
Claims
1. A method of producing a single-domain antibody (sdAb), the method comprising: causing a bacteria to express the sdAb into cytoplasm of the bacteria, wherein the sdAb is expressed as a fusion protein with the acid tail of -synuclein; and then purifying the sdAb, wherein the fusion protein is expressed free of a periplasmic location tag.
2. The method of claim 1, wherein the sdAb lacks a disulfide bond.
3. The method of claim 1, further comprising subjecting the sdAb to thermal denaturation and subsequently cooling the sdAb whereby the sdAb substantially refolds into its functional conformation.
4. The method of claim 1, wherein the fusion protein further comprises an affinity tag for purification.
5. The method of claim 4, further comprising removing the affinity tag from the sdAb prior to purifying the sdAb.
6. The method of claim 4, wherein the affinity tag is polyhistidine.
7. The method of claim 1, wherein the acid tail of -synuclein comprises the amino acid sequence DPDNEAYEMPSEEGYQDYEPEA (SEQ ID No: 1).
8. The method of claim 1, further comprising removing the acid tail of -synuclein from the sdAb prior to purifying the sdAb.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
DETAILED DESCRIPTION
Definitions
(6) Before describing the present invention in detail, it is to be understood that the terminology used in the specification is for the purpose of describing particular embodiments, and is not necessarily intended to be limiting. Although many methods, structures and materials similar, modified, or equivalent to those described herein can be used in the practice of the present invention without undue experimentation, the preferred methods, structures and materials are described herein. In describing and claiming the present invention, the following terminology will be used in accordance with the definitions set out below.
(7) As used in this specification and the appended claims, the singular forms a, an, and the do not preclude plural referents, unless the content clearly dictates otherwise.
(8) As used herein, the term and/or includes any and all combinations of one or more of the associated listed items.
(9) As used herein, the term about when used in conjunction with a stated numerical value or range denotes somewhat more or somewhat less than the stated value or range, to within a range of 10% of that stated.
Description
(10) Single-domain antibodies (sdAbs) are recombinant derivatives of heavy-chain-only antibodies found in camelids and sharks. Heavy-chain-only antibodies are distinct from conventional antibodies in that they lack the typical heavy-chain/light-chain structure. The binding element for conventional antibodies is composed of both a heavy-chain variable domain and light-chain variable domain so that the functional component of the antibody is divided between two distinct proteins. By contrast, the binding element of a heavy-chain-only antibody is composed of a single domain. This confers two features that have been exploited. First, this binding domain can be isolated from the heavy-chain and used as a very small (15 kDa) functional protein by itself. Secondly, as compared to a conventional antibody, the lack of posttranslational modifications in sdAbs allows for their production in bacterial expression systems rather than more complex and costly eukaryotic systems.
(11) Basic structure, composition, preparation, and uses of relevant antibodies are described in, for example, U.S. Pat. Nos. 5,800,988; 5,840,526; 5,874,541; 6,005,079; 6,015,695; and 6,765,087.
(12) Bacterial expression is a favorable means of producing recombinant proteins in large quantities. Typically, sdAbs are produced with a periplasmic localization tag. This short amino-acid sequence, placed at the amino-terminus of the protein, directs the bacterial cell to export the protein from the cytoplasm into the periplasmic space (the space between the inner and outer membranes in bacteria such as E. coli). This has two benefits. First, proteins can be extracted from the periplasm without need to fully lyse the cells. Second, the periplasm is a more favorable environment for the formation of disulfide bonds in exogenous proteins.
(13) Living bacteria normally have a difference in redox potential between the cytoplasm, which is reducing, and the periplasm, which is oxidizing. A reducing environment tends to cleave disulfide bonds. Therefore, if the non-native protein of interest contains disulfide links, then cytoplasmic expression is unfavorable. This is typically the case with sdAbs, which normally contain a single disulfide that contributes to thermal stability. On the other hand, periplasmic expression introduces a significant bottleneck in protein production (the export through the inner membrane) and usually results in significantly lower yield compared to expression in the cytoplasm. It would be beneficial to ameliorate the effects of cytoplasmic expression in order to benefit from increased protein production.
(14) However, sdAb expression in the reducing cytoplasm is prone to detrimental effects. In proteins that would form disulfide bonds (including most sdAbs), there is a reduction of the melting temperature of the protein (i.e., the temperature at which the protein, in water, unfolds into a random coil) due to the lack of disulfide bonding. When sdAbs lack the disulfide bond, they do not refold on cooling after thermal denaturation. While lowering the melting temperature is undesirable, a loss of refolding imposes a severe limitation on the utility of sdAb.
(15) As disclosed herein, a solution to the problem of refolding of cytoplasmically expressed sdAb using the acid tail of -synuclein (ATS). The synucleins are a class of human proteins, and -synuclein has been implicated in the pathology of Parkinson's disease. This protein is a small heat shock protein (sHSP), a class of proteins that function to prevent the aggregation of other proteins within the cell during periods of biochemical stress.
(16) The ATS has been used in isolation and as fusions to other proteins to prevent aggregation and to protect proteins from damage by freeze-thaw cycles. It has also been used to stabilize proteins against thermal denaturation.
(17) Critically, however, reports to date found that ATS was not able to promote refolding after thermal denaturation of enzymes. See refs. 5 and 6. Thus, the results described herein, with the ATS tail significantly assisting refolding sdAbs, was surprising and unexpected. Providing refolding ability to sdAbs presents many improved opportunities for commercialization. For example, diagnostic and/or analytical kits and devices may be used in the field use where refrigeration is not available.
Constructs of sdAbs
(18) The sdAb used were isolated from immune-based libraries of phage-displayed llama sdAb. The protein sequence of the ATS tail used DPDNEAYEMPSEEGYQDYEPEA (SEQ ID No: 1). Conventional molecular biological techniques were used to generate constructs. Proteins were produced in E. coli with polyhistidine tails to assist purification, and purified using an osmotic shock protocol followed by purification through a standard immobilized metal affinity (IMAC) protocol. Size exclusion chromatography was used as a final purification step, and the protein concentration was estimated by absorbance at 280 nm using a nanodrop spectrophotometer. Growth and purification of the cytoplasmically produced proteins was performed overnight at 16 C. The cells were broken by chemical means and/or sonication and then the protein purified by IMAC and size exclusion chromatography.
(19) The ATS sequence was added to the C-terminus of certain sdAbs. The sdAbs used were sdAb A5, a sdAb specific for the BclA protein of the Bacillus anthracis spore, sdAb H1 and C8, which recognize ricin, and sdAb A3, which binds Staphylococcal Enterotoxin B (SEB).
(20) The sequences of these proteins and their ATS fusions were as follows:
(21) TABLE-US-00001 C8-ATS: (SEQIDNo:2) EVQLQASGGGLVQGGDSLRLSCAASGRTLGDYGVAWFRQAPGKEREFVSV ISRSTIITDYANSVKGRFTISRDNAKNAVYLQMNSLKPEDTAVYYCAVIA NPVYATSRNSDDYGHWGQGTQVTVSSAAADPDNEAYEMPSEEGYQDYE PEALEHHHHHH C8 (SEQIDNo:3) EVQLQASGGGLVQGGDSLRLSCAASGRTLGDYGVAWFRQAPGKER EFVSVISRSTIITDYANSVKGRFTISRDNAKNAVYLQMNSLKPEDTAV YYCAVIANPVYATSRNSDDYGHWGQGTQVTVSSAAALEHHHHHH A3-ATS: (SEQIDNo:4) EVQLVESGGGLVQAGDSLRLSCTASGRTFSRAVMGWFRQAPGKEREFVA AISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYC AADLKMQVAAYMNQRSVDYWGQGTQVTVSSAAADPDNEAYEMPSEEG YQDYEPEALEHHHHHH A3: (SEQIDNo:5) EVQLVESGGGLVQAGDSLRLSCTASGRTFSRAVMGWFRQAPGKEREFVA AISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYC AADLKMQVAAYMNQRSVDYWGQGTQVTVSSAAALEHHHHHH A5-ATS: (SEQIDNo:6) EVQLQASGGGLVQPGGSLRLSCVASGINFSTNVPTWYRQAPGKQRELVAV ITTNGLTRYADSVKGRFTISKDNAKNAVYLQMNSLKPEDTAVYYCRARD YWGQGTQVTVSSEPKTPKPQPAASGAEFAAADPDNEAYEMPSEEGYQD YEPEALEHHHHHH A5: (SEQIDNo:7) EVQLQASGGGLVQPGGSLRLSCVASGINFSTNVPTWYRQAPGKQRELVAV ITTNGLTRYADSVKGRFTISKDNAKNAVYLQMNSLKPEDTAVYYCRARD YWGQGTQVTVSSEPKTPKPQPAASGAEFAAALEHHHHHH H1-ATS: (SEQIDNo:8) DVQLQASGGGLAQAGGSLRLSCAYSGDTVNDYAMAWFRQAPGKGREFV AAIRARGGGTEYLDSVKGRFTISRDNGENTAYLQMDNLQPDDTALYFC ALAMGGYAYRAFERYSVRGQGTQVTVSSAAADPDNEAYEMPSEEGYQD YEPEALEHHHHHH H1: (SEQIDNo:9) DVQLQASGGGLAQAGGSLRLSCAYSGDTVNDYAMAWFRQA PGKGREFVAAIRARGGGTEYLDSVKGRFTISRDNGENTAY LQMDNLQPDDTALYFCALAMGGYAYRAFER YSVRGQGTQVTVSSAAALEHHHHHH
Experimental Methods
(22) Heating of the sdAb constructs to various temperatures and time points was done at a concentration of 1 mg/ml using a thermal cycler. After heating, the samples were removed from the thermal cycler, cooled to room temperature on the bench top, centrifuged and protein concentration measured by absorbance at 280 nm.
(23) Melting temperature and ability to refold was determined by circular dichroism (CD). Measurements were performed using a spectropolarimeter equipped with a temperature control system. CD spectra were obtained from 200 to 245 nm and melting point data was acquired at a single wavelength between 200 and 205 nm, at a temperature rate of 2.5 C./min.
(24) Surface plasmon resonance (SPR) was used to measure binding kinetics of sdAb wild-type and ATS variants as well as to assay their binding activity after heating. Measurements were performed on a ProteON XPR36 (Bio-Rad) using a chip coated with appropriate antigens (iBclA, SEB, or ricin) at 20 g/mL. Binding was assessed by flowing six concentrations varying from 0-300 nM at 50 L/min for 120 s over the antigen coated chip and then monitoring dissociation for 600 s. The chip was regenerated using 50 mM glycineHCl (pH 2.0) for 36 s, prior to any additional testing. The data were analyzed with the ProteON Manager 2.1 software, corrected by subtraction of the zero antibody concentration column as well as interspot corrected. Binding constants were determined using the software's Langmuir model. When assessing the ability of the A3 and A3-ATS constructs to bind antigen after heating, samples were heated to 90 C. at 1 mg/ml for the indicated time, and then allowed to cool to room temperature.
Experimental Results
(25) The addition of the ATS sequence did not measurably change the affinity of any of the sdAb for their targets, although it did shift the melting temperature slightly lower. The level of production of fusion proteins was somewhat lower than that of the parental sdAb, however protein production of the fusion could potentially be optimized by changing the growth and production protocol. The ATS was added to sdAb A5, which included part of the upper hinge region, which contains several positively charged amino acids, and to clones H1, C8, and A3 which do not include the hinge sequence.
(26) The sdAb-ATS fusions demonstrated an increase in the solubility over parental sdAb when they were heated at high concentration (1 mg/ml) above their melting temperature, with protein concentration estimated by absorbance at 280 nm.
(27) Some of the most dramatic improvements in stability were recorded with sdAb A3. This clone has a melting temperature of 85 C., and showed refolding when examined by CD. When heated at high concentration, however, sdAb A3 is prone to aggregation; after heating at a concentration of 1 mg/ml for thirty minutes at 90 C., the clone had lost its binding ability. The sdAb A3 variant with the ATS retains a significant portion of its binding activity even after heating (1 mg/ml) for an hour at 90 C., as shown in
(28) Variable heavy domains normally contain a conserved disulfide bond between the framework 1 and framework 3 regions of the protein. Removal of this conserved disulfide through mutagenesis of the two cysteines has previously been reported to result in a decrease of the melting temperature of the sdAb. Such variations (C22A/C99V) in the A3 and A3-ATS proteins were made, with the following sequences:
(29) TABLE-US-00002 A3-ds: (SEQIDNo:10) EVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVA AISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYV AADLKMQVAAYMNQRSVDYWGQGTQVTVSSAAALEHHHHHH A3-ds-ATS: (SEQIDNo:11) EVQLQASGGGLVQPGGSLRLSAVASGINFSTNVPTWYRQAPGKQRELVAV ITTNGLTRYADSVKGRFTISKDNAKNAVYLQMNSLKPEDTAVYYVRARD YWGQGTQVTVSSEPKTPKPQPAASGAEFAAADPDNEAYEMPSEEGYQD YEPEALEHHHHHH
(30) As seen in
(31) The sequences for the A3 and A5 sdAb, with and without the ATS, were mobilized to vectors for expression in the cytoplasm. Much of the cytoplasmically produced sdAb lacks the disulfide bond, as inferred from its decreased melting temperature. As mutants lacking cysteines were able to refold when expressed with the ATS tail, it seemed possible that the tail would promote refolding of sdAb expressed in the cytoplasm.
(32) The melting and refolding of sdAb A3 and sdAb A3-ATS expressed in the cytoplasm was examined. Two melting transitions were observed in the cytoplasmically expressed A3 which can be attributed to sdAb populations with and without a formed disulfide (
Intrabodies
(33) It is contemplated that sdAbs as described herein may have use as intrabodies, active inside cells to binding to target molecules within the cells. Intrabody based strategies using sdAb have several potential applications including protection from intracellular toxins and viral inhibitors. In order for a sdAb to be an efficient intrabody, it must function in the absence of its disulfide. Selection strategies, such as the use of a bacterial 2-hybrid system, have been described specifically for the isolation of camelid sdAb best able to function as intrabodies. The ATS fusion potentially endows a wide variety of sdAbs with ability to function as an intrabody.
CONCLUDING REMARKS
(34) As demonstrated, the sdAb with the ATS can be expressed in the cytoplasm to produce proteins that refold after heat denaturation. In the case of sdAb A5 ATS, once heated above its melting temperature and cooled to refold, the subsequent melting temperature of the cytoplasmically produced protein shifted higher to become identical to that of the periplasmically produced version, suggesting that the ATS tail may somehow promote disulfide formation (
(35) Although the present invention has been described in connection with preferred embodiments thereof, it will be appreciated by those skilled in the art that additions, deletions, modifications, and substitutions not specifically described may be made without departing from the spirit and scope of the invention. Terminology used herein should not be construed as being means-plus-function language unless the term means is expressly used in association therewith.
(36) All documents mentioned herein are hereby incorporated by reference for the purpose of disclosing and describing the particular materials and methodologies for which the document was cited.
REFERENCES
(37) 1. Eliezer (2013) The Mysterious C-Terminal Tail of Alpha-Synuclein: Nanobody's Guess. Journal of Molecular Biology, Volume 425, Issue 14, 24 Jul. 2013, Pages 2397-2411 2. Holliger P, Hudson P J (2005) Engineered antibody fragments and the rise of single domains. Nature Biotechnology 23: 1126-1136 3. Kim, Y. M., et al. (2009) Expression of human interferon alpha-1 with enhanced stability via the tagging system of a stabilizing peptide Prot. Expr. Purif. 63, 140-146 4. Park S M, Kim J (2008) A soluble and heat-resistant form of hantavirus nucleocapsid protein for the serodiagnosis of HFRS Journal of Virological Methods 147: 1-9 5. Park, S. M., et al. (2002) Distinct Roles of the N-terminal-binding Domain and the C-terminal-solubilizing Domain of alpha-synuclein, a Molecular Chaperone J. Biol. Chem. 277, 28512-28520 6. Park, S. M., et al. (2002) Stress-Induced Aggregation Profile of GST-alpha-Synuclein Fusion Proteins Biochem. 41, 4137-4146 7. Park, S. M., et al. (2004) Effects of novel peptides derived from the acid tail of synuclein (ATS) on the aggregation and stability of fusion proteins Prot. Eng. Design Sel. 17, 251-260