ANTI-LAP ANTIBODIES AND USES THEREOF
20190144549 ยท 2019-05-16
Inventors
- Barbara S. Fox (Wayland, MA, US)
- Randall Burton (Billerica, MA, US)
- Stavros Kopsiaftis (West Roxbury, MA, US)
- Xiufeng Song (Jamaica Plain, MA, US)
- Patricia Rao (Acton, MA, US)
- Kenneth J. Simon (Milton, MA, US)
- Jessie M. English (Cambridge, MA)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A61K47/6887
HUMAN NECESSITIES
A61K47/6851
HUMAN NECESSITIES
G01N2800/52
PHYSICS
C07K2317/24
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6879
HUMAN NECESSITIES
C07K16/22
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
Abstract
Provided herein are antibodies which bind to latency-associated peptide (LAP) of TGF-1 and are characterized by particular functional features, such as binding specifically to LAP-TGF1 on cells but not to LAP-TGF1 in extracellular matrix, as well as compositions including the same. Also provided are uses of these antibodies in therapeutic applications, such as in the treatment of cancer, and diagnostic applications.
Claims
1. An anti-LAP antibody which inhibits TGF1 activation on immunosuppressive cells for use in treating cancer, wherein the antibody (a) specifically binds to or has been determined to specifically bind to LAP-TGF1 in the absence of an anchor protein, and (b) binds to or has been determined to bind to immunosuppressive cells but not to extracellular matrix.
2-3. (canceled)
4. The antibody of claim 1, wherein the antibody exhibits one or more of the following properties: (a) inhibits or is determined to inhibit TGF activation; (b) binds or is determined to bind to human LAP-TGF1; (c) binds or is determined to bind to murine and human LAP-TGF1; (d) does not bind or is determined not to bind to human LAP-TGF2 and human LAP-TGF3; and (e) does not bind or is determined not to bind to free TGF1 or empty LAP.
5-8. (canceled)
9. The antibody of claim 1, wherein the immunosuppressive cells are suppressive T cells, M2 macrophages, cancer cells expressing LAP-TGF1, and/or monocytic myeloid-derived suppressor cells.
10. The antibody of claim 1, wherein the antibody binds or is determined to bind to LAP-TGF1 complexed with an anchor protein on immunosuppressive cells, but does not bind to the anchor protein or to an epitope composed of residues of both LAP-TGF and the anchor protein.
11. (canceled)
12. The antibody of claim 1, wherein the antibody binds or is determined to bind to both GARP-positive immunosuppressive cells and GARP-negative immunosuppressive cells.
13. The antibody of claim 1, wherein the antibody does not bind or is determined to not to bind to LAP-TGF1 complexed with LTBP1, LTBP3 and/or LTBP4.
14. The antibody of claim 1, wherein the antibody binds or is determined to bind to platelets.
15. (canceled)
16. The antibody of claim 1, wherein the antibody binds or is determined to bind to human LAP-TGF1 comprising K27C and Y75C mutations.
17. The antibody of claim 1, wherein the antibody does not bind or is determined not to bind to human LAP-TGF1 comprising the Y74T mutation.
18. (canceled)
19. The antibody of claim 1, wherein the antibody is a human IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody, or variant thereof.
20. The antibody of claim 1, wherein the antibody is a chimeric, humanized, or human antibody.
21. A bispecific antibody comprising a first and second binding region, wherein the first binding region comprises the antigen binding region of the antibody of claim 1.
22. The bispecific antibody of claim 21, wherein the second binding region specifically binds to a tumor-associated antigen.
23. The bispecific antibody of claim 21, wherein the second binding region specifically binds to CD4, CD8, CD45, CD56, CD14, CD16, CD19, CD11b, CD25, CD20, CD22, CD30, CD38, CD114, CD23, CD163, CD206, CD203, CD200R or CD39.
24. An immunoconjugate comprising the antibody of claim 1 linked to a detectable moiety, a binding moiety, a labeling moiety, or a biologically active moiety.
25. A pharmaceutical composition comprising the antibody of claim 1.
26-28. (canceled)
29. A kit comprising the antibody of claim 1, and instructions for use.
30. A method of inhibiting TGF1 activation on immunosuppressive cells comprising administering to a subject an anti-LAP antibody which inhibits TGF1 activation on immunosuppressive cells, wherein the antibody specifically binds to LAP-TGF1 in the absence of an anchor protein and binds to immunosuppressive cells but not to extracellular matrix.
31. A method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of an anti-LAP antibody which inhibits TGF1 activation on immunosuppressive cells, wherein the antibody specifically binds to LAP-TGF1 in the absence of an anchor protein and binds to immunosuppressive cells but not to extracellular matrix.
32-35. (canceled)
36. The method of claim 31, wherein the cancer is selected from the group consisting of breast cancer, bladder cancer, uterine/cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, lymphoma, leukemia, myeloma, sarcoma, and myelodysplastic syndromes.
37. A method of treating cancer associated with an increased number of circulating platelets or an increased platelet to lymphocyte ratio comprising administering to a subject in need thereof an effective amount of an antibody which specifically binds to LAP, wherein the antibody binds to platelets but does not cause platelet aggregation or platelet degranulation.
38. (canceled)
39. The methods of claim 31, further comprising administering one or more additional therapies.
40. The method of claim 39, wherein the one or more additional therapies is selected from radiation therapy, chemotherapy, an immune checkpoint inhibitor, immunostimulatory therapy, immunosuppressive therapy, cell therapy, and a therapeutic agent.
41. The method of claim 40, wherein the immune checkpoint inhibitor is selected from the group consisting of: an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-LAG-3 antibody, an anti-CTLA-4 antibody, an anti-TIGIT antibody, and an anti-TIM3 antibody.
42. The method of claim 40, wherein the therapeutic agent is selected from the group consisting of an anti-cancer agent, a chemotherapeutic agent, an immunosuppressive agent, an immunomodulatory agent, and an anti-inflammatory agent.
43. A method of detecting LAP comprising contacting a sample with the antibody of claim 1, and detecting the complex.
44. A method of diagnosing a cancer associated with regulatory T cell infiltration comprising contacting a biological sample from a patient afflicted with the cancer with the antibody of claim 1, wherein positive staining with the antibody indicates the cancer is associated with immunosuppressive cell infiltration.
45. A method of diagnosing a cancer associated with GARP-negative suppressive cells comprising contacting a biological sample from a patient afflicted with the cancer with the antibody of claim 1, wherein positive staining with the antibody and negative staining with an anti-GARP antibody indicates the cancer is associated with GARP-negative suppressive cells.
46. A method of selecting a patient afflicted with cancer for treatment with the antibody of claim 1, comprising contacting a biological sample from the patient with the antibody, wherein positive staining with the antibody indicates the cancer is amenable to treatment with the antibody.
47. A method of determining the response of a patient afflicted with cancer to treatment with the antibody of claim 1, comprising contacting a biological sample from the patient with the antibody, wherein reduced staining with the antibody indicates the cancer is responding to treatment with the antibody.
48. A method of selecting an anti-LAP antibody among a plurality of antibodies for the treatment of cancer or fibrosis comprising: (a) determining whether one or more anti-LAP antibodies inhibit TGF1 activation on immunosuppressive cells; (b) determining whether one or more anti-LAP antibodies specifically bind to LAP-TGF1 in the absence of an anchor protein; (c) determining whether one or more anti-LAP antibodies specifically binds to immunosuppressive cells but not to extracellular matrix; and (d) selecting an antibody that (i) inhibits TGF1 activation on immunosuppressive cells; (ii) specifically binds to LAP-TGF1 in the absence of an anchor protein, and (iii) binds to immunosuppressive cells but not to extracellular matrix.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
DETAILED DESCRIPTION
[0080] Provided herein are isolated antibodies that specifically bind to LAP-TGF1 and are characterized by combinations of therapeutically advantageous functional features (e.g., binding to LAP-TGF1 on immunosuppressive cells but not in the extracellular matrix). Also provided herein are methods of making such antibodies, bispecific antibodies, immunoconjugates, pharmaceutical compositions, and methods of treating various diseases/disorders using such antibodies.
Definitions
[0081] In order for the following detailed description to be readily understood, certain terms are first defined. Additional definitions are provided throughout.
[0082] As used herein, comprising is synonymous with including, containing, or characterized by, and is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. As used herein, consisting of excludes any element, step, or ingredient not specified in the claim element. As used herein, consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim. In each instance herein any of the terms comprising, consisting essentially of, and consisting of may be optionally replaced with either of the other two terms, thus describing alternative aspects of the scope of the subject matter. The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein.
[0083] As used herein, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. The use of or or and means and/or unless stated otherwise. Furthermore, use of the term including as well as other forms, such as include, includes, and included, is not limiting.
[0084] The term about as used herein when referring to a measurable value such as an amount, a temporal duration and the like, encompasses variations of up to 10% from the specified value. Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, etc., used herein are to be understood as being modified by the term about.
[0085] One of ordinary skill in the art will appreciate that starting materials, biological and chemical materials, biological and chemical reagents, synthetic methods, purification methods, analytical methods, assay methods, and biological methods other than those specifically exemplified can be employed in the practice of the invention without resort to undue experimentation. All art-known functional equivalents, of any such materials and methods are intended to be included in this disclosure.
[0086] As used herein, Latency associated peptide or LAP refers to the amino-terminal domain of the human TGF1 precursor peptide and has the amino acid sequence set forth in SEQ ID NO: 1. LAP-TGF1 is used herein to refer to the human TGF1 precursor peptide (which includes the TGF1 cytokine) and has the amino acid sequence of SEQ ID NO: 2. LAP can also refer to the amino-terminal domains of the human TGF2 precursor peptide (LAP domain: SEQ ID NO: 3, LAP-TGF2: SEQ ID NO: 4) and human TGF3 precursor peptide (LAP domain: SEQ ID NO: 5, LAP-TGF2: SEQ ID NO: 6), as well as their counterparts from other species (e.g., murine TGF1 precursor peptide (murine LAP domain: SEQ ID NO: 7; murine LAP-TGF1: SEQ ID NO: 8), murine TGF2 precursor peptide (murine LAP domain: SEQ ID NO: 9; murine LAP-TGF2: SEQ ID NO: 10), and murine TGF3 precursor peptide (murine LAP domain: SEQ ID NO: 11; murine LAP-TGF3: SEQ ID NO: 12)) and other naturally occurring allelic, splice variants, and processed forms thereof. LAP is synthesized as a complex with TGF. LAP in the absence of mature TGF is referred to as empty LAP. Unless otherwise specified, empty LAP as used herein refers to LAP originating from the N-terminal domain of human TGF1.
[0087] As used herein free TGF1 refers to the mature TGF1 cytokine, i.e., TGF1 that is not complexed with LAP.
[0088] As used herein, anchor protein refers to a protein that anchors LAP-TGF to a cell surface or to the extracellular matrix. Exemplary anchor proteins include GARP, LRRC33, LTBP1, LTBP3, and LTBP4. GARP and LRRC33 are proteins that anchor LAP-TGF to the surface of cells, and LTBP1, LTBP3, and LTBP4 are proteins that anchor LAP-TGF to the extracellular matrix.
[0089] The term antibody as used herein includes whole antibodies and any antigen binding fragments (i.e., antigen-binding portions) or single chains thereof. An antibody refers, in one embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. In certain naturally occurring antibodies, the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. In certain naturally occurring antibodies, each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
[0090] As used herein, isotype refers to the antibody class (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE antibody) that is encoded by the heavy chain constant region genes.
[0091] Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (K.sub.D) of 10.sup.5 to 10.sup.11 M or less. Any K.sub.D greater than about 10.sup.4 M is generally considered to indicate nonspecific binding. As used herein, an antibody that binds specifically to an antigen refers to an antibody that binds to the antigen and substantially identical antigens with high affinity, which means having a K.sub.D of 10.sup.7 M or less, preferably 10.sup.8 M or less, even more preferably 510.sup.9 M or less, and most preferably between 10.sup.8 M and 10.sup.10 M or less, but does not bind with high affinity to unrelated antigens.
[0092] The phrase antigen-binding portion of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human and/or murine LAP). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term antigen-binding portion of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V.sub.1, V.sub.H, CL and CH1 domains; (ii) a F(ab).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V.sub.H and CH1 domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V.sub.H domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker. Furthermore, although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term antigen-binding portion of an antibody. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies. Antigen-binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
[0093] A multispecific antibody is an antibody (e.g., bispecific antibodies, tri-specific antibodies) that recognizes two or more different antigens or epitopes.
[0094] A bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al., J. Immunol. 148, 1547-1553 (1992). Bifunctional antibodies include, for example, heterodimeric antibody conjugates (e.g., two antibodies or antibody fragments joined together with each having different specificities), antibody/cell surface-binding molecule conjugates (e.g., an antibody conjugated to a non-antibody molecule such as a receptor), and hybrid antibodies (e.g., an antibody having binding sites for two different antigens).
[0095] The term monoclonal antibody, as used herein, refers to an antibody that displays a single binding specificity and affinity for a particular epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a particular epitope.
[0096] The term recombinant antibody, refers to antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for immunoglobulin genes (e.g., human immunoglobulin genes) or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial antibody library (e.g., containing human antibody sequences) using phage display, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of immunoglobulin gene sequences (e.g., human immunoglobulin genes) to other DNA sequences. Such recombinant antibodies may have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis and thus the amino acid sequences of the V.sub.H and V.sub.L regions of the recombinant antibodies are sequences that, while derived from and related to human germline V.sub.H and V.sub.L sequences, may not naturally exist within the human antibody germline repertoire in vivo.
[0097] A human antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences. Also encompassed are antibodies derived from human germline immunoglobulin sequences that include normal somatic hypermutations which alter the germline immunoglobulin sequences relative to the wild-type germline immunoglobulin sequences.
[0098] A humanized antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen. A humanized antibody retains an antigenic specificity similar to that of the original antibody.
[0099] A chimeric antibody refers to an antibody in which the variable regions are derived from one or more species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
[0100] An isolated antibody, as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities.
[0101] An effector function refers to the interaction of an antibody Fc region with an Fc receptor or ligand, or a biochemical event that results therefrom. Exemplary effector functions include Clq binding, complement dependent cytotoxicity (CDC), Fc receptor binding, FcR-mediated effector functions such as ADCC and antibody dependent cell-mediated phagocytosis (ADCP), and downregulation of a cell surface receptor (e.g., the B cell receptor; BCR). Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain).
[0102] An Fc region, Fc domain, or Fc refers to the C-terminal region of the heavy chain of an antibody. Thus, an Fc region comprises the constant region of an antibody excluding the first constant region immunoglobulin domain (e.g., CH1 or CL).
[0103] As used herein, the terms specific binding, selective binding, selectively binds, and specifically binds, refer to antibody binding to an epitope on a predetermined antigen. Typically, the antibody (i) binds with an equilibrium dissociation constant (K.sub.D) of approximately less than 10.sup.7 M, such as approximately less than 10.sup.8 M, 10.sup.9 M or 10.sup.10 M or even lower when determined by, e.g., surface plasmon resonance (SPR) using a predetermined antigen as the analyte and the antibody as the ligand, or Scatchard analysis of binding of the antibody to antigen positive cells, and (ii) binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
[0104] The term cross-reacts, as used herein, refers to the ability of an antibody described herein to bind to LAP-TGF1 from a different species. For example, an antibody described herein that binds human LAP-TGF1 may also bind another species of LAP-TGF1 (e.g., murine LAP-TGF1). Cross-reactivity may be measured by detecting a specific reactivity with purified antigen in binding assays (e.g., SPR, ELISA, bio-layer interferometry) or binding to, or otherwise functionally interacting with, cells physiologically expressing LAP-TGF1 (e.g., HT1080 cells overexpressing LAP-TGF1). Methods for determining cross-reactivity include standard binding assays as described herein, for example, by bio-layer interferometry or flow cytometric techniques.
[0105] As used herein, the term linked refers to the association of two or more molecules. The linkage can be covalent or non-covalent. The linkage also can be genetic (i.e., recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
[0106] The term k.sub.assoc or k.sub.a, as used herein, refers to the association rate of a particular antibody-antigen interaction, whereas the term k.sub.dis or k.sub.d, as used herein, is intended to refer to the dissociation rate of a particular antibody-antigen interaction. The term K.sub.D, as used herein, is intended to refer to the dissociation constant, which is obtained from the ratio of k.sub.d to k.sub.a(i.e., k.sub.d/k.sub.a) and is expressed as a molar concentration (M). K.sub.D values for antibodies can be determined using methods well established in the art. A preferred method for determining the K.sub.D of an antibody is by using surface plasmon resonance, preferably using a biosensor system such as a Biacore system, flow cytometry, bio-layer interferometry, and Scatchard analysis.
[0107] The term EC50 in the context of an in vitro or in vivo assay using an antibody refers to the concentration of an antibody that induces a response that is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
[0108] The term nucleic acid molecule, as used herein, is intended to include DNA molecules and RNA molecules. A nucleic acid molecule may be single-stranded or double-stranded, but preferably is double-stranded DNA.
[0109] The term isolated nucleic acid molecule, as used herein in reference to nucleic acids encoding antibodies or antibody fragments (e.g., V.sub.H, V.sub.L, CDR3), is intended to refer to a nucleic acid molecule in which the nucleotide sequences are essentially free of other genomic nucleotide sequences, e.g., those encoding antibodies that bind antigens other than LAP, which other sequences may naturally flank the nucleic acid in human genomic DNA.
[0110] The term vector, as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as recombinant expression vectors (or simply, expression vectors). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector. However, also included are other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
[0111] The term recombinant host cell (or simply host cell), as used herein, is intended to refer to a cell that comprises a nucleic acid that is not naturally present in the cell, and may be a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term host cell as used herein.
[0112] The term inhibition as used herein, refers to any statistically significant decrease in biological activity, including partial and full blocking of the activity. For example, inhibition can refer to a statistically significant decrease of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% in biological activity.
[0113] As used herein, TGF1 activation refers to the release of the mature cytokine TGF1 from the latent complex made up of LAP and TGF1. There are many mechanisms known to induce TGF1 activation (see Robertson I B, Rifkin D B. Unchaining the beast; insights from structural and evolutionary studies on TGF1 secretion, sequestration, and activation. Cytokine Growth Factor Rev. 2013 August; 24(4):355-72). The mature cytokine can be detected using a specific ELISA or similar detection methodology or through the use of a reporter cell line that expresses a TGF receptor.
[0114] For example, as used herein, the term inhibits TGF1 activation includes any measurable decrease in TGF1 activation, e.g., an inhibition of TGF1 activation by at least about 10%, for example, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 99%, or about 100%, relative to a control (e.g., a control antibody). The inhibition may be specific to a single mechanism of TGF1 activation or may be generalizable to all mechanisms of TGF1 activation. As used herein, the term inhibits TGF1 activation includes inhibition of at least one activation mechanism.
[0115] As used herein, the term enhances TGF1 activation includes any measurable increase in TGF1 activation, e.g., an increase of TGF1 activation by at least about 10%, for example, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, or at least about 200% or more, relative to a control (e.g., a control antibody). The enhancement may be specific to a single mechanism of TGF1 activation or may be generalizable to all mechanisms of TGF1 activation. As used herein, the term enhances TGF1 activation includes enhancement of at least one activation mechanism. The term enhances TGF1 activation also includes activation by the antibody itself in the absence of any additional activating mechanism.
[0116] The terms treat, treating, and treatment, as used herein, refer to therapeutic or preventative measures described herein. The methods of treatment employ administration to a subject with a tumor or cancer or a subject who is predisposed to having such a disease or disorder, an anti-LAP antibody (e.g., anti-human LAP antibody) described herein, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disease or disorder or recurring disease or disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
[0117] Immunotherapy refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response.
[0118] Immunostimulating therapy or immunostimulatory therapy refers to a therapy that results in increasing (inducing or enhancing) an immune response in a subject for, e.g., treating cancer.
[0119] As used herein, immune cell refers to the subset of blood cells known as white blood cells, which include mononuclear cells such as lymphocytes, monocytes, macrophages, and granulocytes.
[0120] As used herein, immunosuppressive cell refers to a cell that contributes to or promotes an immunosuppressive tumor microenvironment. The presence of a population of immunosuppressive cells in a tumor microenvironment increases the tumor's resistance to an immune response, resulting in tumor protection, tumor escape, and/or tumor metastasis. Unless countered in some manner, these immunosuppressive cells can decrease the efficacy of immune-mediated anti-cancer treatments. Exemplary immunosuppressive cells include cancer-associated fibroblasts, myeloid-derived suppressor cells, regulatory T cells (Tregs), tumor cells expressing LAP, and immunosuppressive macrophages. These cell types can be identified by one skilled in the art using, e.g., flow cytometry to identify markers of Tregs (e.g, CD4, FoxP3, CD127, and CD25), macrophages (e.g., CSF-IR, CD203, CD206, CD163, IL-10, and TGF), cancer associated fibroblasts (e.g., alpha smooth muscle actin, fibroblast activation protein, tenascin-C, periostin, NG2, vimentin, desmin, PDGFR alpha and beta, FSP-1, ASPN, and STC1), and myeloid-derived suppressor cells (e.g., CD11b, CD33, CD14, or CD15, and low levels of HLA DR). It is understood that immunosuppressive cells may also be important in suppressing the immune system in other disease states.
[0121] As used herein, suppressive T cells refer to T cells that contribute to or promote an immunosuppressive microenvironment. Exemplary suppressive T cells include CD4+ regulatory T cells and CD8+ regulatory T cells. Such cells can be identified by one skilled in the art using, e.g., flow cytometry to identify markers such as FoxP3, LAP or Helios.
[0122] As used herein, regulatory T cells or Tregs refer to immunosuppressive cells that generally suppress or downregulate induction and proliferation of effector T cells. Tregs generally express the biomarkers CD4, FOXP3, and CD25 and are thought to be derived from the same lineage as nave CD4 cells.
[0123] T effector (T.sub.eff) cells refers to T cells (e.g., CD4+ and CD8+ T cells) with cytolytic activities as well as T helper (Th) cells, which secrete inflammatory cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
[0124] As used herein, administering refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art. Preferred routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase parenteral administration as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation. Alternatively, an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically. Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
[0125] As used herein, cancer refers to a broad group of diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division may result in the formation of malignant tumors or cells that invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
[0126] As used herein, autoimmune disease describes a disease state or syndrome whereby a subject's body produces a dysfunctional immune response against the subject's own body components, with adverse effects.
[0127] As used herein, fibrosis refers to disorders or disease states that are caused by or accompanied by the abnormal deposition of extracellular matrix (i.e., not formation of fibrous tissue in normal organ in tissue). Fibrosis is characterized by excessive accumulation of extracellular matrix in the affected tissue that often results in destruction of its normal architecture and causes significant organ dysfunction. Although fibrotic conditions in various organs have diverse etiologies, fibrosis typically results from chronic persistent inflammation induced by a variety of stimuli, such as chronic infections, ischemia, allergic and autoimmune reactions, chemical insults or radiation injury (from Biernacka, 2011). Fibrosis notably affects the heart, liver, kidney, lung and skin and is also a central feature in many cancers.
[0128] As used herein, cell therapy refers to a method of treatment involving the administration of live cells (e.g., CAR T cells, NK cells).
[0129] The terms treat, treating, and treatment, as used herein, refer to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease. Treatment can be of a subject having a disease or a subject who does not have a disease (e.g., for prophylaxis).
[0130] As used herein, adjunctive or combined administration (coadministration) includes simultaneous administration of the compounds in the same or different dosage form, or separate administration of the compounds (e.g., sequential administration). Thus, a first antibody, e.g., an anti-LAP antibody, and a second, third, or more antibodies or agents can be simultaneously administered in a single formulation. Alternatively, the first and second (or more) antibodies and/or agents can be formulated for separate administration and are administered concurrently or sequentially. Combination therapy, as used herein, means administration of two or more therapeutic agents in a coordinated fashion, and includes, but is not limited to, concurrent dosing. Specifically, combination therapy encompasses both co-administration (e.g. administration of a co-formulation or simultaneous administration of separate therapeutic compositions) and serial or sequential administration, provided that administration of one therapeutic agent is conditioned in some way on administration of another therapeutic agent. For example, one therapeutic agent may be administered only after a different therapeutic agent has been administered and allowed to act for a prescribed period of time. (See, e.g., Kohrt et al. (2011) Blood 117:2423). For example, the anti-LAP antibody can be administered first followed by (e.g., immediately followed by) the administration of a second antibody (e.g., an anti-PD-1 antibody), or vice versa. In one embodiment, the anti-LAP antibody is administered prior to administration of the second antibody. In another embodiment, the anti-LAP antibody is administered, for example, within about 30 minutes of the second antibody. Such concurrent or sequential administration preferably results in both antibodies being simultaneously present in treated patients
[0131] The term effective dose or effective dosage is defined as an amount sufficient to achieve or at least partially achieve a desired effect. A therapeutically effective amount or therapeutically effective dosage of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. A therapeutically effective amount or dosage of a drug includes a prophylactically effective amount or a prophylactically effective dosage, which is any amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease. The ability of a therapeutic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
[0132] The administration of effective amounts of the anti-LAP antibody alone, or anti-LAP antibody combined with an immune checkpoint blocker (e.g., an anti-PD-1 antibody), according to any of the methods provided herein, can result in at least one therapeutic effect, including, for example, reduced tumor growth or size, reduced number of metastatic lesions appearing over time, complete remission, partial remission, or stable disease. For example, the methods of treatment produce a comparable clinical benefit rate (CBR=complete remission (CR)+partial remission (PR)+stable disease (SD) lasting 6 months) better than that achieved without administration of the anti-LAP antibody, or than that achieved with administration of any one of the combined antibodies, e.g., the improvement of clinical benefit rate is about 20% 20%, 30%, 40%, 50%, 60%, 70%, 80% or more.
[0133] By way of example, for the treatment of tumors, a therapeutically effective amount or dosage of the drug inhibits tumor cell growth by at least about 20%, by at least about 30% by at least about 40%, by at least about 50%, by at least about 60%, by at least above 70%, by at least about 80%, or by at least about 90% relative to untreated subjects. In some embodiments, a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., inhibits cell growth or tumor growth by 100%. The ability of a compound, including an antibody, to inhibit tumor growth can be evaluated using the assays described herein. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit cell growth; such inhibition can be measured in vitro by assays known to the skilled practitioner.
[0134] The term patient includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
[0135] As used herein, the term subject includes any human or non-human animal. For example, the methods and compositions described herein can be used to treat a subject having cancer. The term non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
[0136] The term sample refers to tissue, body fluid, or a cell (or a fraction of any of the foregoing) taken from a patient or a subject. Normally, the tissue or cell will be removed from the patient, but in vivo diagnosis is also contemplated. In the case of a solid tumor, a tissue sample can be taken from a surgically removed tumor and prepared for testing by conventional techniques. In the case of lymphomas and leukemias, lymphocytes, leukemic cells, or lymph tissues can be obtained (e.g., leukemic cells from blood) and appropriately prepared. Other samples, including urine, tears, serum, plasma, cerebrospinal fluid, feces, sputum, cell extracts etc. can also be useful for particular cancers.
[0137] As used herein, and/or is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term and/or as used in a phrase such as A and/or B includes A and B, A or B, A alone, and B alone. Likewise, the term and/or as used in a phrase such as A, B, and/or C encompasses each of the following: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A alone; B alone; and C alone.
[0138] As used herein, the terms ug and uM are used interchangeably with g and M, respectively.
[0139] Various aspects described herein are described in further detail in the following subsections.
I. Anti-LAP Antibodies
[0140] Provided herein are anti-LAP antibodies which are characterized by particular therapeutically advantageous functional features or properties, and thus can be used to treat various diseases/disorders.
[0141] In one aspect, provided herein are monoclonal antibodies which specifically bind to LAP-TGF1 on cells (e.g., immune cells, such as immunosuppressive cells) without binding to LAP-TGF1 in the extracellular matrix. These antibodies are useful in the treatment of, e.g., cancer.
[0142] In another aspect, provided herein are monoclonal antibodies which have been determined to specifically bind to LAP-TGF1 on cells (e.g., immune cells, such as immunosuppressive cells) without binding to LAP-TGF1 in the extracellular matrix.
[0143] In another aspect, provided herein are anti-LAP antibodies which selectively inhibit TGF1 activation on immunosuppressive cells without inhibiting TGF1 activation on extracellular matrix for use in treating cancer, wherein the antibody (a) specifically binds to LAP-TGF1 in the absence of an anchor protein, and (b) binds to immunosuppressive cells but not to extracellular matrix.
[0144] In another aspect, provided herein are anti-LAP antibodies which selectively inhibit TGF1 activation on immunosuppressive cells without inhibiting TGF1 activation on extracellular matrix for use in treating cancer, wherein the antibody has been determined to (a) specifically bind to LAP-TGF1 in the absence of an anchor protein, and (b) bind to immunosuppressive cells but not to extracellular matrix.
[0145] In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) LAP-TGF1 (e.g., recombinant LAP-TGF1), for example, with a K.sub.D of 10 nM or less, such as 1 nM or less, as assessed by, e.g., bio-layer interferometry.
[0146] In some embodiments, the anti-LAP antibodies do not bind to LAP-TGF2 and LAP-TGF3, as assessed by, e.g., flow cytometry using cells that overexpress LAP-TGF2 or LAP-TGF3, or bio-layer interferometry with recombinant LAP-TGF2 or LAP-TGF3. For example, in some embodiments, the anti-LAP antibodies bind to LAP-TGF2 or LAP-TGF3 with a signal or affinity that is not significantly above the signal seen with a control antibody (e.g., isotype control) or the signal seen in the absence of anti-LAP antibody (e.g., as described in Example 2).
[0147] In some embodiments, the anti-LAP antibodies inhibit (or are determined to inhibit) TGF1 activation, as assessed by, e.g., ELISA detection of free TGF1 in a culture of P3U1 cells overexpressing LAP-TGF1. In some embodiments, the anti-LAP antibodies inhibit (or are determined to inhibit) TGF1 activation by about 50% or more, e.g., by about 60% or more, by about 70% or more, by about 80% or more, or by about 90% or more, as assessed by, e.g., ELISA detection of free TGF1 in a culture of P3U1 cells overexpressing LAP-TGF1 (e.g., as described in Example 3).
[0148] In some embodiments, the anti-LAP antibodies do not inhibit (or are determined to not inhibit) TGF activation in the ECM, as assessed by, e.g., ELISA detection of free TGF1 in an assay combining a source of LAP-TGF1 in the ECM (e.g., as described in Example 4) with MMP-2, MMP-9, thrombospondin or cells expressing V6 or V8 integrins.
[0149] In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) murine and human LAP-TGF1, as assessed by, e.g., flow cytometry of activated immune cell populations.
[0150] In some embodiments, the anti-LAP antibodies do not bind to (or are determined not to bind to) free TGF1 (i.e., TGF1 without LAP), as assessed by, e.g., ELISA. In some embodiments, the anti-LAP antibodies do not bind to (or are determined not to bind to) empty LAP (i.e., LAP that is not complexed with TGF1), as assessed by, e.g., bio-layer interferometry. For example, in these embodiments, the anti-LAP antibodies bind to free TGF1 or empty with a signal or affinity that is not significantly above the signal seen with a control antibody (e.g., isotype control) or the signal seen in the absence of anti-LAP antibody (e.g., as described in Example 2).
[0151] In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) LAP-TGF1 complexed with an anchor protein on immunosuppressive cells, but does not bind to the anchor protein (e.g., GARP, LRRC33) or to an epitope composed of residues of both LAP-TGF1 and the anchor protein (e.g., GARP, LRRC33). Accordingly, in some embodiments, the anti-LAP antibodies do not bind to GARP. In some embodiments, the anti-LAP antibodies do not bind to LRRC33. In some embodiments, the anti-LAP antibodies do not bind to an epitope composed of residues of both LAP-TGF1 and GARP. In some embodiments, the anti-LAP antibodies do not bind to an epitope composed of residues of both LAP-TGF1 and LRRC33. In some embodiments, the anti-LAP antibodies do not bind to LTBP1. In some embodiments, the anti-LAP antibodies do not bind to LTBP3. In some embodiments, the anti-LAP antibodies do not bind to LTBP4. In some embodiments, the anti-LAP antibodies do not recognize a protease cleavage site in human TGF1 (e.g., the protease cleavage site between the arginine residue at position 58 and the leucine residue at position 59, between the lysine residue at position 56 and the leucine residue at position 57, between the alanine residue at position 79 and the leucine residue at position 80, between the arginine residue at position 85 and the aspartic acid residue at position 86, between the lysine residue at position 106 and the glutamic acid residue at position 107, and/or between the alanine residue at position 76 and the valine residue at position 77). In some embodiments, the anti-LAP antibodies do not recognize the edge of a protease cleavage site in human TGF1 (e.g., the cutting edge at the leucine residue at position 59, the arginine residue at position 58, the leucine residue at position 57, the lysine residue at position 56, the leucine residue at position 80, the alanine residue at position 79, the aspartic acid residue at position 85, the glutamic acid residue at position 107, the lysine residue at position 106, the valine residue at position 77, and/or the alanine residue at position 76).
[0152] In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) human LAP-TGF1 comprising K27C and Y75C mutations. In another embodiment, the anti-LAP antibodies do not bind to (or are determined not to bind to) human LAP-TGF1 comprising a Y74T mutation. In another embodiment, the anti-LAP antibodies bind to (or are determined to bind to) human LAP-TGF1 comprising K27C and Y75C mutations, but not to LAP-TGF1 comprising a Y74T mutation.
[0153] As discussed above, the anti-LAP antibodies bind to (or are determined to bind to) LAP-TGF1 on cells, such as immune cells, e.g., immunosuppressive cells. Immunosuppressive cells include, but are not limited to, suppressive T cells (e.g., regulatory T cells, activated T cells, suppressive CD8+ T cells), M1 macrophages, M2 macrophages, dendritic cells, regulatory B cells, granulocytic MDSCs, and/or monocytic MDSCs, as assessed, e.g., by flow cytometry. In some embodiments, the anti-LAP antibodies bind to cells other than immune cells, such as tumor cells, fibroblasts (including cancer associated fibroblasts), mesenchymal stromal cells, mesenchymal stem cells, hemopoietic stem cells, non-myelinating schwann cells, myofibroblasts, endothelial cells, platelets, megakaryocytes, pericytes, and/or hepatic stellate cells. In some embodiments, the anti-LAP antibodies bind to LAP-TGF1 on both immune cells (e.g., immunosuppressive cells) and non-immune cells.
[0154] In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) LAP-TGF1 on GARP-positive cells (e.g., GARP-positive immunosuppressive cells). In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) LAP-TGF1 on GARP-negative cells (e.g., GARP-negative immunosuppressive cells). In some embodiments, the anti-LAP antibodies bind to (or are determined to bind to) LAP-TGF1 on both GARP-positive and GARP-negative cells (e.g., immunosuppressive cells), as assessed, e.g., by flow cytometry.
[0155] In some embodiments, the anti-LAP antibodies reduce the endogenous expression of CD73. In some embodiments, the anti-LAP antibodies inhibit the increase of CD73 expression caused by a treatment, e.g., radiation.
[0156] In some embodiments, the anti-LAP antibodies bind to LAP-TGF1 expressed on cells (e.g., human or murine LAP-TGF1 expressed on, e.g., P3U1 cells) with an EC.sub.50 of 1000 ng/ml or less, 500 ng/ml or less, 200 ng/ml or less, 150 ng/ml or less, 100 ng/ml or less, 50 ng/ml or less, 25 ng/ml or less, 10 ng/ml or less, 5 ng/ml or less, 2 ng/ml or less, 1 ng/ml to 200 ng/ml, 1 ng/ml to 150 ng/ml, 1 ng/ml to 100 ng/ml, 1 ng/ml to 50 ng/ml, 1 ng/ml to 25 ng/ml, 1 ng/ml to 10 ng/ml, or 1 ng/ml to 5 ng/ml, as measured by flow cytometry (e.g., as described in Example 1).
[0157] Preferably, the anti-LAP antibodies bind to soluble LAP-TGF1 with high affinity, for example, with a K.sub.D of 10.sup.7 M or less, 10.sup.8 M or less, 10.sup.9 M or less, 10.sup.10 M or less, 10.sup.11 M or less, 10.sup.12 M or less, 10.sup.12 M to 10.sup.7 M, 10.sup.7 M to 10.sup.7 M, 10.sup.10 M to 10.sup.7 M, or 10.sup.9 M to 10.sup.7 M, as measured by bio-layer interferometry.
[0158] The binding of anti-LAP antibodies to LAP-TGF1 may also be defined using quantitative immunofluorescence by flow cytometry, which allows the number of antibody molecules bound per cell to be quantified. Accordingly, in some embodiments, the number of anti-LAP antibodies bound to a cell that also expresses GARP may be equal to the number of anti-GARP antibodies bound to that cell, or may be at least 80%, at least 50%, at least 20%, at least 10%, at least 5%, at least 1%, or at least 0.1% of the number of anti-GARP antibodies bound to that cell. In some embodiments, the number of LAP-TGF1 molecules expressed per cell may be quantified using quantitative immunofluorescence using an anti-LAP antibody of a group that detects the majority of LAP molecules; examples of such antibodies include 2F8, 2C9, 16B4 and the anti-LAP monoclonal antibody #27232 (R&D Systems). In some embodiments, the number of anti-LAP antibodies bound to the cell may be equal to the number of LAP molecules on the cell, or may be at least 80%, at least 50%, at least 20%, at least 10%, at least 5%, at least 1% or at least 0.1% of the number of LAP molecules expressed on that cell.
[0159] In some embodiments, the anti-LAP antibodies inhibit TGF1 activation by, for example, 10% or more, for example, 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, or 95% or more, relative to a control (e.g., a control antibody), as measured by ELISA (e.g., as described in Example 3).
[0160] In some embodiments, the anti-LAP antibodies do not bind to LAP-TGF1 in the extracellular matrix, for example, as assessed by ELISA, wherein the O.D. signal for antibody binding is not significantly above the signal seen in the absence of the anti-LAP antibody or the signal seen with a control antibody (e.g., isotype control) (e.g., as described in Example 4).
[0161] In some embodiments, the anti-LAP antibodies bind to LAP-TGF1 on platelets. For example, in some embodiments, at least 5%, at least 10%, at least 20% or at least 50% of platelets can be detected by binding of the anti-LAP antibody (e.g. display a signal above that seen with an isotype control antibody) by flow cytometry (e.g., as described in Example 5).
[0162] In some embodiments, the anti-LAP antibodies bind to platelets but do not cause platelet aggregation or platelet degranulation.
[0163] In some embodiments, the anti-LAP antibodies bind to immune cells, e.g., suppressive T cells (e.g., regulatory T cells), M2 macrophages, monocytic MDSCs, CD11b-positive cells, and/or dendritic cells. For example, in some embodiments, at least 0.5%, at least 1%, at least 2%, at least 5%, at least 7%, at least 10%, at least 20%, or at least 50% of these cell types can be detected by binding of the anti-LAP antibody (e.g. display a signal above that seen with an isotype control antibody) by flow cytometry (e.g., as described in Examples 6-8). In some embodiments, the anti-LAP antibodies are considered to bind to these cell types if they bind 2 standard deviations above isotype control.
[0164] In some embodiments, the anti-LAP antibodies bind to GARP-negative leukocytes. For example, in some embodiments, at least 0.5%, at least 1%, at least 2%, at least 5%, at least 7%, at least 10%, at least 20% or at least 50% of GARP-negative leukocytes can be detected by binding of the anti-LAP antibody (e.g. display a signal above that seen with an isotype control antibody) by flow cytometry (e.g., as described in Example 8).
[0165] In some embodiments, the anti-LAP antibodies described herein bind to murine LAP-TGF1. In some embodiments, the anti-LAP antibodies described herein bind to human LAP-TGF1. In some embodiments, the anti-LAP antibodies described herein bind to both murine and human LAP-TGF1. Binding of anti-LAP antibodies to murine and/or human LAP-TGF1 can be assessed by flow cytometry using cells that overexpress murine or human LAP-TGF1 (e.g., as described in Example 2).
[0166] An antibody that exhibits one or more of the functional properties described above (e.g., biochemical, immunochemical, cellular, physiological or other biological activities), as determined using methods known to the art and described herein, will be understood to relate to a statistically significant difference in the particular activity relative to that seen in the absence of the antibody (e.g., or when a control antibody of irrelevant specificity is present). Preferably, the anti-LAP antibody-induced increases in a measured parameter effects a statistically significant increase by at least 10% of the measured parameter, more preferably by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% (i.e., 2 fold), 3 fold, 5 fold or 10 fold. Conversely, anti-LAP antibody-induced decreases in a measured parameter (e.g., TGF1 activation) effects a statistically significant decrease by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100%.
[0167] In some embodiments, a VH domain of the anti-LAP antibodies described herein is linked to a constant domain to form a heavy chain, e.g., a full-length heavy chain. In some embodiments, the VH domain is linked to the constant domain of a human IgG (e.g., IgG1, IgG2, IgG3, or IgG4), IgD, IgA, IgE, or IgM, or variants thereof (e.g., variants comprising Fc regions with altered effector function). Similarly, a VL domain of the anti-LAP antibodies described herein described herein is linked to a constant domain to form a light chain, e.g., a full-length light chain.
[0168] Antibodies disclosed herein include all known forms of antibodies and other protein scaffolds with antibody-like properties. For example, the antibody can be a human antibody, a humanized antibody, a bispecific antibody, an immunoconjugate, a chimeric antibody, or a protein scaffold with antibody-like properties, such as fibronectin or ankyrin repeats.
[0169] In some embodiments, the antibody is a bispecific antibody comprising a first and second binding region, wherein the first binding region comprises the binding specificity (e.g., antigen-binding region) of an anti-LAP antibody described herein, and a second binding region that does not bind to LAP. In some embodiments, the second binding region binds to a protein that is not expressed on platelets.
[0170] The antibody also can be a Fab, Fab.sub.2, scFv, AFFIBODY, avimer, nanobody, single chain antibody, or a domain antibody. The antibody also can have any isotype, including any of the following isotypes: IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgAsec, IgD, and IgE. Full-length antibodies can be prepared from V.sub.H and V.sub.L sequences using standard recombinant DNA techniques and nucleic acid encoding the desired constant region sequences to be operatively linked to the variable region sequences.
[0171] In certain embodiments, the antibodies described herein may have effector function or may have reduced or no effector function. In certain embodiments, anti-LAP antibodies comprise an effectorless or mostly effectorless Fc, e.g., IgG2 or IgG4. Generally, variable regions described herein may be linked to an Fc comprising one or more modification, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity. Furthermore, an antibody described herein may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, to alter one or more functional properties of the antibody. Each of these embodiments is described in further detail below. The numbering of residues in the Fc region is that of the EU index of Kabat.
[0172] In some embodiments, the Fc region is a variant Fc region, e.g., an Fc sequence that has been modified (e.g., by amino acid substitution, deletion and/or insertion) relative to a parent Fc sequence (e.g., an unmodified Fc polypeptide that is subsequently modified to generate a variant), to provide desirable structural features and/or biological activity. For example, modifications can be made in the Fc region in order to generate an Fc variant that (a) has increased or decreased antibody-dependent cell-mediated cytotoxicity (ADCC), (b) increased or decreased complement mediated cytotoxicity (CDC), (c) has increased or decreased affinity for C1q and/or (d) has increased or decreased affinity for a Fc receptor relative to the parent Fc. Such Fc region variants will generally comprise at least one amino acid modification in the Fc region. Combining amino acid modifications is thought to be particularly desirable. For example, the variant Fc region may include two, three, four, five, etc substitutions therein, e.g. of the specific Fc region positions identified herein.
[0173] A variant Fc region may also comprise a sequence alteration wherein amino acids involved in disulfide bond formation are removed or replaced with other amino acids. Such removal may avoid reaction with other cysteine-containing proteins present in the host cell used to produce the antibodies described herein. Even when cysteine residues are removed, single chain Fc domains can still form a dimeric Fc domain that is held together non-covalently. In other embodiments, the Fc region may be modified to make it more compatible with a selected host cell. For example, one may remove the PA sequence near the N-terminus of a typical native Fc region, which may be recognized by a digestive enzyme in E. coli such as proline iminopeptidase. In other embodiments, one or more glycosylation sites within the Fc domain may be removed. Residues that are typically glycosylated (e.g., asparagine) may confer cytolytic response. Such residues may be deleted or substituted with unglycosylated residues (e.g., alanine). In other embodiments, sites involved in interaction with complement, such as the C1q binding site, may be removed from the Fc region. For example, one may delete or substitute the EKK sequence of human IgG1. In certain embodiments, sites that affect binding to Fc receptors may be removed, preferably sites other than salvage receptor binding sites. In other embodiments, an Fc region may be modified to remove an ADCC site. ADCC sites are known in the art; see, for example, Molec. Immunol. 29 (5): 633-9 (1992) with regard to ADCC sites in IgG1. Specific examples of variant Fc domains are disclosed for example, in WO 97/34631 and WO 96/32478.
[0174] In one embodiment, the hinge region of Fc is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745 by Ward et al.
[0175] In yet other embodiments, the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody. For example, one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260, both by Winter et al. In another example, one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551 by Idusogie et al. In another example, one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351 by Bodmer et al.
[0176] In yet another example, the Fc region may be modified to increase antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity for an Fc receptor by modifying one or more amino acids at the following positions: 234, 235, 236, 238, 239, 240, 241, 243, 244, 245, 247, 248, 249, 252, 254, 255, 256, 258, 262, 263, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 299, 301, 303, 305, 307, 309, 312, 313, 315, 320, 322, 324, 325, 326, 327, 329, 330, 331, 332, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 416, 419, 430, 433, 434, 435, 436, 437, 438 or 439. Exemplary substitutions include 236A, 239D, 239E, 268D, 267E, 268E, 268F, 324T, 332D, and 332E. Exemplary variants include 239D/332E, 236A/332E, 236A/239D/332E, 268F/324T, 267E/268F, 267E/324T, and 267E/268F/324T. Other modifications for enhancing FcyR and complement interactions include but are not limited to substitutions 298A, 333A, 334A, 326A, 2471, 339D, 339Q, 280H, 290S, 298D, 298V, 243L, 292P, 300L, 396L, 305I, and 396L. These and other modifications are reviewed in Strohl, 2009, Current Opinion in Biotechnology 20:685-691.
[0177] Fc modifications that increase binding to an Fc receptor include amino acid modifications at any one or more of amino acid positions 238, 239, 248, 249, 252, 254, 255, 256, 258, 265, 267, 268, 269, 270, 272, 279, 280, 283, 285, 298, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 312, 315, 324, 327, 329, 330, 335, 337, 3338, 340, 360, 373, 376, 379, 382, 388, 389, 398, 414, 416, 419, 430, 434, 435, 437, 438 or 439 of the Fc region, wherein the numbering of the residues in the Fc region is that of the EU index as in Kabat (WO00/42072).
[0178] Other Fc modifications that can be made to Fcs are those for reducing or ablating binding to FcR and/or complement proteins, thereby reducing or ablating Fc-mediated effector functions such as ADCC, ADCP, and CDC. Exemplary modifications include but are not limited substitutions, insertions, and deletions at positions 234, 235, 236, 237, 267, 269, 325, and 328, wherein numbering is according to the EU index. Exemplary substitutions include but are not limited to 234G, 235G, 236R, 237K, 267R, 269R, 325L, and 328R, wherein numbering is according to the EU index. An Fc variant may comprise 236R/328R. Other modifications for reducing FcyR and complement interactions include substitutions 297A, 234A, 235A, 237A, 318A, 228P, 236E, 268Q, 309L, 330S, 331 S, 220S, 226S, 229S, 238S, 233P, and 234V, as well as removal of the glycosylation at position 297 by mutational or enzymatic means or by production in organisms such as bacteria that do not glycosylate proteins. These and other modifications are reviewed in Strohl, 2009, Current Opinion in Biotechnology 20:685-691.
[0179] Optionally, the Fc region may comprise a non-naturally occurring amino acid residue at additional and/or alternative positions known to one skilled in the art (see, e.g., U.S. Pat. Nos. 5,624,821; 6,277,375; 6,737,056; 6,194,551; 7,317,091; 8,101,720; PCT Patent Publications WO 00/42072; WO 01/58957; WO 02/06919; WO 04/016750; WO 04/029207; WO 04/035752; WO 04/074455; WO 04/099249; WO 04/063351; WO 05/070963; WO 05/040217, WO 05/092925 and WO 06/020114).
[0180] Fc variants that enhance affinity for an inhibitory receptor FcyRllb may also be used. Such variants may provide an Fc fusion protein with immunomodulatory activities related to FcyRllb.sup.+ cells, including for example B cells and monocytes. In one embodiment, the Fc variants provide selectively enhanced affinity to FcyRllb relative to one or more activating receptors. Modifications for altering binding to FcyRllb include one or more modifications at a position selected from the group consisting of 234, 235, 236, 237, 239, 266, 267, 268, 325, 326, 327, 328, and 332, according to the EU index. Exemplary substitutions for enhancing FcyRllb affinity include but are not limited to 234D, 234E, 234F, 234W, 235D, 235F, 235R, 235Y, 236D, 236N, 237D, 237N, 239D, 239E, 266M, 267D, 267E, 268D, 268E, 327D, 327E, 328F, 328W, 328Y, and 332E. Exemplary substitutions include 235Y, 236D, 239D, 266M, 267E, 268D, 268E, 328F, 328W, and 328Y. Other Fc variants for enhancing binding to FcyRllb include 235Y/267E, 236D/267E, 239D/268D, 239D/267E, 267E/268D, 267E/268E, and 267E/328F.
[0181] In certain embodiments, the antibody is modified to increase its biological half-life. Various approaches are possible. For example, this may be done by increasing the binding affinity of the Fc region for FcRn. For example, one or more of more of following residues can be mutated: 252, 254, 256, 433, 435, 436, as described in U.S. Pat. No. 6,277,375. Specific exemplary substitutions include one or more of the following: T252L, T254S, and/or T256F. Alternatively, to increase the biological half-life, the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al. Other exemplary variants that increase binding to FcRn and/or improve pharmacokinetic properties include substitutions at positions 259, 308, 428, and 434, including for example 2591, 308F, 428L, 428M, 434S, 434H, 434F, 434Y, and 434M. Other variants that increase Fc binding to FcRn include: 250E, 250Q, 428L, 428F, 250Q/428L (Hinton et al., 2004, J. Biol. Chem. 279(8): 6213-6216, Hinton et al. 2006 Journal of Immunology 176:346-356), 256A, 272A, 286A, 305A, 307A, 307Q, 31 1A, 312A, 376A, 378Q, 380A, 382A, 434A (Shields et al, Journal of Biological Chemistry, 2001, 276(9):6591-6604), 252F, 252T, 252Y, 252W, 254T, 256S, 256R, 256Q, 256E, 256D, 256T, 309P, 31 1 S, 433R, 433S, 433I, 433P, 433Q, 434H, 434F, 434Y, 252Y/254T/256E, 433K/434F/436H, 308T/309P/311S (Dall Acqua et al. Journal of Immunology, 2002, 169:5171-5180, Dall'Acqua et al., 2006, Journal of Biological Chemistry 281:23514-23524). Other modifications for modulating FcRn binding are described in Yeung et al., 2010, J Immunol, 182:7663-7671. In certain embodiments, hybrid IgG isotypes with particular biological characteristics may be used. For example, an IgG1/IgG3 hybrid variant may be constructed by substituting IgG1 positions in the CH2 and/or CH3 region with the amino acids from IgG3 at positions where the two isotypes differ. Thus a hybrid variant IgG antibody may be constructed that comprises one or more substitutions, e.g., 274Q, 276K, 300F, 339T, 356E, 358M, 384S, 392N, 397M, 4221, 435R, and 436F. In other embodiments described herein, an IgG1/IgG2 hybrid variant may be constructed by substituting IgG2 positions in the CH2 and/or CH3 region with amino acids from IgG1 at positions where the two isotypes differ. Thus a hybrid variant IgG antibody may be constructed that comprises one or more substitutions, e.g., one or more of the following amino acid substitutions: 233E, 234L, 235L, -236G (referring to an insertion of a glycine at position 236), and 327A.
[0182] Moreover, the binding sites on human IgG1 for FcR1, FcRII, FcRIII and FcRn have been mapped and variants with improved binding have been described (see Shields, R. L. et al. (2001) J. Biol. Chem. 276:6591-6604). Specific mutations at positions 256, 290, 298, 333, 334 and 339 were shown to improve binding to FcRIII. Additionally, the following combination mutants were shown to improve FcRIII binding: T256A/S298A, S298A/E333A, S298A/K224A and S298A/E333A/K334A, which has been shown to exhibit enhanced FcRIIIa binding and ADCC activity (Shields et al., 2001). Other IgG1 variants with strongly enhanced binding to FcRIIIa have been identified, including variants with S239D/I332E and S239D/I332E/A330L mutations which showed the greatest increase in affinity for FcRIIIa, a decrease in FcRIIb binding, and strong cytotoxic activity in cynomolgus monkeys (Lazar et al., 2006). Introduction of the triple mutations into antibodies such as alemtuzumab (CD52-specific), trastuzumab (HER2/neu-specific), rituximab (CD20-specific), and cetuximab (EGFR-specific) translated into greatly enhanced ADCC activity in vitro, and the S239D/I332E variant showed an enhanced capacity to deplete B cells in monkeys (Lazar et al., 2006). In addition, IgG1 mutants containing L235V, F243L, R292P, Y300L and P396L mutations which exhibited enhanced binding to FcRIIIa and concomitantly enhanced ADCC activity in transgenic mice expressing human FcRIIIa in models of B cell malignancies and breast cancer have been identified (Stavenhagen et al., 2007; Nordstrom et al., 2011). Other Fc mutants that may be used include: S298A/E333A/L334A, 5239D/I332E, S239D/I332E/A330L, L235V/F243L/R292P/Y3001J P396L, and M428L/N434S.
[0183] When using an IgG4 constant domain, it is usually preferable to include the substitution S228P, which mimics the hinge sequence in IgG1 and thereby stabilizes IgG4 molecules.
[0184] In still another embodiment, the glycosylation of an antibody is modified. For example, an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation). Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen. Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may increase the affinity of the antibody for antigen. Such an approach is described in further detail in U.S. Pat. Nos. 5,714,350 and 6,350,861 by Co et al. Glycosylation of the constant region on N297 may be prevented by mutating the N297 residue to another residue, e.g., N297A, and/or by mutating an adjacent amino acid, e.g., 298 to thereby reduce glycosylation on N297.
[0185] Additionally or alternatively, an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies described herein to thereby produce an antibody with altered glycosylation. For example, EP 1,176,195 by Hanai et al. describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation. PCT Publication WO 03/035835 by Presta describes a variant CHO cell line, Lec13 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields, R. L. et al. (2002) J. Biol. Chem. 277:26733-26740). PCT Publication WO 99/54342 by Umana et al. describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., beta(1,4)-N-acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana et al. (1999) Nat. Biotech. 17:176-180).
[0186] Another modification of the antibodies described herein is pegylation. An antibody can be pegylated to, for example, increase the biological (e.g., serum) half-life of the antibody. To pegylate an antibody, the antibody, or fragment thereof, typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. Preferably, the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. In certain embodiments, the antibody to be pegylated is an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies described herein. See for example, EP 0 154 316 by Nishimura et al. and EP 0 401 384 by Ishikawa et al.
[0187] The affinities and binding properties of an Fc region for its ligand may be determined by a variety of in vitro assay methods (biochemical or immunological based assays) known in the art including, but not limited to, equilibrium methods (e.g., enzyme-linked immunosorbent assay (ELISA), or radioimmunoassay (RIA)), or kinetics (e.g., BIACORE analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis, and chromatography (e.g., gel filtration). These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels. A detailed description of binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
Additional Therapeutic Anti-LAP Antibodies
[0188] Also disclosed herein are anti-LAP antibodies which bind to LAP-TGF1 and exhibit two or more of the following features:
[0189] (a) inhibits TGF1 activation;
[0190] (b) binds to extracellular matrix;
[0191] (c) binds to regulatory T cells; and
[0192] (d) binds to GARP-negative leukocytes.
[0193] Examples of such anti-LAP antibodies include antibodies which inhibit TGF activation and bind to extracellular matrix. These antibodies are useful for treating, e.g., cancer and fibrosis.
[0194] Also disclosed herein are anti-LAP antibodies which exhibit two or more of the following features:
[0195] (a) inhibits TGF activation;
[0196] (b) does not bind to extracellular matrix; and
[0197] (c) binds to GARP-negative leukocytes.
[0198] Examples of such anti-LAP antibodies include antibodies which inhibit TGF1 activation, do not bind to extracellular matrix, bind to platelets, bind to regulatory T cells, and bind to GARP-negative leukocytes. These antibodies are useful for treating, e.g., cancer.
[0199] Also disclosed herein are anti-LAP antibodies which exhibit two or more of the following features:
[0200] (a) does not inhibit or enhance TGF1 activation;
[0201] (b) binds to extracellular matrix;
[0202] (c) binds to regulatory T cells; and
[0203] (d) does not bind to GARP-negative leukocytes.
[0204] Examples of such anti-LAP antibodies include antibodies which do not inhibit or enhance TGF1 activation. These anti-LAP antibodies serve to selectively target the antibody to LAP on the surface of cells or in the extracellular matrix, and are useful for e.g., engaging T cell activation, for delivering a toxin or similar agent via ADC or for targeting a bi-specific antibody. As such, these antibodies are useful for treating, e.g., cancer or other diseases where it is desirable to reduce the number of immunosuppressive cells or to deliver an antibody to diseased tissues. These antibodies may exhibit similar effects on TGF1 activation as a control antibody (e.g., an isotype control antibody), e.g., within 10% of the effect of the control antibody, bind to extracellular matrix, bind to platelets, and not bind to regulatory T cells. An anti-LAP antibody is considered to bind to LAP-TGF1 in the extracellular matrix when the signal for binding has an O.D. significantly above the signal seen in the absence of the anti-LAP antibody in an ELISA.
[0205] Also disclosed herein are anti-LAP antibodies which enhance TGF activation. These anti-LAP antibodies are useful for treating, e.g., autoimmune diseases. Such antibodies may also be useful for administering to patients undergoing transplantation by enhancing Tregs and development of tolerance to the graft, which may also help speed healing. These anti-LAP antibodies may increase TGF activation, e.g., by at least about 20%, for example, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, or at least about 200%, relative to a control (e.g., a control antibody), as measured by ELISA.
II. Nucleic Acid Molecules
[0206] Also provided herein are nucleic acid molecules that encode the anti-LAP antibodies described herein. The nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. A nucleic acid described herein can be, for example, DNA or RNA and may or may not contain intronic sequences. In certain embodiments, the nucleic acid is a cDNA molecule. The nucleic acids described herein can be obtained using standard molecular biology techniques. For antibodies expressed by hybridomas (e.g., hybridomas prepared from transgenic mice carrying human immunoglobulin genes as described further below), cDNAs encoding the light and heavy chains of the antibody made by the hybridoma can be obtained by standard PCR amplification or cDNA cloning techniques. For antibodies obtained from an immunoglobulin gene library (e.g., using phage display techniques), nucleic acid encoding the antibody can be recovered from the library.
[0207] In some embodiments, provided herein are nucleic acid molecules that encode the VH and/or VL sequences, or heavy and/or light chain sequences, of any of the anti-LAP antibodies described herein. Host cells comprising the nucleotide sequences (e.g., nucleic acid molecules) described herein are encompassed herein. Once DNA fragments encoding VH and VL segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene. In these manipulations, a VL- or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker. The term operatively linked, as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.
[0208] The isolated DNA encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding DNA to another DNA molecule encoding heavy chain constant regions (hinge, CH1, CH2 and/or CH3). The sequences of human heavy chain constant region genes are known in the art (see e.g., Kabat, E. A., el al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
[0209] The isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL. The sequences of human light chain constant region genes are known in the art (see e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The light chain constant region can be a kappa or lambda constant region.
[0210] Also provided herein are nucleic acid molecules with conservative substitutions that do not alter the resulting amino acid sequence upon translation of the nucleic acid molecule.
III. Methods of Production
[0211] Anti-LAP antibodies with particular functional features, for example, the anti-LAP antibodies described herein, can be generated using art-recognized methods.
[0212] Polyclonal antibodies to LAP-TGF1 (e.g., human LAP-TGF1) can be produced by various procedures well known in the art. For example, LAP-TGF1 or fragments thereof comprising one or more of the LAP-TGF1 ligand interaction sites, can be administered to various host animals including, but not limited to, rabbits, mice, rats, etc. to induce the production of sera containing polyclonal antibodies specific for the protein. Polyclonal antibodies are preferably raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) injections of the relevant antigen and an adjuvant. It can be useful to conjugate the antigen to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soy-bean trypsin inhibitor using a bifunctional or derivatizing agent, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxy-succinimide (through lysine residues), glutaraldehyde, succinic anhydride, SOCI2, or R 1NCNR, where R and R1 are different alkyl groups. Various other adjuvants can be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvum. Suitable adjuvants are also well known to one of skill in the art.
[0213] Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof. Various methods for making monoclonal antibodies described herein are available in the art. For example, the monoclonal antibodies can be made using the hybridoma method first described by Kohler et al, Nature, 256:495 (1975), or any later developments thereof, or by recombinant DNA methods (U.S. Pat. No. 4,816,567). For example, monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed., 1988); Hammer-ling, et al, in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981) (said references incorporated by reference in their entireties). Methods for producing and screening for specific antibodies using hybridoma technology are routine and well known in the art. In another example, antibodies useful in the methods and compositions described herein can also be generated using various phage display methods known in the art, such as isolation from antibody phage libraries generated using the techniques described in McCafferty et al, Nature, 348:552-554 (1990). Clackson et al., Nature, 352:624-628 (1991) and Marks et al, J. Mol. Biol, 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al, Bio/Technology, 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nuc. Acids. Res., 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.
[0214] Human antibodies can be made by a variety of methods known in the art, including phage display methods described above using antibody libraries derived from human immunoglobulin sequences. See also, U.S. Pat. Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741, the contents of which are herein incorporated by reference in their entireties. Human antibodies can also be produced using transgenic mice which express human immunoglobulin genes, and upon immunization are capable of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For an overview of this technology for producing human antibodies, see, Lonberg and Huszar, 1995, Int. Rev. Immunol. 13:65-93. Phage display technology (McCafferty et al, Nature 348:552-553 (1990)) also can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors. Human antibodies can also be generated by in vitro activated B cells (see U.S. Pat. Nos. 5,567,610 and 5,229,275, the contents of which are herein incorporated by reference in their entireties). Completely human antibodies which recognize a selected epitope can be generated using a technique referred to as guided selection. In this approach a selected non-human monoclonal antibody, e.g., a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope (Jespers et al, 1994, Bio/technology 12:899-903).
[0215] Chimeric antibodies can be prepared based on the sequence of a murine monoclonal antibody. DNA encoding the heavy and light chain immunoglobulins can be obtained from the murine hybridoma of interest and engineered to contain non-murine (e.g., human) immunoglobulin sequences using standard molecular biology techniques. For example, to create a chimeric antibody, the murine variable regions can be linked to human constant regions using methods known in the art (see e.g., U.S. Pat. No. 4,816,567 to Cabilly et al.).
[0216] Humanized forms of anti-LAP antibodies (e.g., humanized forms of mouse anti-LAP antibodies) are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies are typically human immunoglobulins (recipient antibody) in which residues from a CDR or hypervariable region of the recipient are replaced by residues from a CDR or hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
[0217] The framework and CDR regions of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor antibody CDR or the consensus framework can be mutagenized by substitution, insertion and/or deletion of at least one amino acid residue so that the CDR or framework residue at that site does not correspond exactly to either the donor antibody or the consensus framework. As used herein, the term consensus framework refers to the framework region in the consensus immunoglobulin sequence. As used herein, the term consensus immunoglobulin sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related immunoglobulin sequences (see e.g., Winnaker, From Genes to Clones (Veriagsgesellschaft, Weinheim, Germany 1987). In a family of immunoglobulins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. Where two amino acids occur equally frequently, either can be included in the consensus sequence. As used herein, Vernier zone refers to a subset of framework residues that may adjust CDR structure and fine-tune the fit to antigen as described by Foote and Winter (1992, J. Mol. Biol. 224:487-499, which is incorporated herein by reference). Vernier zone residues form a layer underlying the CDRs and can impact on the structure of CDRs and the affinity of the antibody. Human immunoglobulin (Ig) sequences that can be used as a recipient are well known in the art.
[0218] Framework residues in the human framework regions can be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089; Riechmann et al., Nature 332:323 (1988), which are incorporated herein by reference in their entireties.) Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the consensus and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding. Antibodies can be humanized using a variety of techniques known in the art, including, but not limited to, those described in Jones et al., Nature 321:522 (1986); Verhoeyen et al., Science 239: 1534 (1988), Sims et al., J. Immunol. 151: 2296 (1993); Chothia and Lesk, J. Mol. Biol. 196:901 (1987), Carter et al, Proc. Natl. Acad. Sci. U.S.A. 89:4285 (1992); Presta et al, J. Immunol. 151:2623 (1993), Padlan, Molecular Immunology 28(4/5):489-498 (1991); Studnicka et al., Protein Engineering 7(6):805-814 (1994); Roguska. et al., PNAS 91:969-973 (1994); PCT publication WO 91/09967, PCT: US98/16280, US96/18978, US91/09630, US91/05939, US94/01234, GB89/01334, GB91/01134, GB92/01755; WO90/14443, WO90/14424, WO90/14430, EP 229246, EP 592,106; EP 519,596, EP 239,400, U.S. Pat. Nos. 5,565,332, 5,723,323, 5,976,862, 5,824,514, 5,817,483, 5,814,476, 5,763,192, 5,723,323, 5,766,886, 5,714,352, 6,204,023, 6,180,370, 5,693,762, 5,530, 101, 5,585,089, 5,225,539; 4,816,567, each entirely incorporated herein by reference.
[0219] The anti-LAP antibodies generated using the methods described above can be tested for desired functions, such as particular binding specificities, binding affinities, targeted cell populations, using methods known in the art and described in the Examples, for example, art-recognized protein-protein binding assays, biochemical screening assays, immunoassays, and cell-based assays. Exemplary assays include, but are not limited to, immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA), FACS, enzyme-linked immunoabsorbent assay (ELISA), bio-layer interferometry (e.g., ForteBio assay), and Scatchard analysis.
IV. Multispecific Antibodies
[0220] Multispecific antibodies (e.g., bispecific antibodies) provided herein include at least one binding region for a particular epitope on LAP-TGF1 (e.g., human LAP-TGF1) as described herein, and at least one other binding region (e.g., a cancer antigen). Multispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab).sub.2 antibodies).
[0221] Methods for making multispecific antibodies are well known in the art (see, e.g., WO 05117973 and WO 06091209). For example, production of full length multispecific antibodies can be based on the coexpression of two paired immunoglobulin heavy chain-light chains, where the two chains have different specificities. Various techniques for making and isolating multispecific antibody fragments directly from recombinant cell culture have also been described. For example, multispecific antibodies can be produced using leucine zippers. Another strategy for making multispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported.
[0222] Examples of suitable multispecific molecule platforms include, but are not limited to, Dual Targeting (DT)-Ig (GSK/Domantis), Two-in-one Antibody (Genentech), Cross-linked Mabs (Karmanos Cancer Center), Fcab and mAb.sup.2 (F-Star), CovX-body (CovX/Pfizer), Dual Variable Domain (DVD)-Ig (Abbott), IgG-like Bispecific (ImClone/Eli Lilly), Ts2Ab (Medlmmune/AZ) and BsAb (Zymogenetics), HERCULES (Biogen Idee), TvAb (Roche), ScFv/Fc Fusions, SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS), Dual Affinity Retargeting Technology (Fc-DART) (MacroGenics), Dual(ScFv)2-Fab (National Research Center for Antibody MedicineChina), F(ab)2 (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol), SEED (EMD Serono), mAb.sup.2 (F-star), Fab-Fv (UCB-Celltech), Bispecific T Cell Engager (BiTE) (Micromet, Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DART) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), COMBODY (Epigen Biotech), dual targeting nanobodies (Ablynx), and Fc-engineered IgG1 (Xencor).
[0223] In a particular embodiment, the multispecific antibody comprises a first antibody (or binding portion thereof) which binds to LAP-TGF1 derivatized or linked to another functional molecule, e.g., another peptide or protein (e.g., another antibody or ligand for a receptor) to generate a multispecific molecule that binds to LAP-TGF1 and a non-LAP target molecule. An antibody may be derivatized or linked to more than one other functional molecule to generate multispecific molecules that bind to more than two different binding sites and/or target molecules. To create a multispecific molecule, an antibody disclosed herein can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide, receptor, or binding mimetic, such that a multispecific molecule results.
[0224] Accordingly, multispecific molecules, for example, bispecific antibodies and bifunctional antibodies, comprising at least one first binding specificity for a particular epitope on LAP-TGF1 (e.g., human LAP-TGF1) and a second binding specificity for a second target are contemplated. In some embodiments, the second target is the second binding region specifically binds to a tumor-associated antigen. Tumor-associated antigens are well known in the art. Exemplary tumor-associated antigens include, but are not limited to, AFP, ALK, BAGE proteins, -catenin, brc-abl, BRCA1, BORIS, CA9, carbonic anhydrase IX, caspase-8, CCR5, CD19, CD20, CD30, CDK4, CEA, cyclin-B1, CYPB 1, EGFR, EGFRvIII, ErbB2/Her2, ErbB3, ErbB4, ETV6-AML, EpCAM, EphA2, Fra-1, FOLR1, GAGE proteins (e.g., GAGE-1, -2), GD2, GD3, GloboH, glypican-3, GM3, gp100, Her2, HLA/B-raf, HLA/k-ras, HLA/MAGE-A3, hTERT, LMP2, MAGE proteins (e.g., MAGE-1, -2, -3, -4, -6, and -12), MART-1, mesothelin, ML-IAP, Muc1, Muc2, Muc3, Muc4, Muc5, Muc16 (CA-125), MUM1, NA17, NY-BR1, NY-BR62, NY-BR85, NY-ESO1, OX40, p15, p53, PAP, PAX3, PAX5, PCTA-1, PLAC1, PRLR, PRAME, PSMA (FOLH1), RAGE proteins, Ras, RGS5, Rho, SART-1, SART-3, Steap-1, Steap-2, STn, survivin, TAG-72, TGF-, TMPRSS2, Tn, TRP-1, TRP-2, tyrosinase, and uroplakin-3.
[0225] In some embodiments, the second binding region of the bispecific antibody specifically binds to CD4, CD8, CD45, CD56, CD14, CD16, CD19, CD20, CD25, CD38, CD11b, CD22, CD30, CD39, CD114, CD23, CD163, CD206, CD203, CD200R, PD-1, PD-L1, PD-L2, CTLA-4, IDO, TIM-3, LAG-3, TIGIT, PVR, PVRL2, B7H3, B7H4, CSF-1R, VISTA, KIR, OX-40, GITR, 4-1BB, CD40, CD40L, CD27/CD70, CD28, ICOS, CD3, CD56, NKG2DA, NKG2DB, NKG2DC, NKG2DD, NKG2DF, NKG2DH, CD94, NKP46, NKP30, CD33, CD73, CD47, LILRB 1, CD91, calreticulin, CD122, GARP, LRRC33, LAP2, LAP3, TGF1, TGF2, TGF3, FAP, and stanniocalcin 1. In some embodiments, the second binding region has agonistic properties when binding to a target, e.g., a TNF family member agonist, OX40 ligand, CD137 ligand, CD137 agonist, STING agonist, GITR agonist, ICOS agonist, and CD28 agonist.
[0226] In some embodiments, the antibody is a trispecific antibody comprising a first, second, and third binding region, wherein the first binding region comprises the binding specificity (e.g., antigen-binding region) of an anti-LAP antibody described herein, and the second and third binding regions bind to two different targets (or different epitopes on the same target), for example, the targets described above.
[0227] In some embodiments, the antibody is a bifunctional antibody comprising an anti-LAP antibody described herein and a receptor molecule (i.e., a receptor trap construct such as a TGF superfamily ligand receptor (e.g., ActRIIB and variants thereof) or VEGFR).
[0228] In one embodiment, the multispecific molecules comprise as a binding specificity at least one antibody, or an antibody fragment thereof, including, e.g., an Fab, Fab, F(ab).sub.2, Fv, or a single chain Fv. The antibody may also be a light chain or heavy chain dimer, or any minimal fragment thereof such as a Fv or a single chain construct as described in Ladner et al. U.S. Pat. No. 4,946,778.
[0229] The multispecific molecules can be prepared by conjugating the constituent binding specificities, e.g., the anti-FcR and anti-LAP binding specificities, using methods known in the art. For example, each binding specificity of the multispecific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation. Examples of cross-linking agents include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane-1-carboxylate (sulfo-SMCC). Preferred conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, Ill.).
[0230] When the binding specificities are antibodies, they can be conjugated via sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains. In a particularly preferred embodiment, the hinge region is modified to contain an odd number of sulfhydryl residues, preferably one, prior to conjugation.
[0231] Alternatively, both binding specificities can be encoded in the same vector and expressed and assembled in the same host cell. This method is particularly useful where the multispecific molecule is a mAbmAb, mAbFab, FabF(ab).sub.2 or ligand x Fab fusion protein. A multispecific molecule can be a single chain molecule comprising one single chain antibody and a binding determinant, or a single chain bispecific molecule comprising two binding determinants. Multispecific molecules may comprise at least two single chain molecules. Methods for preparing multispecific molecules are described for example in U.S. Pat. Nos. 5,260,203; 5,455,030; 4,881,175; 5,132,405; 5,091,513; 5,476,786; 5,013,653; 5,258,498; and 5,482,858.
[0232] Binding of the multispecific molecules to their specific targets can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g., growth inhibition), or western blot assay. Each of these assays generally detects the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody) specific for the complex of interest. For example, the FcR-antibody complexes can be detected using e.g., an enzyme-linked antibody or antibody fragment which recognizes and specifically binds to the antibody-FcR complexes. Alternatively, the complexes can be detected using any of a variety of other immunoassays. For example, the antibody can be radioactively labeled and used in a radioimmunoassay (RIA). The radioactive isotope can be detected by such means as the use of a - counter or a scintillation counter or by autoradiography.
V. Immunoconjugates
[0233] Immunoconjugates comprising the anti-LAP antibodies described herein can be formed by conjugating the antibodies to another therapeutic agent to form, e.g., an antibody-drug conjugate (ADC). Suitable agents include, for example, a cytotoxic agent (e.g., a chemotherapeutic agent), a toxin (e.g. an enzymatically active toxin of bacterial, fungal, plant or animal origin, or fragments thereof), and/or a radioactive isotope (i.e., a radioconjugate). Additional suitable agents include, e.g., antimetabolites, alkylating agents, DNA minor groove binders, DNA intercalators, DNA crosslinkers, histone deacetylase inhibitors, nuclear export inhibitors, proteasome inhibitors, topoisomerase I or II inhibitors, heat shock protein inhibitors, tyrosine kinase inhibitors, antibiotics, and anti-mitotic agents. In some embodiments, ADCs with the anti-LAP antibodies described herein (e.g., conjugated to a cytotoxic agent) that bind to immunosuppressive cells (e.g., regulatory T cells) can be used to deplete the immunosuppressive cells from, e.g., the tumor microenvironment.
[0234] Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, neomycin, and the tricothecenes. Additional examples of cytotoxins or cytotoxic agents include, e.g., taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine and vinblastine).
[0235] In the ADC, the antibody and therapeutic agent preferably are conjugated via a cleavable linker such as a peptidyl, disulfide, or hydrazone linker. More preferably, the linker is a peptidyl linker such as Val-Cit, Ala-Val, Val-Ala-Val, Lys-Lys, Pro-Val-Gly-Val-Val (SEQ ID NO: 48), Ala-Asn-Val, Val-Leu-Lys, Ala-Ala-Asn, Cit-Cit, Val-Lys, Lys, Cit, Ser, or Glu. The ADCs can be prepared as described in U.S. Pat. Nos. 7,087,600; 6,989,452; and 7,129,261; PCT Publications WO 02/096910; WO 07/038658; WO 07/051081; WO 07/059404; WO 08/083312; and WO 08/103693; U.S. Patent Publications 20060024317; 20060004081; and 20060247295; the disclosures of which are incorporated herein by reference. A variety of radionuclides are available for the production of radioconjugated anti-LAP antibodies. Examples include .sup.212 Bi, .sup.131 I, .sup.131 In, .sup.90Y and .sup.186 Re.
[0236] Immunoconjugates can also be used to modify a given biological response, and the drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity (e.g., lymphokines, tumor necrosis factor, IFN, growth factors).
[0237] Immunoconjugates can be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody (see, e.g., WO94/11026).
[0238] Techniques for conjugating such therapeutic moiety to antibodies are well known, see, e.g., Arnon et al., Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy, in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Hellstrom et al., Antibodies For Drug Delivery, in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review, in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy, in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates, Immunol. Rev., 62:119-58 (1982).
[0239] The anti-LAP antibodies described herein also are used for diagnostic purposes. Such antibodies can be conjugated to an appropriate detectable agent to form an immunoconjugate. For diagnostic purposes, appropriate agents are detectable labels that include radioisotopes, for whole body imaging, and radioisotopes, enzymes, fluorescent labels and other suitable antibody tags for sample testing.
[0240] The detectable labels can be any of the various types used currently in the field of in vitro diagnostics, including particulate labels, isotopes, chromophores, fluorescent markers, luminescent markers, metal labels (e.g., for CyTOF, imaging mass cytometry), phosphorescent markers and the like, as well as enzyme labels that convert a given substrate to a detectable marker, and polynucleotide tags that are revealed following amplification such as by polymerase chain reaction. Suitable enzyme labels include horseradish peroxidase, alkaline phosphatase and the like. For instance, the label can be the enzyme alkaline phosphatase, detected by measuring the presence or formation of chemiluminescence following conversion of 1,2 dioxetane substrates such as adamantyl methoxy phosphoryloxy phenyl dioxetane (AMPPD), disodium 3-(4-(methoxyspiro {1,2-dioxetane-3,2-(5-chloro)tricyclo (3.3.1.1 3,7}decan}-4-yl) phenyl phosphate (CSPD), as well as CDP and CDP-Star or other luminescent substrates well-known to those in the art, for example the chelates of suitable lanthanides such as Terbium(III) and Europium(III). The detection means is determined by the chosen label. Appearance of the label or its reaction products can be achieved using the naked eye, in the case where the label is particulate and accumulates at appropriate levels, or using instruments such as a spectrophotometer, a luminometer, a fluorimeter, and the like, all in accordance with standard practice.
[0241] Preferably, conjugation methods result in linkages which are substantially (or nearly) non-immunogenic, e.g., peptide- (i.e. amide-), sulfide-, (sterically hindered), disulfide-, hydrazone-, and ether linkages. These linkages are nearly non-immunogenic and show reasonable stability within serum (see e.g. Senter, P. D., Curr. Opin. Chem. Biol. 13 (2009) 235-244; WO 2009/059278; WO 95/17886).
[0242] Depending on the biochemical nature of the moiety and the antibody, different conjugation strategies can be employed. In case the moiety is naturally occurring or recombinant of between 50 to 500 amino acids, there are standard procedures in text books describing the chemistry for synthesis of protein conjugates, which can be easily followed by the skilled artisan (see e.g. Hackenberger, C. P. R., and Schwarzer, D., Angew. Chem. Int. Ed. Engl. 47 (2008) 10030-10074). In one embodiment the reaction of a maleinimido moiety with a cysteine residue within the antibody or the moiety is used. This is an especially suited coupling chemistry in case e.g. a Fab or Fab-fragment of an antibody is used. Alternatively in one embodiment coupling to the C-terminal end of the antibody or moiety is performed. C-terminal modification of a protein, e.g. of a Fab-fragment can e.g. be performed as described (Sunbul, M. and Yin, J., Org. Biomol. Chem. 7 (2009) 3361-3371).
[0243] In general, site specific reaction and covalent coupling is based on transforming a natural amino acid into an amino acid with a reactivity which is orthogonal to the reactivity of the other functional groups present. For example, a specific cysteine within a rare sequence context can be enzymatically converted in an aldehyde (see Frese, M. A., and Dierks, T., ChemBioChem. 10 (2009) 425-427). It is also possible to obtain a desired amino acid modification by utilizing the specific enzymatic reactivity of certain enzymes with a natural amino acid in a given sequence context (see, e.g., Taki, M. et al., Prot. Eng. Des. Sel. 17 (2004) 119-126; Gautier, A. et al. Chem. Biol. 15 (2008) 128-136; and Protease-catalyzed formation of CN bonds is used by Bordusa, F., Highlights in Bioorganic Chemistry (2004) 389-403). Site specific reaction and covalent coupling can also be achieved by the selective reaction of terminal amino acids with appropriate modifying reagents. The reactivity of an N-terminal cysteine with benzonitrils (see Ren, H. et al., Angew. Chem. Int. Ed. Engl. 48 (2009) 9658-9662) can be used to achieve a site-specific covalent coupling. Native chemical ligation can also rely on C-terminal cysteine residues (Taylor, E. Vogel; Imperiali, B, Nucleic Acids and Molecular Biology (2009), 22 (Protein Engineering), 65-96).
[0244] The moiety may also be a synthetic peptide or peptide mimic. In case a polypeptide is chemically synthesized, amino acids with orthogonal chemical reactivity can be incorporated during such synthesis (see e.g. de Graaf, A. J. et al., Bioconjug. Chem. 20 (2009) 1281-1295). Since a great variety of orthogonal functional groups is at stake and can be introduced into a synthetic peptide, conjugation of such peptide to a linker is standard chemistry.
[0245] In some embodiments, the moiety attached to an anti-LAP antibody is selected from the group consisting of a detectable moiety, binding moiety, a labeling moiety, and a biologically active moiety.
VI. Assays
[0246] Following the production and isolation of antibodies, they can be tested for desired properties, e.g., those described herein, using a variety of assays known in the art.
[0247] In one embodiment, the antibodies are tested for specific binding to LAP-TGF1 (e.g., human LAP-TGF1). Methods for analyzing binding affinity, cross-reactivity, and binding kinetics of various anti-LAP antibodies include standard assays known in the art, for example, Biacore surface plasmon resonance (SPR) analysis using a Biacore 2000 SPR instrument (Biacore AB, Uppsala, Sweden) or bio-layer interferometry (e.g., ForteBio assay), as described in the Examples. In some embodiments, the LAP used in the binding assay is complexed with TGF1. In some embodiments, the LAP used in the binding assay is not complexed with TGF1. In some embodiments, the LAP used in the binding assay is complexed with TGF1 and GARP or a fragment of GARP or LRRC33 or a fragment of LRRC33. In some embodiments the LAP used in the binding assay is complexed with TGF1 and LTBP (e.g., LTBP1, LTBP3, or LTBP4) or a fragment of LTBP.
[0248] In one embodiment, the antibodies are tested for the ability to bind to cells that have been transfected with LAP-TGF1. In some embodiments the cells have also been transfected with GARP or LRRC33.
[0249] In one embodiment, the antibodies are screened for the ability to bind to the surface of beads that have been coated with LAP.
[0250] In one embodiment, the antibodies are screened for the ability to bind to LAP on cells expressing a heparin sulfate glycoprotein such as syndecan-4. For example, heparin sulfate glycoprotein-expressing cells are incubated with LAP or with LAP complexed to LTBP (e.g., LTBP1, LTBP3, or LTBP4) and the antibodies are screened for binding by flow cytometry.
[0251] In one embodiment, the antibodies are tested for the ability to bind or affect TGF1. In one embodiment, the antibodies are screened for the ability to bind or affect TGF2. In one embodiment, the antibodies are tested for the ability to bind or affect TGF3.
[0252] In another embodiment, the antibodies are tested for their effects on TGF activation (e.g., inhibition, stimulation, or no effect). In some embodiments, TGF1 activation is mediated by the binding of integrins including, but not limited, to v6, v8, v3, or v1. In some embodiments, TGF1 activation is mediated by matrix metalloproteases including, but not limited to, MMP2 and MMP9. In some embodiments, TGF1 activation is mediated by thrombospondin. In some embodiments, TGF1 activation is mediated by serum proteases. In some embodiments, TGF1 activation is mediated by heat, by shear forces, by a shift in pH or by ionizing radiation. In some embodiments, TGF1 activation is mediated by reactive oxygen species (ROS). The source of LAP in the activation assays can be LAP on the surface of a transfected cell line, LAP on the surface of a cell population that expresses LAP endogenously or in response to specific stimuli, LAP bound to extracellular matrix, LAP in solution (e.g., recombinant LAP), either complexed with TGF1 or without TGF1 or complexed with TGF1 and an anchor protein, such as GARP, LRRC33, LTBP1, LTBP3, or LTBP4. LAP-TGF1 can be purchased from R&D Systems or can be isolated from cell supernatants. The effect an antibody has on TGF1 activation can be determined, for example, using an ELISA (e.g., as described in Example 3) which measures levels of active TGF1 under different conditions (e.g., with or without antibody). The effect an antibody has on LAP-TGF1 activation can also be determined using a reporter cell line that expresses TGF receptor and responds to mature TGF.
[0253] In another embodiment, the antibodies are tested for the ability to bind LAP in the extracellular matrix. Suitable methods for determining whether antibodies bind to LAP in the extracellular matrix include in vitro assays, wherein cells (e.g., P3U1 cells transfected with LAP-TGF) are cultured to lay down ECM on culture plates and subsequently removed, and labeled antibodies are tested for their ability to bind to the LAP and ECM left on the culture plate surface (e.g., as described in Example 4). Similar assays can be run using fibroblast cell lines or other cells that are known to secrete LAP-TGF and extracellular matrix components. In some embodiments, whether or not the anti-LAP antibodies bind to or do not bind to ECM can be determined by an ELISA, where the ECM has been shown to express latent TGF using commercially available antibodies.
[0254] In another embodiment, the antibodies are tested for their ability to bind to particular cell types, e.g., immune cells (e.g., immunosuppressive cells, leukocytes) or platelets. The binding of antibodies to certain leukocyte populations (e.g., Tregs, macrophages, MDSCs, GARP-negative cells) can be determined using flow cytometry, for example, as described in Examples 6-8.
[0255] Antibodies can also be tested for their ability to inhibit the proliferation or viability of cells (either in vivo or in vitro), such as tumor cells, using art-recognized methods (e.g., 3H-thymidine incorporation, immunohistochemistry with proliferation markers, animal cancer models).
[0256] Antibodies can also be tested for their anti-tumor activity in vivo (e.g., as monotherapy or combination therapy), using syngeneic tumor models well known in the art, such as the CT26 colorectal tumor model, EMT6 breast cancer model, and 4T1 breast cancer tumor metastasis model. Anti-LAP antibodies can also be tested in tumor xenogragft models which are known to be inhibited by anti-TGF antibodies (e.g., Detroit 562 tumor xenograft model). Exemplary methods for treating these models with anti-LAP antibodies are described, e.g., in Examples 10-14.
[0257] Exemplary criteria for determining whether an anti-LAP antibody exhibits certain properties (e.g., binding, inhibition of LAP-TGF1 activation, activation of LAP-TGF1) are shown in Table 1.
TABLE-US-00001 TABLE 1 Antibody Property Positive Binding to cells or ECM, as assessed 2 SD above the mean of a negative control by ELISA Binding to cell types, as assessed by 2 SD above the mean (MFI on a homogeneous cell flow cytometry line or cell population) of a negative control Binding to TGF by a binding assay 100-fold difference in affinity relative to a (e.g., bio-layer interferometry negative control Inhibition of TGF1 activation 50% reduction in mature TGF1 levels in an in vitro culture relative to negative control when tested at antibody concentrations of 8 ug/mL Activation of TGF1 2-fold increase in mature TGF1 levels in an in vitro culture relative to negative control when tested at antibody concentrations of 8 ug/mL
VII. Compositions
[0258] Also provided herein are compositions (e.g., pharmaceutical compositions) comprising the anti-LAP antibodies described herein, immunoconjugates comprising the same, or bispecific antibodies comprising the same, and a carrier (e.g., pharmaceutically acceptable carrier). Such compositions are useful for various therapeutic applications.
[0259] In some embodiments, pharmaceutical compositions disclosed herein can include other compounds, drugs, and/or agents used for the treatment of various diseases (e.g., cancer, fibrosis, autoimmune diseases). Such compounds, drugs, and/or agents can include, for example, an anti-cancer agent, a chemotherapeutic agent, an immunosuppressive agent, an immunostimulatory agent, an immune checkpoint inhibitor, and/or an anti-inflammatory agent. Exemplary compounds, drugs, and agents that can be formulated together or separately with the anti-LAP antibodies described herein are described in the next section (i.e., Section VIII; Uses and Methods).
[0260] As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active compound, i.e., antibody, immunoconjugate, or bispecific molecule, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
[0261] The pharmaceutical compounds described herein may include one or more pharmaceutically acceptable salts. A pharmaceutically acceptable salt refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
[0262] A pharmaceutical composition described herein may also include a pharmaceutically acceptable anti-oxidant. Examples of pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
[0263] Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions described herein include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
[0264] Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions described herein is contemplated. A pharmaceutical composition may comprise a preservative or may be devoid of a preservative. Supplementary active compounds can be incorporated into the compositions.
[0265] Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
[0266] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated herein. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0267] The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 percent to about ninety-nine percent of active ingredient, preferably from about 0.1 percent to about 70 percent, most preferably from about 1 percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier.
[0268] Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms described herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
[0269] For administration of the antibody, the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 or 10 mg/kg, of the host body weight. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
[0270] An antibody can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
[0271] Actual dosage levels of the active ingredients in the pharmaceutical compositions described herein may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions described herein employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
[0272] A therapeutically effective dosage of an anti-LAP antibody described herein preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. In the context of cancer, a therapeutically effective dose preferably results in increased survival, and/or prevention of further deterioration of physical symptoms associated with cancer. A therapeutically effective dose may prevent or delay onset of cancer, such as may be desired when early or preliminary signs of the disease are present.
[0273] A composition described herein can be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Preferred routes of administration for antibodies described herein include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase parenteral administration as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
[0274] Alternatively, an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
[0275] The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
[0276] Therapeutic compositions can be administered with medical devices known in the art. For example, in a preferred embodiment, a therapeutic composition described herein can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules for use with anti-LAP antibodies described herein include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicants through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. These patents are incorporated herein by reference. Many other such implants, delivery systems, and modules are known to those skilled in the art.
[0277] In certain embodiments, the anti-LAP antibodies described herein can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds described herein cross the BBB (if desired, e.g., for brain cancers), they can be formulated, for example, in liposomes. For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade (1989) J. Clin. Pharmacol. 29:685). Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun. 153:1038); antibodies (P. G. Bloeman et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233:134); p120 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4:273.
VIII. Uses and Methods
[0278] The antibodies, antibody compositions, and methods described herein have numerous in vitro and in vivo utilities.
[0279] For example, provided herein is a method of treating cancer comprising administering to a subject in need thereof an anti-LAP antibody described herein, such that the subject is treated, e.g., such that growth of cancerous tumors is inhibited or reduced and/or that the tumors regress and/or that prolonged survival is achieved.
[0280] In one embodiment, provided herein is a method of treating cancer comprising administering to a subject in need thereof an effective amount of an anti-LAP antibody (or a bispecific antibody or immunoconjugate comprising the antibody) which specifically binds to LAP-TGF1 in the absence of an anchor protein, and binds to cells (e.g., immune cells such as immunosuppressive cells) but not to extracellular matrix. In some embodiments, the anti-LAP antibody selectively inhibits TGF1 activation on cells (e.g., immune cells such as immunosuppressive cells) without inhibiting TGF1 activation in extracellular matrix.
[0281] In some embodiments, the cancer is characterized by abnormal TGF activity. In some embodiments, the cancer is associated with fibrosis. In some embodiments, the cancer is associated with infiltration of CD4+ regulatory T cells. In some embodiments, the cancer is associated with infiltration of CD8+ regulatory T cells. In some embodiments, the cancer is associate with infiltration of regulatory B cells. In some embodiments, the cancer is associated with infiltration of myeloid-derived suppressor cells. In some embodiments, the cancer is associated with infiltration of tumor-associated macrophages. In some embodiments, the cancer is associated with infiltration of innate lymphoid cells. In some embodiments, the cancer is associated with infiltration of cancer-associated fibroblasts. In some embodiments, the cancer is associated with a radiation-related increase in the above cell types.
[0282] In some embodiments, the cancer is associated with an increased TGF1 activation signature. In some embodiments the cancer is associated with an EMT signature. In some embodiments the cancer is associated with a tumor exhibiting an EMT signature and immune infiltration. In some embodiments the cancer is associated with a tumor profile of immune exclusion. In some embodiments, the cancer is associated with increased LAP expression. In some embodiments, the cancer is associated with increased GARP expression. In some embodiments, the cancer is associated with increased LRRC33 expression. Cancers whose growth may be inhibited using the anti-LAP antibodies described herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include, but are not limited to, basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and CNS cancer; breast cancer (e.g. estrogen-receptor positive breast cancer HER2-positive breast cancer; triple negative breast cancer); cancer of the peritoneum; cervical cancer; cholangiocarcinoma; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer (including gastrointestinal cancer); glioblastoma; liver cancer (e.g. hepatocellular carcinoma; hepatoma); intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; lung cancer (e.g., small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung); lymphoma including Hodgkin's and non-Hodgkin's lymphoma; melanoma; myeloma; neuroblastoma; oral cavity cancer (e.g., lip, tongue, mouth, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; cancer of the respiratory system; salivary gland carcinoma; sarcoma; skin cancer; squamous cell cancer; teratocarcinoma; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulval cancer; as well as other carcinomas and sarcomas; as well as B-cell lymphoma (including low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's Macroglobulinemia); chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic myeloblasts leukemia; and post-transplant lymphoproliferative disorder (PTLD), as well as abnormal vascular proliferation associated with phakomatoses, edema (such as that associated with brain tumors), tumors of primitive origins and Meigs' syndrome.
[0283] Additional cancers which can be treated using the anti-LAP antibodies described herein include metastatic pancreatic cancer, metastatic adenocarcinoma of the pancreas, stomach cancer, fibrotic cancer, glioma, malignant glioma, diffuse intrinsic pontine glioma, recurrent childhood brain neoplasm renal cell carcinoma, clear-cell metastatic renal cell carcinoma, metastatic castration resistant prostate cancer, stage IV prostate cancer, metastatic melanoma, malignant melanoma, recurrent melanoma of the skin, melanoma brain metastases, malignant melanoma of head and neck, squamous cell non-small cell lung cancer, metastatic breast cancer, follicular lymphoma, advanced B-cell NHL, HL including diffuse large B-cell lymphoma (DLBCL), multiple myeloma, chronic myeloid leukemia, adult acute myeloid leukemia in remission, adult acute myeloid leukemia with Inv(16)(p13.1q22), CBFB-MYH11, adult acute myeloid leukemia with t(16:16) (p13.1:q22), CBFB-MYH11, adult acute myeloid leukemia with t(8:21)(d22:q22), RUNX1-RUNX1T1, adult acute myeloid leukemia with t(9:11)(p22:q23), MLLT3-MLL, adult acute promyelocytic leukemia with tO15:17)(q22:q12), PML-RARA, alkylating agent-related acute myeloid leukemia, Richter's syndrome, adult glioblastoma, adult gliosarcoma, recurrent glioblastoma, recurrent childhood rhabdomyosarcoma, recurrent ewing sarcoma/peripheral primitive neuroectodermal tumor, recurrent neuroblastoma, recurrent osteosarcoma, colorectal cancer, MSI positive colorectal cancer, MSI negative colorectal cancer, nasopharyngeal nonkeratinizing carcinoma, recurrent nasopharyngeal undifferentiated carcinoma, cervical adenocarcinoma, cervical adenosquamous carcinoma; cervical squamous cell carcinoma, recurrent cervical carcinoma, anal canal squamous cell carcinoma, metastatic anal canal carcinoma, recurrent anal canal carcinoma, recurrent head and neck cancer, squamous cell of head and neck, head and neck squamous cell carcinoma (HNSCC), ovarian carcinoma, colon cancer, advanced GI cancer, gastric adenocarcinoma, gastroesophageal junction adenocarcinoma, bone neoplasms, soft tissue sarcoma, bone sarcoma, thymic carcinoma, urothelial carcinoma, merkel cell carcinoma, recurrent merkel cell carcinoma, mycosis fungoides, Sezary syndrome, neuroendocrine cancer, nasopharyngeal cancer, basal cell skin cancer, squamous cell skin cancer, dermatofibrosarcoma trotuberans, glioma, mesothelioma, myelodysplastic syndromes (MDS), myelofibrosis (MF), myeloproliferative neoplasms, and acute myeloid leukemia (AML).
[0284] Cancers may be metastatic or may be primary cancers. Cancers may be desmoplastic or non-desmoplastic. Cancers may be recurrent cancers.
[0285] In some embodiments, the anti-LAP antibodies described herein are used to treat myelodysplastic syndromes (MDS). MDS are a diverse group of malignant disorders marked by bone marrow failure due to defective hematopoiesis and production of dysplastic cells. TGF is a primary driver in MDS (Geyh et al., Haematologica 2018; 103:1462-71) and agents that inhibit the function of TGF have been proposed as therapeutics (Mies et al., Curr Hematol Malig Rep 2016; 11:416-24). Furthermore, MDSCs are known to be dysregulated in MDS (Chen et al., JCI 2013; 123:4595-611) and agents that reduce MDSC levels in the bone marrow are potential therapeutics.
[0286] In some embodiments, the anti-LAP antibodies described herein are used to treat myelofibrosis, which is another myeloid malignancy in which TGF1 plays a central role (Mascarenhas et al., Leukemia & Lymphoma 2014; 55:450-2).
[0287] In some embodiments, the cancer is resistant to checkpoint inhibitor(s). In some embodiments, the cancer is intrinsically refractory or resistant (e.g., resistant to a PD-1 pathway inhibitor, PD-1 pathway inhibitor, or CTLA-4 pathway inhibitor). In some embodiments, the resistance or refractory state of the cancer is acquired. In some embodiments, the anti-LAP antibodies described herein can be used in combination with checkpoint inhibitors to overcome resistance of the cancer to the checkpoint inhibitors. In some embodiments, the anti-LAP antibodies described herein can be used to treat tumors with a mesenchymal and/or EMT signature together with checkpoint inhibitors in combination or sequentially with agents that induce a mesenchymal phenotype, such as MAPK pathway inhibitors.
[0288] In some embodiments, the anti-LAP antibodies described herein are used to enhance the viability of immune cells ex vivo, e.g., in adoptive NK cell transfer. Accordingly, in some embodiments, anti-LAP antibodies are used in combination with adoptively transferred NK cells to treat cancer.
[0289] In some embodiments, the anti-LAP antibodies described herein are used to treat tumors with MHC loss or MHC down-regulation, as monotherapy or in combination with NK activating or enhancing treatment. In some embodiments, the anti-LAP antibodies described herein are used to treat checkpoint inhibitor resistant tumors in combination with NK activating or enhancing treatment.
[0290] Also provided herein is a method of treating cancer associated with an increased number of circulating platelets or an increased platelet to lymphocyte ratio comprising administering to a subject in need thereof an effective amount of an antibody which specifically binds to LAP, wherein the antibody binds to platelets but does not cause platelet aggregation or platelet degranulation.
[0291] The ability of a compound to inhibit cancer can be evaluated in an animal model system predictive of efficacy in human tumors. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit using in vitro assays known to the skilled practitioner. A therapeutically effective amount of a therapeutic compound can decrease tumor size, or otherwise ameliorate symptoms in a subject. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
[0292] Also encompassed are methods for detecting the presence of LAP-TGF1 in a sample (e.g., a tumor biopsy sample), or measuring the amount of LAP-TGF1 in sample, comprising contacting the sample (e.g., tumor tissue) and a control sample (e.g., corresponding healthy tissue) with a monoclonal antibody which specifically binds to LAP-TGF1 under conditions that allow for formation of a complex between the antibody or portion thereof and LAP-TGF1. The formation of a complex is then detected, wherein a difference complex formation between the sample compared to the control sample is indicative the presence of LAP-TGF1 in the sample. The anti-LAP antibodies described herein can also be used to purify LAP-TGF1 via immunoaffinity purification.
[0293] Diagnostic applications of the anti-LAP antibodies described herein are also contemplated.
[0294] In one embodiment, provided herein is a method of diagnosing a cancer associated with regulatory T cell infiltration comprising contacting a biological sample from a patient afflicted with the cancer with an anti-LAP antibody described herein which binds to regulatory T cells, wherein positive staining with the antibody indicates the cancer is associated with regulatory T cell infiltration.
[0295] In another embodiment, provided herein is a method of diagnosing a cancer associated with GARP-negative suppressive cells comprising contacting a biological sample from a patient afflicted with the cancer with an anti-LAP antibody described herein which binds to GARP-negative suppressive cells, wherein positive staining with the antibody and negative staining with an anti-GARP antibody indicates the cancer is associated with GARP-negative suppressive cells.
[0296] In another embodiment, provided herein is a method of selecting a patient afflicted with cancer for treatment with an anti-LAP antibody described herein, comprising contacting a biological sample from the patient with the antibody, wherein positive staining with the antibody indicates the cancer is amenable to treatment with the antibody.
[0297] In another embodiment, provided herein is a method of determining the response of a patient afflicted with cancer to treatment with an anti-LAP antibody described herein comprising contacting a biological sample from the patient with the antibody, wherein reduced staining with the antibody indicates the cancer is responding to treatment with the antibody.
[0298] In another embodiment, provided herein is a method of determining whether a cancer in a patient has metastasized comprising (a) identifying a patient having a cancer, (b) administering a labeled (e.g., radiolabeled) anti-LAP antibody described herein to the patient and determining the biodistribution of the labeled anti-LAP antibody, and (c) periodically repeating step (b) to determine whether the biodistribution of the labeled anti-LAP antibody has changed, wherein a change in the biodistribution of the labeled anti-LAP antibody is indicative that the cancer has metastasized.
[0299] Also provided are methods of treating fibrosis with the anti-LAP antibodies described herein.
[0300] Exemplary fibrotic disorders include, but are not limited to, heart fibrosis, muscle fibrosis, skin fibrosis, liver fibrosis, soft tissue (e.g. mediastinum or retroperitoneum) fibrosis, renal fibrosis, bone marrow fibrosis, intestinal fibrosis, joint (e.g., knee, shoulder or other joints) fibrosis, pulmonary fibrosis, idiopathic pulmonary fibrosis, cystic fibrosis, endomyocardial fibrosis, mediastinal fibrosis, myelofibrosis, retroperitoneal fibrosis, progressive massive fibrosis, pipestem fibrosis, nephrogenic systemic fibrosis, Crohn's disease, keloid, old myocardial infarction, scleroderma/systemic sclerosis, subepithelial fibrosis, arthrofibrosis, some forms of adhesive capsulitis, proliferative fibrosis, viral hepatitis induced fibrosis, drug-induced fibrosis, radiation-induced fibrosis, and fibrosis associated with cancer.
[0301] Also provided are methods of treating autoimmune disease with the anti-LAP antibodies described herein.
[0302] Exemplary autoimmune diseases include, but are not limited to, systemic lupus erythematosus (SLE), rheumatoid arthritis, type I diabetes, acute glomerulonephritis, Addison's disease, adult onset idiopathic hypoparathyroidism (AOIH), alopecia totalis, amyotrophic lateral sclerosis, ankylosing spondylitis, antiphospholipid syndrome, autoimmune aplastic anemia, autoimmune hemolytic anemia, Behcet's disease, Celiac disease, chronic active hepatitis, CREST syndrome, Crohn's disease, dermatomyositis, dilated cardiomyopathy, eosinophilia-myalgia syndrome, epidermolisis bullosa acquisita (EBA), giant cell arteritis, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome, hemochromatosis, Henoch-Schonlein purpura, idiopathic IgA nephropathy, insulin-dependent diabetes mellitus (IDDM), juvenile rheumatoid arthritis, Lambert-Eaton syndrome, linear IgA dermatosis, lupus erythematosus, mixed connective tissue disease, multiple sclerosis, myasthenia gravis, myocarditis, narcolepsy, necrotizing vasculitis, neonatal lupus syndrome (NLE), nephrotic syndrome, pemphigoid, phemphigus, polymyositis, primary sclerosing cholangitis, psoriasis, rapidly progressive glomerulonephritis (RPGN), Reiter's syndrome, rheumatoid arthritis, scleroderma, Sjogren's syndrome, stiff-man syndrome, systemic sclerosis, thyroiditis, and ulcerative colitis. Additional autoimmune diseases are provided at www.aarda.org/diseaselist.
[0303] Also provided herein is a method of reducing the number of immunosuppressive cells in a patient before, during, and/or after transplantation comprising administering an effective amount of the anti-LAP antibodies described herein to a patient before undergoing transplantation, during transplantation and/or after transplantation (e.g., anti-LAP antibodies which bind to immunosuppressive cells). In some embodiments, the anti-LAP antibodies improve graft survival.
[0304] Inhibition of TGF has been shown to restore regenerative failure by reducing senescence and enhancing liver regeneration, in a model of acute liver disease (acetaminophen injury mouse model) (Bird et al., Sci Transl Med 2018; 10:eaan1230). Accordingly, also provided herein is a method of increasing the regenerative response in acute organ injury (e.g., acute liver injury) comprising administering to a subject with acute organ injury an effective amount of the anti-LAP antibodies described herein (i.e., anti-LAP antibodies which inhibit LAP-TGF1 activation) to treat the acute organ injury.
[0305] Aberrant activation of TGF has been shown to initiate the onset of temporomandibular joint osteoarthritis (Zheng et al., Bone Res 2018; 6:26). Accordingly, also provided herein is a method of treating a patient with temporomandibular joint osteoarthritis comprising administering to the patient an effective amount of the anti-LAP antibodies described herein (i.e., anti-LAP antibodies which inhibit LAP-TGF1 activation) to treat the temporomandibular joint osteoarthritis.
[0306] LAP-TGF1 has also been shown to mediate the differentiation of CD4+ effector cells into productively and latently infected central memory T cells during HIV-1 infection (Cheung et al., J Viol 2018; 92:e01510-17). Accordingly, also provided herein is a method of treating a patient with HIV-1 infection (or a patient at risk of developing HIV-1 infection) comprising administering to the patient an effective amount of the anti-LAP antibodies described herein (i.e., anti-LAP antibodies which inhibit LAP-TGF1 activation) to treat the HIV-1 infection.
[0307] TGF-expressing macrophages and suppressive regulatory T cells have been shown to be altered in the peritoneal fluid of patients with endometriosis (Hanada et al., Reprod Biol Endocrinol 2018; 16:9), suggesting that targeting LAP-TGFb1 expressed on these cells may be beneficial for treating the disorder. Accordingly, also provided herein is a method of treating a patient with endometriosis comprising administering to the patient an effective amount of the anti-LAP antibodies described herein (i.e., anti-LAP antibodies which inhibit LAP-TGF1 activation) to treat the endometriosis.
[0308] LAP-TGF1-expressing CD4+ T cells and CD14+ monocytes and macrophages have been shown to be increased in patients carrying multidrug resistant Mycobacterium tuberculosis (Basile et al., Clin Exp Immunol 2016; 187:160), suggesting that targeting LAP-TGF1 expressed on these cells may be beneficial for treating the infection. Accordingly, also provided herein is a method of treating a patient with multidrug resistant Mycobacterium tuberculosis comprising administering to the patient an effective amount of the anti-LAP antibodies described herein (i.e., anti-LAP antibodies which inhibit LAP-TGF1 activation) to treat the infection.
[0309] In certain embodiments, the anti-LAP antibody can be used alone to treat a disease or disorder (e.g., cancer). Alternatively, an anti-LAP antibody can be used in conjunction with another agent or therapy, e.g., an anti-cancer agent, a chemotherapeutic agent, an immunosuppressive agent, an immunostimulatory agent, an immune checkpoint inhibitor, an anti-inflammatory agent, and cell therapy, as described in more detail below.
Combination Therapy
[0310] The anti-LAP antibodies described herein can be used in combination with various treatments or agents (or in the context of a multispecific antibody or bifunctional partner) for the treatment of cancer, as described below.
[0311] Suitable anti-cancer agents for use in combination therapy with the anti-LAP antibodies described herein include, but are not limited to, surgery, chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, radiotherapy and agents used in radiation therapy, anti-angiogenesis agents, apoptotic agents, anti-tubulin agents, and other agents to treat cancer, such as anti-HER-2 antibodies (e.g., HERCEPTIN), anti-CD20 antibodies, an epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HER1/EGFR inhibitor (e.g., erlotinib (TARCEVA)), platelet derived growth factor inhibitors (e.g., GLEEVEC (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, cytokines, antagonists (e.g., neutralizing antibodies) that bind to one or more of the following targets PD 1, PDL1, PDL2 (e.g., pembrolizumab; nivolumab; MK-3475; AMP-224; MPDL3280A; MEDI0680; MSB0010718C; and/or MEDI4736); CTLA4 (e.g., tremelimumab (PFIZER) and ipilimumab); LAG3 (e.g., BMS-986016); CD 103; TIM-3 and/or other TIM family members; CEACAM-1 and/or other CEACAM family members, ErbB2, ErbB3, ErbB4, PDGFR-beta, BlyS, APRIL, BCMA or VEGF receptor(s), TRAIIJApo2, PARP inhibitors (e.g., AZD-2281, Lynparza Olaparib, Rubraca Rucaparib; (Zejula) niraparib), DNA damage repair inhibitors (e.g., ATMi, ATRi, DNAPKi), and other bioactive and organic chemical agents. Combinations thereof are also specifically contemplated for the methods described herein.
[0312] Suitable chemotherapeutic agents for use in combination therapy with the anti-LAP antibodies described herein include, but are not limited to, alkylating agents such as thiotepa and CYTOXAN cyclosphosphamide; temozolomide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB 1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegal 1 (see, e.g., Agnew, Chem. Intl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL paclitaxel (Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, 111), and TAXOTERE doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; GEMZAR gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin, oxaliplatin and carboplatin, vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; NAVELBINE, vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin, including the oxaliplatin treatment regimen (FOLFOX); lapatinib (TYKERB); inhibitors of PKC-alpha, Raf, H-Ras, EGFR (e.g., erlotinib (TARCEVA)) and VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[0313] Also suitable for use in combination with the anti-LAP antibodies described herein are drugs targeting epigenetic regulators, such as HDAC inhibitors, bromodomain inhibitors, and E3 ligase (e.g., cereblon) inhibitors (e.g., lenalidomide, pomalidomide, and thalidomide).
[0314] Suitable anti-inflammatory agents for use in combination therapy with the anti-LAP antibodies described herein include, but are not limited to, aspirin and other salicylates, Cox-2 inhibitors (e.g., rofecoxib and celecoxib), NSAIDs (such as ibuprofen, fenoprofen, naproxen, sulindac, diclofenac, piroxicam, ketoprofen, diflunisal, nabumetone, etodolac, oxaprozin, and indomethacin), anti-IL6R antibodies, anti-IL8 antibodies, anti-IL15 antibodies, anti-IL15R antibodies, anti-CD4 antibodies, anti-CD11a antibodies (e.g., efalizumab), anti-alpha-4/beta-1 integrin (VLA4) antibodies (e.g., natalizumab), CTLA4-Ig for the treatment of inflammatory diseases, prednisolone, prednisone, disease modifying antirheumatic drugs (DMARDs) such as methotrexate, hydroxychloroquine, sulfasalazine, pyrimidine synthesis inhibitors (e.g., leflunomide), IL-1 receptor blocking agents (e.g., anakinra), TNF- blocking agents (e.g., etanercept, infliximab, and adalimumab), and the like.
[0315] Suitable immunomodulatory agents (e.g., immunostimulatory and immunosuppressive agents) include, but are not limited to, cyclosporine, azathioprine, mycophenolic acid, mycophenolate mofetil, corticosteroids such as prednisone, methotrexate, gold salts, sulfasalazine, antimalarials, brequinar, leflunomide, mizoribine, 15-deoxyspergualine, 6-mercaptopurine, cyclophosphamide, rapamycin, tacrolimus (FK-506), OKT3, anti-thymocyte globulin, thymopentin, thymosin-, antibodies that bind to p75 of the IL-2 receptor, antibodies that bind to MHC, CD2, CD3, CD4, CD7, CD28, B7, CD40, CD45, IFN-, TNF-, IL-4, IL-5, IL-6R, IL-6, IGF, IGFR1, IL-7, IL-8, IL-10, CD11a, or CD58, or antibodies binding to their ligands, soluble IL-15R, IL-10, B7 molecules (B7-1, B7-2, variants thereof, and fragments thereof), ICOS, OX40, an inhibitor of a negative T cell regulator (such as an antibody against CTLA4), and the like.
[0316] Additional immunosuppressive agents include, for example, anti-TNF agents such as etanercept, adalimumab and infliximab, and steroids. Examples of specific natural and synthetic steroids include, for example: aldosterone, beclomethasone, betamethasone, budesonide, cloprednol, cortisone, cortivazol, deoxycortone, desonide, desoximetasone, dexamethasone, difluorocortolone, fluclorolone, flumethasone, flunisolide, fluocinolone, fluocinonide, fluocortin butyl, fluorocortisone, fluorocortolone, fluorometholone, flurandrenolone, fluticasone, halcinonide, hydrocortisone, icomethasone, meprednisone, methylprednisolone, paramethasone, prednisolone, prednisone, tixocortol, and triamcinolone.
[0317] Suitable immunostimulatory agents for use in combination therapy with the anti-LAP antibodies described herein include, for example, compounds capable of stimulating antigen presenting cells (APCs), such as dendritic cells (DCs) and macrophages. For example, suitable immunostimulatory agents are capable of stimulating APCs, so that the maturation process of the APCs is accelerated, the proliferation of APCs is increased, and/or the recruitment or release of co-stimulatory molecules (e.g., CD80, CD86, ICAM-1, MHC molecules and CCR7) and pro-inflammatory cytokines (e.g., IL-1, IL-6, IL-12, IL-15, and IFN-) is upregulated. Suitable immunostimulatory agents are also capable of increasing T cell proliferation. Such immunostimulatory agents include, but are not be limited to, CD40 ligand; FLT 3 ligand; cytokines, such as IFN-, IFN-0, IFN- and IL-2; colony-stimulating factors, such as G-CSF (granulocyte colony-stimulating factor) and GM-CSF (granulocyte-macrophage colony-stimulating factor); an anti-CTLA-4 antibody, anti-PD1 antibody, anti-41BB antibody, or anti-OX-40 antibody; LPS (endotoxin); ssRNA; dsRNA; Bacille Calmette-Guerin (BCG); Levamisole hydrochloride; and intravenous immune globulins. In one embodiment an immunostimulatory agent may be a Toll-like Receptor (TLR) agonist. For example the immunostimulatory agent may be a TLR3 agonist such as double-stranded inosine:cytosine polynucleotide (Poly I:C, for example available as Ampligen from Hemispherx Bipharma, PA, US or Poly IC:LC from Oncovir) or Poly A:U; a TLR4 agonist such as monophosphoryl lipid A (MPL) or RC-529 (for example as available from GSK, UK); a TLR5 agonist such as flagellin; a TLR7 or TLR8 agonist such as an imidazoquinoline TLR7 or TLR 8 agonist, for example imiquimod (e.g., Aldara) or resiquimod and related imidazoquinoline agents (e.g., as available from 3M Corporation); or a TLR 9 agonist such as a deoxynucleotide with unmethylated CpG motifs (CpGs, e.g., as available from Coley Pharmaceutical). In another embodiment, the immunostimulatory molecule is a STING agonist. Such immunostimulatory agents may be administered simultaneously, separately or sequentially with the anti-LAP antibodies described herein.
[0318] Suitable immune checkpoint blockers include, but are not limited to, agents (e.g., antibodies) that bind to PD-1, PD-L1, PD-L2, LAG-3, CTLA4, TIGIT, GITR, ICOS, OX40, GITR, PVR, PVRIG, VISTA, and TIM3. Also encompassed are STING agonists. Non-limiting examples of antibodies that bind to PD-1, PD-L1, and PD-L2 include pembrolizumab; nivolumab; MK-3475; MPDL32; MEDI0680; MEDI4736; AMP-224; and MSB0010718C.
[0319] In some embodiments, the anti-LAP antibody is administered with an agent that targets a stimulatory or inhibitory molecule that is a member of the immunoglobulin super family (IgSF). For example, the anti-LAP antibodies described herein, may be administered to a subject with an agent that targets a member of the IgSF family to increase an immune response. For example, an anti-LAP antibody may be administered with an agent that targets a member of the B7 family of membrane-bound ligands that includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5 (VISTA), and B7-H6 or a co-stimulatory or co-inhibitory receptor binding specifically to a B7 family member.
[0320] An anti-LAP antibody may also be administered with an agent that targets a member of the TNF and TNFR family of molecules (ligands or receptors), such as CD40 and CD40L, OX-40, OX-40L, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137, TRAIIJApo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LTR, LIGHT, DcR3, HVEM, VEGI/TL1A, TRAMP/DR3, EDA1, EDA2, TNFR1, Lymphotoxin /TNF, TNFR2, TNF, LTR, Lymphotoxin 12, FAS, FASL, RELT, DR6, TROY, and NGFR (see, e.g., Tansey (2009) Drug Discovery Today 00:1).
[0321] T cell responses can be stimulated by a combination of anti-LAP antibodies described herein and one or more of the following agents: [0322] (1) An antagonist (inhibitor or blocking agent) of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitors), such as CTLA-4, PD-1, PD-L1, PD-L2, and LAG-3, as described above, and any of the following proteins: TIM-3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD113, CD155, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PD1H, LAIR1, TIM-1, and TIM-4; and/or [0323] (2) An agonist of a protein that stimulates T cell activation, such as B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, GITR, ICOS, ICOS-L, OX40, OX40L, CD70, CD27, CD40, DR3 and CD28H.
[0324] Exemplary agents that modulate the above proteins and may be combined with the anti-LAP antibodies described herein for treating cancer, include: Yervoy (ipilimumab) or Tremelimumab (to CTLA-4), galiximab (to B7.1), BMS-936558 (to PD-1), MK-3475 (to PD-1), AMP224 (to B7DC), BMS-936559 (to B7-H1), MPDL3280A (to B7-H1), MEDI-570 (to ICOS), AMG557 (to B7H2), MGA271 (to B7H3), IMP321 (to LAG-3), BMS-663513 (to CD137), PF-05082566 (to CD137), CDX-1127 (to CD27), anti-OX40 (Providence Health Services), huMAbOX40L (to OX40L), Atacicept (to TACI), CP-870893 (to CD40), Lucatumumab (to CD40), Dacetuzumab (to CD40), Muromonab-CD3 (to CD3), Ipilumumab (to CTLA-4).
[0325] Other molecules that can be combined with anti-LAP antibodies for the treatment of cancer include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells. For example, anti-LAP antibodies can be combined with antagonists of KIR (e.g., lirilumab).
[0326] T cell activation is also regulated by soluble cytokines, and anti-LAP antibodies may be administered to a subject, e.g., having cancer, with antagonists of cytokines that inhibit T cell activation or agonists of cytokines that stimulate T cell activation.
[0327] In certain embodiments, anti-LAP antibodies can be used in combination with (i) antagonists (or inhibitors or blocking agents) of proteins of the IgSF family or B7 family or the TNF family that inhibit T cell activation or antagonists of cytokines that inhibit T cell activation (e.g., IL-6, IL-10, TGF-, VEGF; immunosuppressive cytokines) and/or (ii) agonists of stimulatory receptors of the IgSF family, B7 family or the TNF family or of cytokines that stimulate T cell activation, for stimulating an immune response, e.g., for treating proliferative diseases, such as cancer.
[0328] Yet other agents for combination therapies include agents that inhibit or deplete macrophages or monocytes, including but not limited to CSF-1R antagonists such as CSF-1R antagonist antibodies including RG7155 (WO11/70024, WO11/107553, WO11/131407, WO13/87699, WO13/119716, WO13/132044) or FPA-008 (WO11/140249; WO13169264; WO14/036357).
[0329] Additional agents that may be combined with anti-LAP antibodies include agents that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
[0330] Another therapy that may be combined with anti-LAP antibodies is a therapy that inhibits a metabolic enzyme such as indoleamine dioxygenase (IDO), tryptophan-2,3-dioxigenase, dioxygenase, arginase, or nitric oxide synthetase.
[0331] Another class of agents that may be used with anti-LAP antibodies includes agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor, for example, anti-CD73 antibodies, anti-CD39 antibodies, and adenosine A2A/A2b inhibitors.
[0332] Other therapies that may be combined with anti-LAP antibodies for treating cancer include therapies that reverse/prevent T cell anergy or exhaustion and therapies that trigger an innate immune activation and/or inflammation at a tumor site.
[0333] The anti-LAP antibodies may be combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking regulatory T cells or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD-137 and/or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits regulatory T cells using an antagonist of CD25 (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion; a therapy that impacts the function of suppressor myeloid cells in the tumor; a therapy that enhances immunogenicity of tumor cells (e.g., anthracyclines); cell therapy with adoptive T cell or NK cell transfer including genetically modified cells, e.g., cells modified by chimeric antigen receptors (CAR-T therapy); a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase; a therapy that reverses/prevents T cell anergy or exhaustion; a therapy that triggers an innate immune activation and/or inflammation at a tumor site; administration of immune stimulatory cytokines; or blocking of immunorepressive cytokines.
[0334] The anti-LAP antibodies described herein can be combined with proinflammatory cytokines, for example, IL-12 and IL-2. These cytokines can be modified to enhance half-life and tumor targeting.
[0335] The anti-LAP antibodies described herein can be combined with immune cell engagers such as NK cell engagers or T cell engagers.
[0336] The anti-LAP antibodies described herein can be combined with indoleamine dioxigenase (IDO) inhibitors, tryptophan-2,3-dioxygenase (TDO) inhibitors, and dual IDO/TDO inhibitors.
[0337] The anti-LAP antibodies described herein can be combined with kynurine inhibitors.
[0338] The anti-LAP antibodies described herein can be combined with CD47 and/or SIRPa blocking therapies.
[0339] The anti-LAP antibodies described herein can be combined with JAK inhibitors and JAK pathway inhibitors (e.g., STAT3 inhibitors), e.g., for the treatment of myelofibrosis and myeloproliferative neoplasms.
[0340] The anti-LAP antibodies described herein can be combined with DNA damage repair inhibitors.
[0341] The anti-LAP antibodies described herein can be combined with angiogenesis inhibitors.
[0342] The anti-LAP antibodies described herein can be combined with erythropoietin and drugs that stimulate hematopoiesis.
[0343] Bispecific antibodies which have a first binding region with the specificity of the anti-LAP antibodies described herein and a second binding region which binds to an immune checkpoint blocker (e.g., PD-1, PD-L1) can be used in combination with at least one additional anti-cancer agent (e.g., radiation, chemotherapeutic agents, biologics, vaccines) to inhibit tumor growth.
[0344] The anti-LAP antibodies described herein can be combined with one or more immunostimulatory antibodies, such as an anti-PD-1 antagonist antibody, an anti-PD-L1 antagonist antibody, an antagonist anti-CTLA-4 antibody, an antagonist anti-TIM3 antibody, and/or an anti-LAG3 antagonist antibody, such that an immune response is stimulated in the subject, for example to inhibit tumor growth.
[0345] Exemplary anti-PD-1 antibodies include nivolumab, MK-3475 (Lambrolizumab) described in WO2012/145493; AMP-514 described in WO 2012/145493, as well as PD-1 antibodies and other PD-1 inhibitors described in WO 2009/014708, WO 03/099196, WO 2009/114335, WO 2011/066389, WO 2011/161699, WO 2012/145493, U.S. Pat. Nos. 7,635,757 and 8,217,149, and U.S. Patent Publication No. 2009/0317368.
[0346] Exemplary anti-PD-L1 antibodies include MEDI4736 (also known as Anti-B7-H1), MPDL3280A (also known as RG7446), MSB0010718C (WO2013/79174), rHigM12B7, as well as any of the anti-PD-L1 antibodies disclosed in WO2013/173223, WO2011/066389, WO2012/145493, U.S. Pat. Nos. 7,635,757 and 8,217,149 and U.S. Publication No. 2009/145493.
[0347] Exemplary anti-CTLA-4 antibodies include Yervoy (ipilimumab), tremelimumab (formerly ticilimumab, CP-675,206), or an anti-CTLA-4 antibody described in any of the following publications: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al. (1998) Proc. Natl. Acad. Sci. USA 95(17):10067-10071; Camacho et al. (2004) J. Clin. Oncology 22(145): Abstract No. 2505 (antibody CP-675206); and Mokyr et al. (1998) Cancer Res. 58:5301-5304.
[0348] Exemplary anti-LAG3 antibodies include IMP731 and IMP-321, described in US 2011/007023, WO08/132601, and WO09/44273, as well as antibodies described in U.S. Patent Publication No. US2011/0150892, WO10/19570 and WO2014/008218.
[0349] Anti-LAP antibodies can also be combined with immune-oncology agents such as CD137 (4-1BB) agonists (e.g., an agonistic CD137 antibody such as urelumab or PF-05082566 (WO12/32433)); GITR agonists (e.g., an agonistic anti-GITR antibody), CD40 agonists (e.g., an agonistic CD40 antibody); CD40 antagonists (e.g., an antagonistic CD40 antibody such as lucatumumab (HCD122), dacetuzumab (SGN-40), CP-870,893 or Chi Lob 7/4); CD27 agonists (e.g., an agonistic CD27 antibody such as varlilumab (CDX-1127)), MGA271 (to B7H3) (WO11/109400)); KIR antagonists (e.g., lirilumab); IDO antagonists (e.g., INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WO11/56652, WO12/142237) or F001287); Toll-like receptor agonists (e.g., TLR2/4 agonists (e.g., Bacillus Calmette-Guerin); TLR7 agonists (e.g., Hiltonol or Imiquimod); TLR7/8 agonists (e.g., Resiquimod); or TLR9 agonists (e.g., CpG7909)); and TGF- inhibitors (e.g., GC 1008, LY2157299, TEW7197, or IMC-TR1).
[0350] The anti-LAP antibodies described herein can also be combined with an immunogenic agent, such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines (He et al. (2004) J. Immunol. 173:4919-28). Non-limiting examples of tumor vaccines that can be used include peptides of melanoma antigens, such as peptides of gp100, MAGE antigens, Trp-2, MART1 and/or tyrosinase, or tumor cells transfected to express the cytokine GM-CSF (discussed further below).
[0351] The anti-LAP antibodies described herein can also be combined with an anti-neoplastic antibody, such as Rituxan (rituximab), Herceptin (trastuzumab), Bexxar (tositumomab), Zevalin (ibritumomab), Campath (alemtuzumab), Lymphocide (eprtuzumab), Avastin (bevacizumab), and Tarceva (erlotinib), and the like.
[0352] Several experimental treatment protocols involve ex vivo activation and expansion of antigen specific T cells and adoptive transfer of these cells into recipients in order to antigen-specific T cells against tumor (Greenberg & Riddell, supra). Ex vivo activation in the presence of the anti-LAP antibodies described herein with or without an additional immunostimulating therapy (e.g., an immune checkpoint blocker) can be expected to increase the frequency and activity of the adoptively transferred T cells.
[0353] The anti-LAP antibody may also be administered with a standard of care treatment, or another treatment, such as radiation, surgery, or chemotherapy. The anti-LAP antibody may be combined with a vaccination protocol. Many experimental strategies for vaccination against tumors have been devised (see Rosenberg, S., 2000, Development of Cancer Vaccines, ASCO Educational Book Spring: 60-62; Logothetis, C., 2000, ASCO Educational Book Spring: 300-302; Khayat, D. 2000, ASCO Educational Book Spring: 414-428; Foon, K. 2000, ASCO Educational Book Spring: 730-738; see also Restifo, N. and Sznol, M., Cancer Vaccines, Ch. 61, pp. 3023-3043 in DeVita et al. (eds.), 1997, Cancer: Principles and Practice of Oncology, Fifth Edition). In one of these strategies, a vaccine is prepared using autologous or allogeneic tumor cells. These cellular vaccines have been shown to be most effective when the tumor cells are transduced to express GM-CSF. GM-CSF has been shown to be a potent activator of antigen presentation for tumor vaccination (Dranoff et al. (1993) Proc. Natl. Acad. Sci U.S.A. 90: 3539-43).
[0354] Dendritic cells (DC) are potent antigen presenting cells that can be used to prime antigen-specific responses. DC's can be produced ex vivo and loaded with various protein and peptide antigens as well as tumor cell extracts (Nestle et al. (1998) Nature Medicine 4: 328-332). DCs can also be transduced by genetic means to express these tumor antigens as well. DCs have also been fused directly to tumor cells for the purposes of immunization (Kugler et al. (2000) Nature Medicine 6:332-336). As a method of vaccination, DC immunization can be effectively combined with the anti-LAP antibodies described herein to activate more potent anti-tumor responses.
[0355] In some embodiments, the combination of therapeutic antibodies discussed herein can be administered concurrently as a single composition in a pharmaceutically acceptable carrier, or concurrently as separate compositions with each antibody in a pharmaceutically acceptable carrier. In another embodiment, the combination of therapeutic antibodies can be administered sequentially.
IX. Kits
[0356] Also provided are kits comprising the anti-LAP antibodies, multispecific molecules, or immunoconjugates disclosed herein, optionally contained in a single vial or container, and include, e.g., instructions for use in treating or diagnosing a disease (e.g., cancer). The kits may include a label indicating the intended use of the contents of the kit. The term label includes any writing, marketing materials or recorded material supplied on or with the kit, or which otherwise accompanies the kit. Such kits may comprise the antibody, multispecific molecule, or immunoconjugate in unit dosage form, such as in a single dose vial or a single dose pre-loaded syringe.
[0357] The present disclosure is further illustrated by the following examples, which should not be construed as further limiting. The contents of all figures and all references, Genbank sequences, patents, and published patent applications cited throughout this application are expressly incorporated herein by reference.
EXAMPLES
[0358] Commercially available reagents referred to in the Examples below were used according to manufacturer's instructions unless otherwise indicated. Unless otherwise noted, the present invention uses standard procedures of recombinant DNA technology, such as those described hereinabove and in the following textbooks: Sambrook et al., supra; Ausubel et al., Current Protocols in Molecular Biology (Green Publishing Associates and Wiley Interscience, N.Y., 1989); Innis et al., PCR Protocols: A Guide to Methods and Applications (Academic Press, Inc.: N.Y., 1990); Harlow et al., Antibodies: A Laboratory Manual (Cold Spring Harbor Press: Cold Spring Harbor, 1988); Gait, Oligonucleotide Synthesis (IRL Press: Oxford, 1984); Freshney, Animal Cell Culture, 1987; Coligan et al., Current Protocols in Immunology, 1991.
[0359] Described in the Examples that follow are anti-LAP antibodies with broad therapeutic applications given their selective binding pattern and functional properties. For example, described are anti-LAP antibodies which bind specifically to LAP-TGF1 on cells, in particular, immunosuppressive cells, without binding to LAP-TGF1 on extracellular matrix. These antibodies provide the advantage of selectively inhibiting TGF1 activation on clinically relevant cell types (e.g., regulatory T cells, M2 macrophages, myeloid-derived suppressor cells), without impacting the natural function/activation of LAP-TGF1 on extracellular matrix. Another distinguishing feature of these anti-LAP antibodies is their ability to bind to recombinant LAP-TGF1 in the absence of cell- or ECM-associated anchor proteins (e.g., GARP, LRRC33, LTBP1, LTBP3, LTBP4). This allows for targeting cells (e.g., immunosuppressive cells) regardless of the anchor protein(s) expressed by the cells. Accordingly, these anti-LAP antibodies are distinct from antibodies which bind to LAP-TGF1 on both cells and extracellular matrix, as well as antibodies which bind to LAP-TGF1 only in the presence of an anchor protein (e.g., GARP), for example, by binding an epitope that includes both a region from LAP and the anchor protein.
Example 1: Binding of Anti-LAP Antibodies to Human and Murine LAP-TGF1
[0360] This Example describes the binding of a series of anti-LAP antibodies to human and murine LAP-TGF1. Briefly, P3U1 (mouse myeloma) cells were transfected with human LAP-TGF1 and GARP genes (for testing binding to human LAP-TGF1) or murine LAP-TGF1. Cells were contacted with APC-Streptavidin and a titration series of biotinylated anti-LAP monoclonal antibodies. Bound antibody/streptavidin complexes were detected by flow cytometry. Table 2 summarizes the EC50 values of the tested antibodies for human LAP-TGF1 in the presence or absence of GARP.
TABLE-US-00002 TABLE 2 Binding to P3U1 cells - EC.sub.50 (ng/well) Anti-LAP Human Human TGF1 + mAb TGF1 GARP 28G11 3.9 1.8 2C9 7.0 12.5 7H4 8.3 5.0 16F4 10.3 15.7 3H6 30.3 25.9 478.E9 37.0 51.7 8F10 37.1 27.6 6H10 62.5 143.7 478.G3 62.8 71.6 1E1 64.1 73.0 478.G4 114.6 83.9 2F8 122.6 139.9 1G12 288.2 133.7 13B12 6,400.0 33,000.0 3G5 14,000.0 11,000.0
[0361] As shown in Table 2, 28G11 had the lowest EC.sub.50 (highest apparent affinity) of any of the tested antibodies. Moreover, EC.sub.50 values shifted minimally in cells co-expressing LAP-TGF1 and GARP for most antibodies, indicating that the antibodies do not bind GARP.
[0362] The antibodies were also tested for binding to murine LAP-TGF1 expressing P3U1 cells at a single concentration (0.1 mg/mL). As shown in
[0363]
[0364] The anti-LAP antibodies described above were tested for various functional properties, as described in the Examples that follow. Also included in the Examples below are data from additional exemplary anti-LAP antibodies (i.e., 22F9, 20E6 (26E10), 17G8, and 24E3) derived from different hybridomas produced from TGF1 knockout mice immunized with murine TGF1, which have VH and VL CDR sequences that are structurally distinct from those of 28G11 (Oida et al., PLoS One 2010; 5:e15523).
Example 2: Binding of Anti-LAP Antibodies to TGF Isoforms and TGF Variants
[0365] This Example describes the binding of anti-LAP antibodies to TGF isoforms and TGF variants.
[0366] Briefly, 410.sup.5 each of (a) HT1080 cells, (b) HT1080 cells overexpressing human LAP-TGF1, (c) HT1080 cells overexpressing human LAP-TGF2, (d) HT1080 cells overexpressing human LAP-TGF3, (e) HT1080 cells overexpressing murine LAP-TGF1, (f) P3U1 cells, (g) P3U1 cells overexpressing LAP-TGF1 and GARP, and (h) P3U1 cells overexpressing LAP-TGF1 and LRRC33 were cultured in 96-well plates. The plates were centrifuged for 5 min at 1,500 rpm, liquid was removed, and cells were resuspended with 200 L FACS buffer. The plates were centrifuged again, diluted primary antibody was added to each well, and the plates were incubated on ice for 20 minutes, followed by centrifugation. The cells were resuspended in 200 L FACS buffer, centrifuged again, and resuspended in 50 L diluted secondary antibody (Alexa647-anti-Human IgG or APC-anti-Mouse IgG). The plates were incubated on ice for 20 minutes in the dark, washed twice with 200 L FACS buffer, and cells from each well (in 200 L FACS buffer) were read on the Attune NXT instrument.
[0367] As shown in
[0368] The ability of the anti-LAP antibodies to bind variants of LAP-TGF1 that either prevent TGF1 activation by integrins (closed conformation) or favor spontaneous release (open conformation), and to the LAP-only variant (i.e., human LAP which does not contain mature TGF1), was tested.
[0369] Briefly, 410.sup.5 each of (a) HT1080 cells, (b) HT1080 cells overexpressing human LAP-TGF1, (c) HT1080 cells overexpressing LAP-TGF1 with K27C and Y75C mutations, (d) HT1080 cells overexpressing LAP-TGF1 with a Y74T mutation, and (e) HT1080 cells overexpressing the LAP-only variant were cultured in 96-well plates. Cells were processed for flow cytometry in the same manner described above for the isoform-specific binding experiments.
[0370] As shown in
[0371] To determine whether anti-LAP antibodies 28G11_hIgG1, 22F9_hIgG1, 20E6_hIgG1, 17G8_hIgG1, and 24E3_hIgG1, bind to free human TGF1 (i.e., mature TGF1 that lacks LAP), the ability of the antibodies to inhibit an anti-TGF ELISA was evaluated. Briefly, mature TGF1 (1000 g) was incubated with the indicated anti-LAP antibodies at 10 g/mL, an isotype control antibody as a negative control or the anti-TGF antibody 1D11 as a positive control for 10 minutes on ice. Supernatants were assayed in a TGF1 ELISA (R&D Systems) according to the manufacturer instructions to measure free TGF1. As shown in
[0372] These results suggest that antibodies 28G11_hIgG1, 22F9_hIgG1, 20E6_hIgG1, 17G8_hIgG1, and 24E3_hIgG1 share a related epitope. These antibodies do not bind the mature cytokine directly, as described above (
Example 3: Effects of Anti-LAP Antibodies on TGF1 Activation
[0373] The effects of the anti-LAP antibodies on TGF1 activation were assessed in this Example.
[0374] Briefly, human LAP-TGF1-P3U1 cells were cultured overnight and treated the following day with or without anti-LAP antibody (8 g/mL) for 24 hours. Active TGF1 was detected in the supernatant of cell cultures by utilizing a commercially available human TGF1 ELISA kit (R&D systems).
[0375] As shown in Table 3, anti-LAP antibodies had varying effects on TGF1 activation, including inhibition of TGF1 activation, no effect, and stimulation of TGF1 activation. Activity of the antibodies was largely unaffected by the presence of GARP (with the exception of 3H6 and 6H10). No correlation was found between apparent affinity and the ability to inhibit TGF1 activation (antibodies in Table 3 are listed in rank order based on EC.sub.50s in the P3U1 binding assay from Table 2), indicating that simple binding to LAP-TGF1 and inhibition of TGF1 activation are separable and distinct activities of the anti-LAP antibodies. 13B12 and 3G5 were active in the inhibition assay despite a lack of activity in any of the binding assays. These are the two antibodies with the fastest off-rates in the Octet assay.
TABLE-US-00003 TABLE 3 Effect on TGF1 activation P3U1-human P3U1-human LAP- mAb* LAP-TGF1 TGF1 + GARP 28G11 Inhibition Inhibition 2C9 No effect No effect 7H4 Inhibition Inhibition 16F4 No effect No effect 3H6 No effect Inhibition 478.E9 Stimulate Stimulate 8F10 Inhibition Inhibition 6H10 Inhibition No effect 478.G3 Stimulate Stimulate 1E1 Inhibition Inhibition 478.G4 Stimulate Stimulate 2F8 No effect No effect 1G12 No effect No effect 13B12 Inhibition Inhibition 3G5 Inhibition Inhibition *antibodies tested at 8 g/mL
[0376]
[0377]
[0378]
[0379] The anti-LAP antibodies also had differing effects on P3U1 cells expressing murine LAP-TGF1, as shown in Table 4.
TABLE-US-00004 TABLE 4 Inhibition P3U1-murine mAb* LAP-TGF1 28G11 + 16B4** 20B9 7H4 + *antibodies tested at 8 g/mL; **16B4 inhibits TGF activation when tested at 250 g/mL
[0380] Given that TGF1 activation can be induced by MMPs, the effects of the antibodies on MMP-induced LAP-TGF1 activation was tested. Briefly, recombinant human LAP-TGF1 (R&D Systems) was pre-incubated with anti-LAP antibodies (8 g/ml) for 10 minutes and then treated with 100 ng/ml active MMP2 or MMP9 (EMD Millipore). All reactions were performed in MMP assay buffer (50 mM Tris, 150 mM NaCl, 10 mM CaCl2, 10 uM ZnCl2, 0.05% Brij 35) and incubated at 37C for 2 hours. Reactions were terminated through the addition of 10 M EDTA. Supernatants were collected and analyzed using a commercially available human TGF1 ELISA (R&D Systems). The results for all antibodies tested are summarized in Table 5, and the results for 28G11 are shown in
TABLE-US-00005 TABLE 5 Effect on TGF1 activation by MMP mAb MMP2 MMP9 28G11 Inhibition Inhibition 2C9 Inhibition No effect 7H4 Inhibition Inhibition 3H6 Inhibition No effect 478.E9 Stimulate Stimulate 6H10 Inhibition No effect 478.G3 Stimulate Stimulate 1E1 Inhibition Inhibition 478.G4 Stimulate Stimulate 2F8 +/ No effect 13B12 Inhibition Inhibition 3G5 Inhibition Inhibition
Example 4: Binding of Anti-LAP Antibodies to Extracellular Matrix
[0381] Since the extracellular matrix is a primary source of latent TGF1, the ability of the anti-LAP antibodies to bind to the ECM was examined.
[0382] P3U1 cells lay down ECM via constitutive expression of LTBP, a component of the LAP-TGF I-LTBP complex which binds to ECM. To evaluate antibody binding to ECM, P3U1 cells were incubated in tissue culture plates for 48 hours. Cells were then removed, leaving behind ECM on the surface of the plates. Three different groups were compared: (a) P3U1 cells expressing human LAP-TGF1, (b) P3U1 cells expressing murine LAP-TGF1, and (c) P3U1 cells without LAP-TGF1 (null cells). Binding of antibody to LAP-TGF1/ECM was then determined using biotinylated anti-LAP antibodies.
[0383] As shown in
Example 5: Binding of Anti-LAP Antibodies to Platelets
[0384] This Example describes the binding of anti-LAP antibodies to platelets.
[0385] Briefly, platelets and peripheral blood mononuclear cells were isolated from the blood of a single healthy donor. Cells were activated for 48 hr with plate-bound anti-CD3 monoclonal antibody (10 g/mL), soluble anti-CD28 monoclonal antibody (2 g/mL), and recombinant human IL-2 (3 ng/mL). The activated cells were stained with anti-CD61 and anti-LAP monoclonal antibodies. A gate was set around CD61+ platelets and LAP expression was measured using antibodies 478.E9, 28G11, 7H4, 3G5, 2F8 and 2C9, as shown. The anti-LAP antibodies were directly biotinylated and binding was measured using APC-labeled streptavidin.
[0386] As shown in
[0387] Anti-LAP antibodies were also tested for platelet binding stoichiometry. Briefly, the number of binding sites/platelet was determined using flow cytometry. Platelet rich plasma was prepared from the blood of a healthy patient. The fluorescence level of each labeled antibody was determined using Quantum Simply Cellular beads (Bang Labs) and their respective fluorescent standard beads according to the manufacturer recommendations. Based on these determinations, the ABC (antibody binding capacity) of platelet staining by each antibody could be equated to the ratio of binding sites/platelet. As shown in
[0388] In a further experiment, additional anti-LAP antibodies were tested for binding to platelets by flow cytometry. Briefly, diluted whole human blood was incubated with the indicated concentrations of directly conjugated anti-LAP antibodies (28G11_(hyb), 20E6_mIgG2a, 22F9_mIgG2a, 17G8_hIgG1, and 24E3_hIgG1) for 15 minutes. The reactions were then incubated for an additional 15 minutes with a directly conjugated antibody against CD61, and analyzed by flow cytometry. The data represents the anti-LAP mean fluorescence intensity of CD61 positive platelets. As shown in
[0389] These additional anti-LAP antibodies were further tested for platelet degranulation. Briefly, diluted whole human blood was incubated with the indicated concentrations of anti-LAP antibodies or adenosine diphosphate (ADP) as a positive control for 15 minutes. The reactions were then incubated for an additional 15 minutes with directly conjugated antibodies against CD61, to detect whole blood platelets, and CD62P to detect degranulated platelets. The samples were analyzed by flow cytometry to determine the percentage of CD62P+ platelets.
[0390] As shown in
Example 6: Binding of Anti-LAP Antibodies to Resting and Activated CD4+ T Cells
[0391] This Example describes the binding of anti-LAP antibodies to resting and activated CD4+ T cells from both human PBMC and murine splenocytes.
[0392] Briefly, peripheral blood mononuclear cells were isolated from the blood of a single healthy donor. Cells were rested in culture for 48 hr or were activated for 48 hr with plate-bound anti-CD3 monoclonal antibody (10 g/mL), soluble anti-CD28 monoclonal antibody (2 g/mL), and recombinant human IL-2 (3 ng/mL). The gating strategy used for this Example is shown in
[0393] Murine splenocytes were isolated from a BALB/c mouse. Cells were either analyzed immediately after preparation or after activation for 48 hr with anti-CD3 antibody+ anti-CD28 antibody+IL-2. The gating strategy is shown in
[0394] As shown in
Example 7: Binding of Anti-LAP Antibodies to Regulatory T Cells
[0395] In this example, the binding of multiple anti-LAP antibodies to regulatory T cells was analyzed.
[0396] Briefly, peripheral blood mononuclear cells were isolated from the blood of a single healthy donor. Cells were activated for 48 hr with plate-bound anti-CD3 monoclonal antibody (10 g/mL), soluble anti-CD28 monoclonal antibody (2 g/mL), and recombinant human IL-2 (3 ng/mL). The activated cells were stained with antibodies specific for CD4, CD25, and FoxP3 to define regulatory T cells (CD4+CD25+ FoxP3+). Cells were analyzed by gating first on single cells and then on lymphocytes by forward and side scatter. Binding of biotinylated anti-LAP antibodies 478.E9, 28G11, 7H4, 3G5, 2F8 and 2C9 was assessed using APC-strepavidin.
[0397] As shown in
[0398] Antibody binding to murine Tregs was also assessed in this example. Briefly, splenocytes were isolated from a BALB/c mouse and stimulated for 24 hr with anti-CD3 antibody, anti-CD-28 antibody, and IL-2. Cells were gated on live cells, single cells, lymphocytes, and CD4+CD25+ cells.
[0399] These results suggest that anti-LAP antibodies have differing Treg binding ability. Anti-LAP antibodies that bind a high percentage of human Tregs (e.g., 2C9, 2F8) can be used to treat cancers dominated by Treg infiltration. Anti-LAP antibodies that bind a higher percentage of murine Tregs (e.g. 16B4) can be used as surrogate antibodies to evaluate the activity of this type of antibody in mouse tumor models.
Example 8: Differential Binding of Anti-LAP Antibodies to Mononuclear Cell Populations
[0400] LAP is expressed on the surface of multiple cell populations. This Example describes the ability of anti-LAP antibodies to bind LAP on various populations of cells. In addition, some of these cells do not express GARP and this example describes the binding of anti-LAP antibodies to both GARP+ and GARP.sup.neg cells.
[0401] Briefly, to evaluate binding to human peripheral blood mononuclear cells, these cells were isolated from the blood of a single healthy donor. Cells were activated for 48 hr with plate-bound anti-CD3 monoclonal antibody (10 g/mL), soluble anti-CD28 monoclonal antibody (2 g/mL), and recombinant human IL-2 (3 ng/mL). The activated PBMCs were first stained with LIVE/DEAD Fixable Dead Cell Stain Kits, then incubated with human FcR block, and then stained with anti-CD4, anti-CD25, anti-CD8, anti-CD16/56, anti-CD19, anti-FoxP3, anti-GARP, anti-CD61 and the anti-LAP antibodies 28G11 and 2F8. Live cells were gated first and then single cells. Cells were gated into lymphocyte or monocyte population was gated, and then the CD61 negative gate was set to exclude platelet-associated cells. As shown in
[0402] As shown in
TABLE-US-00006 TABLE 6 28G11 2F8 CD4+ T cells 5-7% 9-16% CD4+ CD25+ 4-7% 24-38% FoxP3+ T cells CD8+ T cells 2-3% 2-3% B cells 6-10% 28-52% NK cells 25-30% 7%
[0403] Anti-LAP antibodies were also tested for their ability to bind to U937 cells, a myeloid cell line derived from a patient with histiocytic lymphoma. U937 cells were incubated with FACS buffer and human Fc block followed by incubation with varying concentrations of Alexa 647 conjugated 28G11_hyb, 22F9_mIgG2a, or 20E6_mIgG2a. In a separate experiment U937 cells were incubated with FACS buffer and human Fc block followed by incubation with 10 ug/ml of Alexa 647 conjugated 28G11_hyb, 22F9_mIgG2a, 20E6_mIgG2a, or mIgG2a isotype control. Representative dot plots are shown in
[0404] These data demonstrate that the anti-LAP antibodies 28G11, 22F9, and 20E6 display comparable binding to a LAP+ myeloid cell line.
[0405] Anti-LAP antibody binding was also evaluated using murine B cells. Murine splenocytes were isolated from nave Balb/c mice and were activated for 48 hr with 5 g/ml LPS. Cells were stained with a live/dead near infra-red dye followed by Fc block. Cells were then stained with anti-CD41, anti-CD19, anti-GARP and anti-LAP antibodies 28G11 and 16B4. Cells were gated by dead cell exclusion, doublet exclusion, FSC vs. SSC inclusion of lymphocytes, exclusion of platelet positive cells and inclusion of CD19+ cells. As shown in
[0406] Finally, the binding of anti-LAP antibodies to various immune cells in tumors of CT26 tumor bearing mice were examined. Briefly, 110.sup.6 CT26 cells were injected into the flank region of 6 male Balb/C mice. When mean tumor volumes reached about 80 mm.sup.3, 3 mice were treated with IgG2a isotype control or IgG1 isotype control (10 mg/kg). Mice were treated again 3 days later and harvested 7 days post first injection. Tumors tissue was disassociated in a GentlMACS dissociator and digested with Collagenase IV/DNase1, strained through a 70-m cell strainer and counted, and spleen tissue was dissociated by passing through a 70-m cell strainer and counted. Cells were then analyzed by flow cytometry using the following scheme: Gate on live cells.fwdarw.Gate on single cells.fwdarw.Gate on CD45+ cells.fwdarw.Gate on CD41 population.fwdarw.Gate on appropriate immune cell subsets as follows: [0407] Regulatory T cellsCD45+, CD3+, CD4+, Foxp3+ [0408] CD11bCD45+, CD11b+ [0409] M2 macrophagesCD45+, CD11b+, F4/80+, CD206+ [0410] Dendritic cellsCD45+, F4/80, CD11c+ [0411] M-MDSCCD45+, CD11b+, F4/80, Ly6G, Ly6C high
[0412] All three antibodies tested, i.e., 28G11, 22F9 and 20E6, were found to bind to subsets of all major immunosuppressive cell populations (i.e., regulatory T cells, CD11b-positive cells, M2 macrophages, dendritic cells, and M-MDSCs) in the tumor.
[0413] Anti-LAP antibodies which bind to LAP on cells can be used to effectively deplete or inhibit a broad range of immunosuppressive cells that are important in cancer.
Example 9: Differential Binding of Anti-LAP Antibodies to Human Tumor Samples
[0414] In this example, anti-LAP antibodies were used to examine LAP expression in human tumor sections.
[0415] Briefly, frozen human hepatocellular carcinoma tissues sections were obtained from Biochain and analyzed by immunohistochemistry. Sections were rehydrated in TBS and endogenous peroxidase activity was blocked by using Bloxall (Vector Labs). Sections were blocked with 5% horse serum for 1 hour and incubated with 28G11 (10 g/ml) or 2C9 (10 g/ml) overnight at 4 C. The following day mouse specific secondary antibody (Vector Labs) was incubated at 1:500 with the sections for 1 hour followed by a 30-minute incubation with ABC reagent (Vector Labs) according to the manufacturer recommendations. Anti-LAP binding was visualized using DAB (3-Diaminobenzidine) substrate (Thermo Fisher) followed by methyl green nuclear counterstain. Images were recorded at 40 magnification.
[0416] As shown in
Example 10: Efficacy of Anti-LAP Antibodies in CT26 Syngeneic Model
[0417] This Example describes the efficacy of anti-LAP antibodies in combination with anti-PD-1 antibodies in the CT26 colorectal cancer tumor model, a syngeneic model of cancer. In this experiment, variants of the anti-LAP antibodies were used in which the Fc portion of the antibody was the IgG2a isotype rather than the isotype found in the parental hybridoma.
[0418] Briefly, 6-8 week-old Balb/c mice were subcutaneously implanted with 310.sup.5 CT26 colorectal cancer cells. Tumors were grown until an average size of 48 mm.sup.2 at which point tumor-bearing animals were randomized to groups of 10 animals each.
[0419] One set of animals was dosed intraperitoneally with either rat anti-PD-1 clone RMP1-14-IgG2a at 3 mg/kg or a combination of anti-PD-1 and antibody 28G11-IgG2a at 10 mg/kg on days 0, 3, 6, 9, and 12. Animal groups were also dosed with isotype control antibodies (rat-IgG2a and/or mouse IgG2a, not shown).
[0420] Another set of animals was dosed intraperitoneally with either rat anti-PD-1 clone RMP1-14-IgG2a at 3 mg/kg, antibody 16B4-IgG2a at 10 mg/kg, or a combination of anti-PD-1 and antibody 16B4-IgG2a at 10 mg/kg on days 0, 3, 6, 9, and 12. Animal groups were also dosed with isotype control antibodies (rat-IgG2a and/or mouse IgG2a, not shown).
[0421] Survival was assessed daily and tumor volumes were measured 3 times per week by caliper using the formula V=W2L/2. Animals were followed for 53 days post dosing.
[0422] As shown in
Example 11: Efficacy of Anti-LAP Antibodies in EMT6 Syngeneic Model
[0423] This Example describes the efficacy of anti-LAP antibodies in combination with anti-PD-1 antibodies in another syngeneic model of cancer, i.e., the EMT6 breast cancer tumor model.
[0424] Briefly, 6-8 week-old Balb/c mice were subcutaneously implanted into the right hind flank with 310.sup.5 EMT6 breast cancer cells. Tumors were grown until an average size of 75 mm.sup.2, at which point tumor-bearing animals were randomized to 10 groups of 10 animals each, and dosed intraperitoneally on days 0, 3, 6, 9, 12, 15, 18, and 21 according to the following:
TABLE-US-00007 TABLE 7 Group Description Dose 1 Rat IgG2a 5 mg/kg Mouse IgG2a 15 mg/kg 2 Rat anti-PD-1 RMP1-14-IgG2a 5 mg/kg Mouse IgG2a 15 mg/kg 3 28G11_IgG2a 10 mg/kg Rat IgG2a 5 mg/kg 4 Rat anti-PD-1 RMP1-14-IgG2a 5 mg/kg 28G11_IgG2a 10 mg/kg 5 22F9_IgG2a 10 mg/kg Rat IgG2a 5 mg/kg 6 22F9_IgG2a 15 mg/kg 7 Rat anti-PD-1 RMP1-14-IgG2a 5 mg/kg 22F9_IgG2a 10 mg/kg 8 Rat anti-PD-1 RMP1-14-IgG2a 5 mg/kg 22F9_IgG2a 15 mg/kg 9 20E6_IgG2a 10 mg/kg Rat IgG2a 5 mg/kg 10 Rat anti-PD-1 RMP1-14-IgG2a 5 mg/kg 20E6_IgG2a 10 mg/kg
[0425] Survival was assessed daily and tumor volumes were measured 3 times per week by caliper using the formula V=W2L/2. Animals were followed for 28 days post dosing. Data is graphed as mean tumor volume +/SEM.
[0426] As shown in
Example 12: Efficacy of Anti-LAP Antibodies in 4T1 Breast Cancer Tumor Metastasis Model
[0427] This Example describes the efficacy of anti-LAP antibodies as monotherapy in a model of tumor metastasis, i.e., the 4T1 breast cancer tumor metastasis model.
[0428] Briefly, 110.sup.5 4T1 breast cancer cells were implanted into the mammary fat pad of 6-8 week-old Balb/c mice. One day after implantation, animals were randomized to groups of 7 animals each. Animals were dosed with mouse IgG1 isotype control antibody, mouse-IgG2a control antibody, anti-TGF clone 1D11-IgG, and anti-LAP antibodies 28G11 and 16B4. All animals were dosed intraperitoneally at 10 mg/kg on days 0, 3, 6, 9, and 12. On day 29 post dosing, animals were sacrificed and metastatic lung tumor nodules were counted. Data is graphed as mean lung nodule count +/SEM.
[0429] As shown in
Example 13: Efficacy of Anti-LAP Antibodies in the CT26 Syngeneic Model in Combination with Radiation
[0430] This Example describes the efficacy of anti-LAP antibodies in combination with radiation in a syngeneic CT26 tumor model.
[0431] Briefly, 110.sup.6 CT26 colorectal cancer cells were implanted into 6-8 week-old Balb/c mice. Eight days after implantation, animals were randomized into 6 groups of 16 animals each when mean tumor volume was 300 mm.sup.2 (day 0). Starting on day 0, animals were dosed with mouse IgG2a isotype control antibody (Group 1), anti-LAP antibody 28G11-IgG2a (Group 2), 12 Gy radiotherapy and mouse IgG2a isotype control antibody (Group 3), 20 Gy radiotherapy and mouse IgG2a isotype control antibody (Group 4), 12 Gy radiotherapy and anti-LAP antibody 28G11-IgG2a (Group 5), or 20 Gy radiotherapy and anti-LAP antibody 28G11-IgG2a (Group 6). All antibodies were dosed intraperitoneally at 10 mg/kg. Groups 1 and 2 received a total of 3 doses of antibody on days 0, 3, and 6 and those animals were sacrificed at day 7 due to large tumor burden. Groups 3-6 received a total of 5 doses of antibody on days 0, 3, 6, 9, and 12. Three random animals from Groups 3-6 were also sacrificed on day 7 and the remaining animals were followed to day 19. In all cases where the animals received radiation therapy, radiation was dosed only once on day 0. Survival was assessed daily and tumor volumes were measured 3 times per week by caliper using the formula V=W2L/2. Data is presented as mean tumor volume +/SEM of surviving animals.
[0432] As shown in
Example 14: Effects of Anti-LAP Antibodies on CD73 Expression
[0433] In this Example, the effect of anti-LAP antibodies on CD73 expression in the tumor microenvironment was examined. CD73 is a cell surface enzyme that processes AMP to adenosine, a molecule with known immunosuppressive effects in the tumor microenvironment.
[0434] CT26 tumors were grown in Balb/c mice to 300 mm.sup.2 (designated day 0), and antibody 28G11 was dosed at 10 mg/kg on days 0, 3, and 6. Mice were treated with targeted radiation (12 Gy or 20 Gy) at a single dose on day 0. CD73 expression on monocytic myeloid-derived suppressor cells (mMDSCs), M2 macrophages, and dendritic cells was examined by flow cytometry on day 7 after radiation. Groupings were as follows:
[0435] Group 1: isotype control, no radiation (n=5)
[0436] Group 2: 28G11, no radiation (n=5)
[0437] Group 3: isotype control, 12 Gy radiation (N=3)
[0438] Group 4: isotype control, 20 Gy radiation (N=3)
[0439] Group 5: 28G11, 12 Gy radiation (N=2)
[0440] Group 6: 28G11, 20 Gy radiation (N=3)
[0441] As shown in
Example 15: Summary of Antibody Properties
[0442] Characteristics of the anti-LAP antibodies described in the preceding Examples are summarized in Tables 8A and 8B.
TABLE-US-00008 TABLE 8A Binding to Binding to human Binding Binding human TGF1 in Binding Binding Binding to to Effect on TGF1 on absence of to to to GARP+ GARPneg human transfected anchor protein human human human human human TGF Ab cells (ForteBio) TGF2 TGF3 ECM cells cells activation 28G11 Yes Yes No No No Yes Yes Inhibit 7H4 Yes ND ND ND No Yes ND Inhibit 22F9 Yes Yes No No No Yes Yes Inhibit 20E6 Yes Yes No No No Yes Yes Inhibit 17G8 Yes Yes No No No Yes Yes Inhibit 24E3 Yes Yes No No No Yes Yes Inhibit 2C9 Yes Yes No No Yes Yes Yes No effect 16F4 Yes ND ND ND Yes ND ND No effect 3H6 Yes Yes ND ND Yes ND ND Inhibit 478.E9 Yes ND ND ND Yes Yes ND Stimulate 478.G3 Yes ND ND ND Yes ND ND Stimulate 478.G4 Yes ND ND ND Yes ND ND Stimulate 8F10 Yes ND ND ND Yes ND ND Inhibit 6H10 Yes ND ND ND Yes ND ND Inhibit 1E1 Yes Yes ND ND Yes ND ND Inhibit 2F8 Yes ND ND ND Yes Yes Yes No effect 1G12 Yes ND ND ND Yes ND ND No effect 13B12 No ND ND ND No ND ND Inhibit 3G5 No ND ND ND No ND ND Inhibit 20B9 No ND ND ND No ND ND ND 16B4 No ND ND ND No ND ND ND ND: not determined
TABLE-US-00009 TABLE 8B Binding to Inhibition of Binding to murine Binding tumor growth - murine TGF1 in Binding to Binding to Effect on combo therapy Inhibition TGF1 on absence of to GARP+ GARPneg murine with anti-PD-1 of transfected anchor protein murine murine murine TGF mAb (CT26 metastasis Ab cells (ForteBio) ECM cells cells activation or EMT6) (4T1) 28G11 Yes Yes No Yes Yes Inhibit Yes Yes 7H4 Yes ND No Yes Yes Inhibit ND ND 22F9 Yes Yes No Yes Yes ND Yes ND 20E6 Yes Yes No Yes Yes ND Yes ND 17G8 Yes Yes No ND ND Inhibit ND ND 24E3 Yes Yes No ND ND Inhibit ND ND 2C9 No ND No ND ND ND ND ND 16F4 No ND No ND ND ND ND ND 3H6 No ND No ND ND ND ND ND 478.E9 ND ND No ND ND ND ND ND 478.G3 Yes ND No ND ND ND ND ND 478.G4 ND ND No ND ND ND ND ND 8F10 No ND No ND ND ND ND ND 6H10 No ND No ND ND ND ND ND 1E1 No ND No ND ND ND ND ND 2F8 ND ND No ND ND ND ND ND 1G12 ND ND No ND ND ND ND ND 13B12 ND ND No ND ND ND ND ND 3G5 ND ND No ND ND ND ND ND 20B9 Yes ND Yes Yes Yes No effect ND ND 16B4 Yes ND Yes Yes Yes No effect No No ND: not determined
TABLE-US-00010 TABLE9 SummaryofSequences SEQ ID Description Sequence 1 LAPdomainof LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNST humanTGF-1 RDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSE precursor LREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPE peptide WLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLAT IHGMNRPFLLLMATPLERAQHLQSSRHR 2 HumanLAP- LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNST TGF1 RDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSE LREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPE WLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLAT IHGMNRPFLLLMATPLERAQHLQSSRHRALDTNYCFSSTEKNCCVRQLYIDFRKD LGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS 3 LAPdomainof LSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISIYNSTR humanTGF-2 DLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIV precursor RFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYI peptide DSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQ TNRRKKR 4 HumanLAP- LSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISIYNSTR TGF2 DLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIV RFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYI DSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQ TNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSN MIVKSCKCS 5 LAPdomainof LSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVLALYNSTRE humanTGF-3 LLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFR precursor FNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGG peptide KNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIH EVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRK KR 6 HumanLAP- LSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVLALYNSTRE TGF3 LLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFR FNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGG KNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIH EVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRK KRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRS ADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKS CKCS 7 LAPdomainof LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNST murineTGF- RDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSD 1precursor IREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNSWRYLGNRLLTPTDTPEW peptide LSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGISPKRRGDLGTI HDMNRPFLLLMATPLERAQHLHSSRHRR 8 MurineLAP- LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNST TGF1 RDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSD IREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPE WLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGISPKRRGDLGT IHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRK DLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQ ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS 9 LAPdomainof LSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPDEVPPEVISIYNSTR murineTGF- DLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHLPSENAIPPTFYRPYFRIV 2precursor RFDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSPTQRYI peptide DSKVVKTRAEGEWLSFDVTDAVQEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKTPHLLLMLLPSYRLESQQ SSRRKKR 10 MurineLAP- LSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPDEVPPEVISIYNSTR TGF2 DLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHLPSENAIPPTFYRPYFRIV RFDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSPTQRYI DSKVVKTRAEGEWLSFDVTDAVQEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP NKSEELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKTPHLLLMLLPSYRLESQQ SSRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC PYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSN MIVKSCKCS 11 LAPdomainof LSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVMTHVPYQVLALYNSTRE murineTGF- LLEEMHGEREEGCTQETSESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFR 3precursor FNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHIAKQRYIGG peptide KNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENVH EVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGSQRK KR 12 MurineLAP- LSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVMTHVPYQVLALYNSTRE TGF3 LLEEMHGEREEGCTQETSESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFR FNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHIAKQRYIGG KNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENVH EVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGSQRK KRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRS ADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKS CKCS 13 HumanLAP- LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNST TGF1 RDRVAGESAEPEPEPEADTYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSE open LREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPE WLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLAT IHGMNRPFLLLMATPLERAQHLQSSRHRALDTNYCFSSTEKNCCVRQLYIDFRKD LGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS 14 HumanLAP- LSTCKTIDMELVKRKRIEAIRGQILSCLRLASPPSQGEVPPGPLPEAVLALYNST TGF1 RDRVAGESAEPEPEPEADYCAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSE closed LREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPE WLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLAT IHGMNRPFLLLMATPLERAQHLQSSRHRALDTNYCFSSTEKNCCVRQLYIDFRKD LGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS 15 Humanfree ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLD TGF1 TQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCK CS 16 28G11 DYYMS VHCDR1 17 28G11 FIRNKPNGYTTE VHCDR2 18 28G11 YTGGGYFDY VHCDR3 19 28G11 RASQDISNYLN VLCDR1 20 28G11 YTSRLHS VLCDR2 21 28G11 QQGDTLPWT VLCDR3 22 28G11VH EVKLVESGGGLVQPGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLGFIRNKP NGYTTEYSASVKGRFTISRDNSQSILYLQMNVLRAEDSATYYCARYTGGGYFDYW GQGTTLTVSS 23 28G11VL DIQMTQTTSSLSASLGDRLTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLH SGVPSRFSGSGSGTDYSLTISNLEQADIATYFCQQGDTLPWTFGGGTKLEIK 24 3G5VHCDR1 SYWMN 25 3G5VHCDR2 QIYPGDGDTKYNGKFKG 26 3G5VHCDR3 RGYDGYYISFDV 27 3G5VLCDR1 RASENIYSNLA 28 3G5VLCDR2 AATNLAD 29 3G5VLCDR3 QHFWVTPYT 30 3G5VH QIQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIYPGD GDTKYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCARRGYDGYYISFDV WGAGTTVTVSS 31 3G5VL DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQRKQGKSPQLLVYAATNLA DGVPSRFSGSGSGTQYSLKINNLQSEDFGSYYCQHFWVTPYTFGGGTKLEIK 32 16B4 TFGMGVG VHCDR1 33 16B4 HIWWDDDKYYNPALKS VHCDR2 34 16B4 IYYYGSWGLYYFDY VHCDR3 35 16B4 RASQDISNYLN VLCDR1 36 16B4 YTSRLHS VLCDR2 37 16B4 QQGNTLPPT VLCDR3 38 16B4VH QVTLKESGPGILQPSQTLSLTCSFSGFSLNTFGMGVGWIRQPSGKGLEWLAHIWW DDDKYYNPALKSRLTISKDTSKNQVFLKIANVDTADTATYYCARIYYYGSWGLYY FDYWGQGTTLTVSS 39 16B4VL DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLH SGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPPTFGGGTKLEIK 40 7H4VHCDR1 SGYYWN 41 7H4VHCDR2 YISYDGTNNYNPSLKN 42 7H4VHCDR3 SFYNNYFDF 43 7H4VLCDR1 KASQDIDKYIA 44 7H4VLCDR2 YTSTLQP 45 7H4VLCDR3 LQYDNLRT 46 7H4VH DVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYD GTNNYNPSLKNRISITRDTSKHQFFLKLNSVTTEDTATYYCARSFYNNYFDFWGQ GTTLTVSS 47 7H4VL DIQMTQSPSSLSASLGGKVTITCKASQDIDKYIAWYQHKPGKGPRLLIHYTSTLQ PGIPSRFSGSGSGRDYSFNISNLEPEDIATYYCLQYDNLRTFGGGTKLEIK 48 Linker PVGVV
EQUIVALENTS
[0443] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents of the specific embodiments disclosed herein. Such equivalents are intended to be encompassed by the following claims.