A NEW BIOMARKER EXPRESSED IN PANCREATIC BETA CELLS USEFUL IN IMAGING OR TARGETING BETA CELLS
20190145987 · 2019-05-16
Inventors
- Eizirik Decio Laks (Dilbeek, BE)
- Alexander BALHUIZEN (Bruxelles, BE)
- Nick Mark Devoogdt (Eppegem-Zemst, BE)
- Sam Marc Kris Aimé Massa (Hoeilaart, BE)
- Luc Bouwens (Dworp, BE)
- Iris Mathijs (Bambrugge, BE)
Cpc classification
B01D15/3809
PERFORMING OPERATIONS; TRANSPORTING
C07K2317/569
CHEMISTRY; METALLURGY
G01N2800/042
PHYSICS
B01D15/3823
PERFORMING OPERATIONS; TRANSPORTING
International classification
Abstract
The present invention is directed to the identification of a biomarker specifically located in the plasma membrane of pancreatic beta cells. Based on a set of specific features the biomarker is a unique candidate for imaging and targeting strategies to study the pancreatic beta cell mass in health and disease (T1D, T2D, pancreatic cancers, obesity, islet transplantation, beta cell regeneration).
Claims
1. A binding molecule comprising DPP6-K as a biomarker for detecting pancreatic beta cells, preferably , wherein said DPP6-K is defined by the sequence of SEQ ID NO: 1.
2. The binding molecule according to claim 1, wherein DPP6-K is used for visualising or measuring pancreatic beta cell mass.
3. The binding molecule according to claim 1, wherein DPP6-K is used as a circulation marker for detecting damaged beta-cells in a blood, plasma, serum, or urine sample of a subject.
4. A method for detecting and/or visualising pancreatic beta-cells comprising the steps of: a) labelling beta cells in a sample of a subject based on the presence of DPP6-K, b) detecting or visualising the labelled beta cells.
5. A method for measuring pancreatic beta-cell mass comprising the steps of: a) detecting or visualizing the beta cells in a sample of a subject using the method according to claim 4, and b) quantifying the amount of labelled beta cells.
6. A composition for the in vitro and/or in-vivo visualisation of pancreatic beta cells comprising a binding molecule specifically binding to DPP6-K.
7. A composition for the in vitro and/or in-vivo diagnosis of pancreatic beta-cell related disorders comprising a binding molecule specifically binding to DPP6-K.
8. The composition according to claim 7, wherein said pancreatic beta-cell related disorder is type 1 diabetes mellitus, type 2 diabetes mellitus, hyperinsulinemia, obesity, neuroendocrine tumors or occurrence of insulinoma, preferably type-1-diabetes mellitus.
9. A method of in vivo diagnosing a beta-cell-related disorder encompassing the following steps: a) introducing a labelled molecule, specifically binding to the extracellular domain of DPP6-K, into a subject, b) visualizing the labelled molecule specifically located to the beta cell population in the pancreas in vivo, c) quantifying the beta cells mass in said subject, d) comparing the beta cell mass data obtained in step c) with the beta cell mass of a healthy subject, or of a previous analysis of the same subject. e) diagnosing the subject as having diabetes or being at risk of having diabetes when the level of beta cell mass obtained in step c) is reduced as compared to that of a healthy subject and diagnosing the subject as having hyperinsulinemia or being at risk of having hyperinsulinemia when the level of beta cell mass obtained in step c) is increased as compared to that of a healthy subject, or of a previous analysis of the same subject.
10. The method according to claim 9, wherein said labelled molecule is selected from the group comprising: an antibody or a fragment thereof, a nanobody, an affibody, a minibody, a diabody, a single chain antibody, an aptamer, a photoaptamer, a peptide, a small molecule, an interacting partner, an isotopically labelled tracer, or a ligand, specifically binding to the extracellular domain of DPP6-K.
11. The method according to claim 9, wherein said in vivo visualisation is done using a PET, PET-CT, SPECT or MRI scan, or through fluorescent imaging.
12. The method of claim 9, wherein the beta-cell-related disorder is type 1 diabetes mellitus, type 2 diabetes mellitus, hyperinsulinemia, obesity, or occurrence of insulinoma.
13. A labelled molecule, specifically binding to the extracellular domain of DPP6-K, for use in diagnosis of a beta-cell-related disorder in vivo, according to the method of claim 9, preferably wherein the beta-cell-related disorder is type 1 diabetes mellitus, type 2 diabetes mellitus, hyperinsulinemia, obesity, or occurrence of insulinoma.
14. A kit for visualising beta cells, for specifically measuring beta cell-mass, for diagnosing a beta-cell-related disorder, for detecting beta cell fragments in a blood or urine sample, and/or for purifying beta cells in a subject comprising a labelled molecule specifically binding to the extracellular domain of DPP6-K, preferably wherein said binding molecule is an antibody or a fragment thereof, a nanobody, an affibody, a minibody, a diabody, a single chain antibody, an aptamer, a photoaptamer, a peptide, a small molecule, an interacting partner, an isotopically labelled tracer, or a ligand, specifically binding to DPP6-K.
15. The kit of claim 14, wherein the binding molecule is a nanobody comprising CDR regions defined by SEQ ID Nos 9, 10, and 11; or a nanobody comprising the heavy chain variable domain as defined by SEQ ID No 8.
16. A method for following up the success of the transplantation of beta cells in a subject comprising the following steps: a) measuring the amount of beta-cell mass in the subject at one or more time points after transplantation of the subject with beta cells with the method according to claim 5, b) determining the success of the transplantation by comparing the beta cell mass in the course of time by evaluating the evolution of beta-cell mass over time.
17. A method for purifying or isolating beta cells from other pancreatic non-beta cells comprising the following steps: a) tagging the beta cells with a labelled binding molecule specifically binding to the extracellular domain of DPP6-K, b) isolating the labelled cells from the non-labelled cells through the tag on the beta cells, thereby obtaining a substantially pure beta cell preparation.
18. A method for identification of regeneration of beta cells comprising the steps of: a) tagging the beta cells with a labelled binding molecule specifically binding to the extracellular domain of DPP6-K, b) isolating the labelled cells from the non-labelled cells through the tag on the beta cells, thereby obtaining a substantially pure regenerated beta cell preparation c) performing immunohistochemistry to identify the number of newly regenerated beta cells, and to define the new beta cell mass d) follow up of therapeutic strategies and detect beta cell mass recovery.
19. The method of claim 18, wherein the tag is a magnetic bead, or paramagnetic bead.
20. A method of identification of stem cell populations treated to differentiate towards functional insulin-expressing beta stem cells comprising the following steps: a) tagging the treated stem cells with a labeled binding molecule specifically binding to the extracellular domain of DPP6-K, b) isolating the labeled cells from the non-labeled cells through the tag on the potential beta stem cells, thereby obtaining a substantially pure beta stem cell preparation.
21. The method of claim 20, further comprising the steps of: c) performing immunohistochemistry to identify the number of precursor beta cells, and optionally to define the new beta cell mass; and/or d) following-up op therapeutic strategies and detect newly formed beta cells.
22. A method for identifying new tracer molecules that specifically bind beta cells comprising the steps of: a) contacting the candidate tracer molecule with cells or cell-lines positive for the extracellular domain of DPP6-K and measuring the interaction between the candidate tracer molecule and the cells; b) contacting the candidate tracer molecule with cells or cell-lines negative for the extracellular domain of DPP6-K and measure the interaction between the candidate tracer molecule and the cells; c) comparing the interactions between both steps a) and b); and d) retain these candidate tracer molecules that bind the cells of step a) but not the cells of step b) as beta-cell-mass tracer molecules.
23. The method of claim 22, wherein the cell or cell-line positive for the extracellular domain of DPP6-K is selected from the group comprising: rodent pancreatic islets, rat INS-1E cells, Kelly tumor cells, and the human beta cell line ENDOC-BH1; and wherein the cell-types or cell-lines negative for the extracellular domain of DPP6-K are PANC-1 or CAPAN-2.
24. A kit for identifying new tracer molecules that specifically bind beta cells comprising two cell types or cell-lines, one being a cell-type or cell-line positive for the extracellular domain of DPP6-K and one being a cell-type or cell-line negative for the extracellular domain of DPP6-K.
25. The kit of claim 24, wherein the cell-type or cell-line positive for the extracellular domain of DPP6-K is selected from the group comprising: rodent pancreatic islets, rat INS-1E cells, Kelly tumor cells and the human beta cell line ENDOC-BH1; and/or wherein the cell-types or cell-lines negative for the extracellular domain of DPP6-K are PANC-1 or CAPAN-2.
26. A method for identifying new tracer molecules that specifically bind beta cells comprising the steps of: a) contacting the candidate tracer molecule with a DPP6-Kmolecule and b) measuring the interaction between the candidate tracer molecule and the DPP6-K molecule, wherein these candidate tracer molecules that specifically bind the DPP6-K molecule of step a) are retained as beta cell tracer molecules.
27. A binding molecule specifically binding the extracellular domain of DPP6-K, preferably selected from the group comprising: an antibody or a fragment thereof, a nanobody, an affibody, a minibody, a diabody, a single chain antibody, an aptamer, a photoaptamer, a peptide, a small molecule, an interacting partner, an isotopically labelled tracer, or a ligand specifically binding to the extracellular domain of DPP6-K.
28. The binding molecule according to claim 27, which is a nanobody comprising CDR regions defined by SEQ ID Nos 9, 10, and 11.
29. The binding molecule according to claim 27, which is a nanobody comprising the heavy chain variable domain defined by SEQ ID No 8.
30. A method of delivering therapeutic agents specifically to beta cells comprising using of a binding molecule according to claim 27, with the goal of protecting these cells against dysfunction and death in diabetes.
31. A kit comprising binding molecules according to claim 27.
32. The kit according to claim 31, wherein said binding molecules are immobilised on a solid support, such as beads, a chip or a microchip.
33. The kit according to claim 31, wherein said binding molecules are labelled, preferably with a radioisotope, a fluorescent moiety, a chemiluminescent moiety, a bioluminescent moiety, a chemifluorescent moiety or a metal or magnetic moiety.
34. The kit according to claim 31, comprising one or more (micro)fluidic or microvortex-creating channels wherein said binding molecules are immobilised, whereon beta cells and/or beta cell debris can be bound and subsequently detected.
35. A method of diagnosing T1D using the binding molecule according to claim 27, comprising detection of beta cells and/or beta cell debris in the circulation of a subject, wherein such detection is indicative of T1D disease development.
36. A method of diagnosing T1D using the binding molecule according to claim 27, comprising detection of beta cells and/or beta cell debris in the circulation of a subject, wherein an increase in detection of beta cells and/or beta cell debris over time in the circulation of the subject is a measure for disease progression.
37. A method of diagnosing T1D using the binding molecule according to claim 27, comprising detection of beta cells and/or beta cell debris in the circulation of a subject, wherein a decrease in detection of beta cells and/or beta cell debris over time is a measure for disease improvement and hence of successful treatment.
38. A method of monitoring beta cell transplants in the skin, intramuscular, or in other accessible locations in the body, using the binding molecule according to claim 27, comprising the detection of the labelled binding molecule(s) specific for beta cells, preferably fluorescently labelled binding molecules, using non-invasive clinical imaging methods.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0102] The present invention is directed to biomarkers specifically useful for visualizing pancreatic beta cells.
[0103] Said biomarkers are not only specific for pancreatic islets versus exocrine tissue but a number of extra selection criteria were added which makes these biomarker candidates more suitable for the use in beta cell imaging and targeting. Unique datasets were used containing quantitative information (instead of comparative information) to select the biomarker. The unique features assigned to the selected biomarkers are:
[0104] 1. The selected biomarker candidate is enriched more than 50-100 times in human islets versus total human pancreas: Instead of using comparative data obtained by microarray, we have quantitative data obtained by RNA sequencing. Since islets constitute 1-2% of the total pancreas, we used as selection criteria an enrichment of 50-100 times in islets versus pancreas. Using the quantitative data we can calculate how many times the expression will be enriched in human pancreatic islets versus the surrounding human tissues (stomach, spleen, intestine) or versus tissues used for placing islet grafts (liver, kidney) based on comparison with publicly available human RNA-seq datasets; this is a very useful criteria for anticipating background levels and for selecting islet specific candidates. The enrichment in islets versus total pancreas is preferably higher than 50 fold.
[0105] 2. Selected candidate is enriched in purified rat beta cells compared to purified rat non beta cells making them relatively beta cell specific. The islet composition changes during the evolution of T1D due to loss of beta cells and the relative increase in non beta cells (mostly alpha cells). It is thus crucial for quantification of beta cell mass that putative biomarkers are specifically expressed in beta cells. The present selection was done based on our unique data set obtained with RNA-seq. Until now no such selection has been done. The term enriched means that a higher level of expression is obtained in beta cells when compared to non-beta cells, manipulated under identical conditions. As this analysis is done based on RNA-seq, the FC change is not taken in account so we selected genes that were higher expressed in beta cells than in non-beta cells but no FC criteria was set as such.
[0106] 3. The selected biomarker is well expressed in beta cells. For imaging the targets need to be expressed in sufficient amount on the pancreatic beta cells to enable detection. We have both quantitative data in human islets and comparative data in human islets and primary rat beta cells to check this criterion.
[0107] 4. The selected biomarker is located in the plasma membrane and can be used for targeting with specific antibodies, chemical synthesis, natural compounds or with peptides. Antibodies and peptides targeting these proteins detect native structures located on the plasma membrane proteins with an affinity high enough to perform imaging/targeting. The localization in the plasma membrane was assessed by a Systems Biology approach (IPA analysis, GO analysis, literature screening) and we perform immunohistochemistry to confirm this localization.
[0108] 5. The expression level of the selected gene/protein is not substantially modified (e.g. induced) during inflammation: We have a large amount of RNA-seq and microarray data comparing control condition to conditions in which inflammation is induced (e.g. cytokine-treated or virus- or dsRNA-exposed beta cells). During inflammation pancreatic beta cells often express similar markers as those found in immune cells (T-cells, dendritic cells) infiltrating in the pancreas. It is thus of major importance to select biomarkers exclusively expressed in the beta cells and not induced during inflammation in order to quantify beta cell mass. By comparison of our RNA-seq and microarray datasets with the publicly available Illumine database we could confirm these data. This analysis was not done previously by other groups. The term not substantially modified (e.g. induced) means that the expression level of the candidate marker is not induced in inflammatory versus non-inflammatory conditions. This is to counter the possible effect of inflammation increasing the expression in an equal amount of decrease in beta cell-mass due to a disease condition such as diabetes. (i.e. if the decrease in beta cell mass in diabetic conditions would be about 30% and the marker as such has an increased expression of about 30% due to inflammation condition, this would not allow to detect changes in beta cell mass based on said marker).
[0109] Next, a procedure was developed to analyze the best candidate of our list at the protein level and to confirm islet- and beta cell-specificity. For the selected candidate we prepared antibodies specifically targeting the biomarker. The selected candidate and the antibodies targeting the candidate were tested in human tissue microarrays confirming their specificity for pancreas (versus surrounding tissues) and their specific expression in pancreatic islets versus exocrine tissue. The protein expression of the biomarker was subsequently validated for its specificity to beta cells versus non beta cells via immunocytochemistry on pancreatic slices of normal and diseased human and rodent pancreas.
[0110] With this set of criteria a unique biomarker was obtained selectively expressed on the plasma membrane of human and rodent pancreatic beta cells. The expression level is high enough to perform imaging/targeting and the expression level is not substantially modified by inflammation and diabetic conditions or has not been previously identified as auto-antigen. This makes it a perfect candidate for imaging/targeting of beta cells.
[0111] The great advantage of the present invention is to enable determination of pancreatic beta cell mass in diabetes mellitus (see below). Of note, there are presently no other available methods to specifically measure beta cell mass.
[0112] Similarly, said biomarker can, due to its specificity be used as a marker for detecting damaged or degraded beta cells circulating in the body of the subject. Such a circulation marker is highly sought after in the field of diabetes mellitus diagnosis, progression monitoring and treatment.
[0113] Type 1 diabetes (T1D) is an autoimmune disease in which the body's immune system attacks and kills its own insulin-producing beta cells and kills them. A key obstacle to early detection of T1D, to understand the evolution of the disease and to assess the effectiveness of novel therapeutic interventions to prevent or cure the disease is the lack of direct, noninvasive technologies to visualize and measure beta cell mass.
[0114] Type 2 diabetes (T2D) is a long-term metabolic disorder that is characterized by high blood sugar caused by failure of the beta cells to compensate for insulin resistance, most commonly secondary to obesity. The lack of reliable methods to determine beta cell mass also limits follow up of pancreatic islet transplantation and of patients affected by type 2 diabetes (T2D), a disease where a progressive decrease of beta cell mass (albeit of less magnitude than T1D) is also present. To achieve the goal of beta cell imaging, there is an urgent need for beta cell specific membrane proteins which can be visualized. To solve this problem, we have selected a novel candidate beta cell biomarker by a Systems Biology approach. The results obtained indicate that:
[0115] The selected candidate is highly enriched in human pancreatic beta cells. Antibodies, Nanobodies (Ablynx NV), small molecules or peptides directed against them can be made into tracers to be used for PET or MRI or SPECT imaging. These tracers will bind preferentially to beta cells, enabling very good specificity and selectivity. In later stages of T1D, when there is a severe decrease in the number of beta cells and a relative increase in alpha cells, beta cell specific biomarker will allow quantification of the remaining beta cell mass without background from non beta cells.
[0116] This biomarker will also allow follow up of pancreatic islet transplants, examination of the progressive decrease in beta cell mass in type 2 diabetic patients or of an eventual increase in beta cell mass in obese non-diabetic patients (in this case, there is an increase in beta cell mass that compensates for the insulin resistance).
[0117] The selected biomarker is not induced by inflammation and will not target infiltrating immune cells. Beta cells express autoantigens which are detected by infiltrating immune cells. Since we compare the expression of our selected biomarker in control and inflamed beta cells and select membrane proteins which are not expressed in immune cells we will be able to follow the beta cell mass during inflammation (insulitis)
[0118] The selected candidate allow non invasive imaging of islet grafts following human islet transplantation and allow adjustment of immunosuppressive therapy to support graft survival and earlier interventions with the aim of rescuing transplants, which are under augmented immune assault.
[0119] Endogenous antibodies targeting the candidates, arising as part of the autoimmune process in T1D, are valuable markers of autoimmunity and help in the detection of patients at a high risk to develop the disease.
[0120] The current agents used for imaging the pancreas include reagents such as glibenclamide, dopamine, fluorodeoxyglucose, fluorodithizone and DOPA. The uptake of these agents in beta cells, as compared to exocrine pancreas and non beta cells in the islets, is not sufficient to allow reliable imaging of beta-cell mass (Sweet et al, 2004).
[0121] In conclusion, the biomarker is preferentially expressed in beta cells and is expressed on the surface in sufficient amounts to enable imaging. It has extracellular domains against which a naturally occurring ligand, a peptide or and antibody (or antibody fragment) can be developed as tracer. The selected biomarker will not be modified in conditions of inflammation. These unique features will make clinical analysis of beta cell mass possible.
[0122] The goal of the biomarker of the present invention is its use in the estimation and visualisation of the pancreatic beta cell mass in healthy and diseased state (diabetes or following islet transplantation). The invention will allow the development of tools for prediction and follow up of the diabetic state, for the follow up of islet transplantation, and as surrogate markers for therapeutic assays aiming to prevent diabetes and/or regenerate beta cell mass. The non-invasive imaging performed with this candidate will allow the detection of the increase of decrease in beta cell mass.
[0123] The invention therefore provides a non-invasive method for the diagnosis, prognosis, progression monitoring, or treatment monitoring of a diabetic disorder such as type 1 or type 2 diabetes mellitus (T1D or T2D) or hyperinsulinemia, by detecting and/or measuring the beta cell mass of a subject and comparing it to a reference amount of beta cell mass of a healthy subject or of a subject with known diagnosis, prognosis, disease progression or treatment outcome. An increase of the beta cell mass in the subject under investigation points to a condition of hyperinsulinemia, while a reduction of the beta cell mass in the subject under investigation points to a condition of diabetes mellitus of type 1 or 2.
[0124] The non-invasive method for the diagnosis or prognosis of a diabetic disorder encompasses the highly specific detection and/or visualization of beta cells through the detection of beta cell-specific biomarker DPP6-K.
[0125] The term DPP6 as used herein refers to the dipeptidyl peptidase VI protein encoded by the DPP6 gene. DPP6 is a single-pass type II transmembrane protein, which is highly expressed in the human and mouse brain. Not much is known about this protein except that it physically associates with certain ion channels in the brain and that DPP6 mutations are associated with brain pathologies. DPP6 is reported to be differentially-spliced, yielding 6 splice variants (
TABLE-US-00001 (SEQIDNO.1) MKEKAMIKTAKMQGNVMELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNS LSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKI ESLRAIRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQY AGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKTHIAH WWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGP THDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKHED ESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGD WDVTKILAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFS HSMDFFLLKCEGPGVPMVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDY NLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRG SGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPA KGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQF LIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSIINFFV ECFRIQDKLLTVTAKEDEEED(SEQIDNO.3UNDERLINED) (SEQIDNO.2) MKEKAMIKTAKMQGNVMELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDTS LSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKI ESLRAIRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQY AGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAH WWSPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGLNGP THDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKHED ESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGD WDVTKILSYDEKRNKIYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFS HNMDFFLLKCEGPGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKIEVEDY SLPMQILKPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAVVVKCDGRG SGFQGTKLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYLSTYILPA KGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRVSALEDQQF LIIHATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHLSRSIIGFFV ECFRVQDKLPTATAKEEEEED
[0126] The detection of the specific markers is done by using a radioisotopically labelled tracer molecule that binds the biomarker with high specificity. Tracers may for example be antibodies, or their fragments, single chain antibodies, nanobodies, affibodies, minibodies, diabodies, aptamers, photoaptamers, a specific ligand or interacting protein, or any small molecule or the like that has been shown to specifically bind the biomarker of choice.
[0127] The antibodies can be known or commercially available antibodies, or can be specifically designed to detect the biomarker of the invention in a highly specific manner.
[0128] In this respect, the inventors designed binding molecules directed to the extracellular domain of DPP6-K, e.g. by immunizing animals with the following peptide (SEQ ID NO: 3):
TABLE-US-00002 LTPAEDNSLSQKKKVTVEDLFSEDFKIHDP EAKWISDTEFIYREQKGTVR LWNVETNTSTVLIEGKKIESLRAIRYEISP DREYALFSYNVEPIYQHSYT GYYVLSKIPHGDPQSLDPPEVSNAKLQYAG WGPKGQQLIFIFENNIYYCA HVGKQAIRVVSTGKEGVIYNGLSDWLYEEE ILKTHIAHWWSPDGTRLAYA AINDSRVPIMELPTYTGSIYPTVKPYHYPK AGSENPSISLHVIGLNGPTH DLEMMPPDDPRMREYYITMVKWATSTKVAV TWLNRAQNVSILTLCDATTG VCTKKHEDESEAWLHRQNEEPVFSKDGRKF FFIRAIPQGGRGKFYHITVS SSQPNSSNDNIQSITSGDWDVTKILAYDEK GNKIYFLSTEDLPRRRQLYS ANTVGNFNRQCLSCDLVENCTYFSASFSHS MDFFLLKCEGPGVPMVTVHN TTDKKKMFDLETNEHVKKAINDRQMPKVEY RDIEIDDYNLPMQILKPATF TDTTHYPLLLVVDGTPGSQSVAEKFEVSWE TVMVSSHGAVVVKCDGRGSG FQGTKLLHEVRRRLGLLEEKDQMEAVRTML KEQYIDRTRVAVFGKDYGGY LSTYILPAKGENQGQTFTCGSALSPITDFK LYASAFSERYLGLHGLDNRA YEMTKVAHRVSALEEQQFLIIHPTADEKIH FQHTAELITQLIRGKANYSL QIYPDESHYFTSSSLKQHLYRSIINFFVEC FRIQDKLLTVTAKEDEEED
[0129] In one embodiment, the diagnostic or prognostic method of the invention uses Positron Emission Tomography (PET), a nuclear medicine medical imaging technique which produces a three-dimensional image or map of functional processes in the body. The system detects pairs of gamma rays emitted indirectly by a positron-emitting radioisotope, which is introduced into the body through a tracer molecule e.g. a specific biomarker binding molecule. Images of the radioisotope labeled tracer in the body are then reconstructed by computer analysis. In modern scanners, a PET scan is combined with a CT X-ray scan (PET-CT) performed on the patient at the same time, in the same machine, providing the structural reference of the organs etc.
[0130] In an alternative embodiment, single photon emission computed tomography (SPECT) imaging can be used in the diagnostic or prognostic method of the invention. SPECT uses a gamma camera to acquire multiple 2-D projections from multiple angles. A computer is then used to apply a tomographic reconstruction algorithm to the multiple projections, yielding a 3-D dataset. This dataset may then be manipulated to show thin slices along any chosen axis of the body.
[0131] Preferred labels used in PET or PET-CT are short-lived radioisotopes such as carbon-11 (20 min), nitrogen-13 (10 min), oxygen-15 (2 min), galium-68 (68 minutes) and fluorine-18 (110 min) or medium-lived radioisotopes such as zirconium-89 (4 days) and iodine-124 (4 days) when appropriate. Several novel tracer molecules have been developed including modified Exendin derivatives (Poly-Chelator Exendin, cleavable linkers and click-chemistry for easy 18F labelling), a PAC1 receptor targeting peptide, GIP derivatives for targeting the GIP receptor, a peptide targeting GPR54, and nanoparticles for MRI and optical imaging coupled with Exendin-4 and glibenclamide. GMP kits for clinical imaging for .sup.111In and .sup.68Ga labelling of Exendin have been developed, fully GMP certified, and can be distributed in Europe after approval of a certified person.
[0132] These novel tracers have been evaluated in vitro and in vivo. Poly-chelator-Exendin has identical pharmacokinetic properties when compared to the lead compound of the project but can be labelled with much higher specific activities, enabling improved small animal imaging with higher activity doses and injection of lower amounts of peptide (also for human use). Other tracers (GIP, PAC1 targeting peptide, GPR54 targeting peptide) do not appear to be suitable for in vivo imaging of pancreatic beta cells although in tumour imaging, PAC1 targeting peptide shows favourable results. Non-invasive islet imaging is also being developed with high field MRI and the use of nanoparticles and probes targeting beta cells via the lead compound as well as manganese contrast enhancement. xf-FDOCT has been further established as a new and powerful method to follow islets and diabetes progression in autoimmune diabetic mouse (NOD) models, to visualize blood flow in pancreatic islets and to dynamically monitor tracer distribution within the pancreas of live mice.
[0133] Preparation and assessment of the GMP clinical grade SPECT and PET tracer targeting GLP-1R is completed. Protocols for quantitative SPECT imaging have been implemented and optimized, as well as dosimetry protocols. Full documentation according to EMA standards for the Exendin based tracers has been achieved for clinical studies and the respective documents allow easy modification for use with other Exendin-based tracers (except for the production IMPD that needs to be prepared for every tracer molecule based on the labelling protocol). As already mentioned, the kits together with full documentation can now be distributed throughout Europe for multicenter studies after approval by a qualified person. Clinical trials with Exendin are under way.
[0134] A typical in vivo diagnostic method encompassed by the invention is as follows:
[0135] a) introducing an isotopically labelled tracer molecule, specifically binding to the beta cell specific biomarker into a subject,
[0136] b) the in vivo visualisation of a tracer molecule specifically binding to the beta cells in the pancreas using PET, PET-CT or SPECT,
[0137] c) quantification of the beta cells mass in said subject,
[0138] d) comparison of the beta cell mass data obtained in step c) with the beta cell mass of a healthy subject, and
[0139] e) diagnosing the subject as having diabetes or being at risk of having diabetes when the level of beta cell mass obtained in step c) is reduced as compared to that of a healthy subject and diagnosing the subject as having hyperinsulinemia or being at risk of having hyperinsulinemia when the level of beta cell mass obtained in step c) is increased as compared to that of a healthy subject.
[0140] The method of in vivo diagnosis or prognosis can be used to diagnose insulin-related disorders such as type 1 or type 2 diabetes mellitus, hyperinsulinemia and pancreatic cancer such as the occurrence of neuroendocrine tumors of the pancreas like insulinoma derived from the beta cells.
[0141] For treating insulin-related disorders, pancreatic islet transplantation is an option.
[0142] Typically, the Edmonton protocol is applied wherein specialized enzymes are used to remove islets from the pancreas of a deceased donor. Because the islets are fragile, transplantation occurs soon after they are removed. Typically a patient receives at least 10,000 islet equivalents per kilogram of body weight, extracted from two or more donor pancreases. Patients often require two transplants to achieve insulin independence. Some transplants have used fewer islet equivalents taken from a single donated pancreas. Transplants are often performed by a radiologist, who uses x rays and ultrasound to guide placement of a catheter through the upper abdomen and into the portal vein of the liver. The islets are then infused slowly through the catheter into the liver. The patient receives a local anesthetic and a sedative. In some cases, a surgeon may perform the transplant through a small incision, using general anesthesia.
[0143] The key of success for such a beta cell transplantation treatment is of course the purity of the beta cell preparation used for the transplantation. The invention provides for methods of specifically isolating beta cells for use in islet transplantation and tools for follow up of transplanted beta cells.
[0144] In a further embodiment, the invention provides for methods to isolate and/or purify pancreatic beta cells from pancreatic tissue, by visualizing or labeling the beta cells in a specific manner using the DPP6-K variant.
[0145] Alternatively, the method provides a method for identification of stem cell populations in order to derive functional insulin-expressing cells comprising the following steps:
[0146] a) tagging the treated stem cells with a labelled binding molecule specifically binding to the DPP6-K variant,
[0147] b) isolating the labelled cells from the non-labeled cells through the tag on the potential beta stem cells, thereby obtaining a substantially pure beta stem cell preparation.
[0148] The method of the invention can in certain embodiments further comprise the steps of:
[0149] c) performing immunohistochemistry to identify the number of beta stem cells, and to define the new beta cell mass and
[0150] d) follow up of therapeutic strategies and detect newly formed beta cell mass.
[0151] The above separation methods can for example be performed by separating labelled cells from non-labelled cells using standard separation techniques based on the retention of labelled binding molecules specifically binding to the biomarker of the present invention.
[0152] One option is to use antibodies, nanobodies, aptamers, oligonucleotides or other specific binding agents or ligands, specifically binding to the biomarker of the invention, for tagging cells of interest with a small magnetic particle or magnetic bead. The bead-binding molecule conjugate is then directed to the beta-cells in the pancreatic cell preparation and the beta cells can be specifically purified from the total pancreatic cell preparation by using e.g. an electromagnetic field. In some systems, the sample is processed through a column that generates a magnetic field when placed within the separator instrument, retaining only the labelled cells.
[0153] Other systems offer simplified versions of the magnetic separator. Instead of a column and separator instrument, these systems use a simple magnet to directly retain the labeled cells within the tube, while the supernatant is drawn off. Some of these systems can be used in a positive or negative selection manner. Negative or enrichment selection means that unwanted cells can be labeled (captured), leaving the cells of interest label-free. The magnetic particles do not interfere with flow cytometry, nor do they interfere with cell growth, according to Hammonds, so cells that have been isolated using such a system can be further cultured.
[0154] Magnetic separation has proven uniquely powerful and broadly applicable, sometimes leading to 70% recovery of the target cells and up to 98% purity while retaining cell viability.
[0155] Alternatively, an efficient non-magnetic separation method, based on work on tetrameric antibody complexes (TACs) works by linking unwanted cells in a sample together, forming clumps. After labelling, the sample is layered over a buoyant density medium such as Ficoll. The labelled cells pellet with when centrifuged, while the desired, unlabelled cells are recovered at the interface. This method is fast and the cells obtained are not labelled with antibodies and are untouched.
[0156] Many of these techniques are most powerful in combination. The skilled person would however be aware of other methods to selectively purify specific cell-types.
[0157] The term binding molecules used in the methods and kits of the invention refers to all suitable binding molecules that are specifically binding or interacting with the biomarker of the invention and that can be used in the methods and kits of the present invention. Examples of suitable binding agents are antibodies, monoclonal- or polyclonal antibodies, nanobodies, affybodies, antibody fragments, aptamers, photoaptamers, oligonucleotides, lipocalins, specifically interacting small molecules, Molecular Imprinting Polymers (MIPs), DARPins, ankyrins, specifically interacting proteins, peptidomimetics, biomimetics or peptides, and other molecules that specifically bind to the biomarker.
[0158] As used herein, the term antibody refers to polyclonal antibodies, monoclonal antibodies, humanized antibodies, single-chain antibodies, and fragments thereof such as Fab, F(ab)2, Fv, and other fragments that retain the antigen binding function of the parent antibody. As such, an antibody may refer to an immunoglobulin or glycoprotein, or fragment or portion thereof, or to a construct comprising an antigen-binding portion comprised within a modified immunoglobulin-like framework, or to an antigen-binding portion comprised within a construct comprising a non-immunoglobulin-like framework or scaffold.
[0159] As used herein, the term monoclonal antibody refers to an antibody composition having a homogeneous antibody population. The term is not limited regarding the species or source of the antibody, nor is it intended to be limited by the manner in which it is made. The term encompasses whole immunoglobulins as well as fragments and others that retain the antigen binding function of the antibody. Monoclonal antibodies of any mammalian species can be used in this invention. In practice, however, the antibodies will typically be of rat or murine origin because of the availability of rat or murine cell lines for use in making the required hybrid cell lines or hybridomas to produce monoclonal antibodies.
[0160] As used herein, the term polyclonal antibody refers to an antibody composition having a heterogeneous antibody population. Polyclonal antibodies are often derived from the pooled serum from immunized animals or from selected humans.
[0161] Heavy chain variable domain of an antibody or a functional fragment thereof, as used herein, means (i) the variable domain of the heavy chain of a heavy chain antibody, which is naturally devoid of light chains (also indicated hereafter as V.sub.HH), including but not limited to the variable domain of the heavy chain of heavy chain antibodies of camelids or sharks or (ii) the variable domain of the heavy chain of a conventional four-chain antibody (also indicated hereafter as V.sub.H), including but not limited to a camelized (as further defined herein) variable domain of the heavy chain of a conventional four-chain antibody (also indicated hereafter as camelized V.sub.H) or any functional fragments thereof, such as but not limited to one or more stretches of amino acid residues (i.e. small peptides) that are particularly suited for binding to a tumor antigen and which are present in, and/or may be incorporated into, the V.sub.HH's as disclosed herein (or may be based on and/or derived from CDR sequences of the V.sub.HH's as disclosed herein).
[0162] As further described hereinbelow, the amino acid sequence and structure of a heavy chain variable domain of an antibody can be considered, without however being limited thereto, to be comprised of four framework regions or FR's, which are referred to in the art and hereinbelow as framework region 1 or FR1; as framework region 2 or FR2; as framework region 3 or FR3; and as framework region 4 or FR4, respectively, which framework regions are interrupted by three complementary determining regions or CDR's, which are referred to in the art as complementarity determining region 1 or CDR1; as complementarity determining region 2 or CDR2; and as complementarity determining region 3 or CDR3, respectively.
[0163] An amino acid sequence, in particular an antibody fragment, such as a V.sub.HH or functional fragments thereof, as disclosed herein is considered to be (in) essentially isolated (form) as used herein, when it has been extracted or purified from the host cell and/or medium in which it is produced.
[0164] In respect of the amino acid sequences, in particular an antibody fragment, such as a V.sub.H or functional fragments thereof .sub.H, as disclosed herein, the terms binding region, binding site or interaction site present on the amino acid sequences as disclosed herein shall herein have the meaning of a particular site, region, locus, part, or domain present on the target molecule, which particular site, region, locus, part, or domain is responsible for binding to that target molecule. Such binding region thus essentially consists of that particular site, region, locus, part, or domain of the target molecule, which is in contact with the amino acid sequence when bound to that target molecule.
[0165] As used herein, the terms complementarity determining region or CDR within the context of antibodies refer to variable regions of either the H (heavy) or the L (light) chains (also abbreviated as VH and VL, respectively) and contain the amino acid sequences capable of specifically binding to antigenic targets. These CDR regions account for the basic specificity of the antibody for a particular antigenic determinant structure. Such regions are also referred to as hypervariable regions. The CDRs represent non-contiguous stretches of amino acids within the variable regions but, regardless of species, the positional locations of these critical amino acid sequences within the variable heavy and light chain regions have been found to have similar locations within the amino acid sequences of the variable chains. The variable heavy and light chains of all canonical antibodies each have 3 CDR regions, each non-contiguous with the others (termed L1, L2, L3, H1, H2, H3) for the respective light (L) and heavy (H) chains.
[0166] As also further described hereinbelow, the total number of amino acid residues in a heavy chain variable domain of an antibody (including a V.sub.HH or a V.sub.H) can be in the region of 110-130, is preferably 112-115, and is most preferably 113. It should however be noted that parts, fragments or analogs of a heavy chain variable domain of an antibody are not particularly limited as to their length and/or size, as long as such parts, fragments or analogs retain (at least part of) the functional activity, and/or retain (at least part of) the binding specificity of the original a heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from. Parts, fragments or analogs retaining (at least part of) the functional activity, and/or retaining (at least part of) the binding specificity of the original heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from are also further referred to herein as functional fragments of a heavy chain variable domain.
[0167] The amino acid residues of a variable domain of a heavy chain variable domain of an antibody (including a V.sub.HH or a V.sub.H) are numbered according to the IMGT numbering (international ImMunoGeneTics information system). Hence, in the present description, aspects, claims and figures, the numbering according to IMGT as applied to V.sub.HH domains will be followed, unless indicated otherwise.
[0168] For a general description of heavy chain antibodies and the variable domains thereof, reference is inter alia made to the following references, which are mentioned as general background art: WO 94/04678, WO 95/04079 and WO 96/34103 of the Vrije Universiteit Brussel; WO 94/25591, WO 99/37681, WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301, EP 1134231 and WO 02/48193 of Unilever; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527 of the Vlaams lnstituut voor Biotechnologie (VIB); WO 03/050531 of Algonomics N.V. and Ablynx NV; WO 01/90190 by the National Research Council of Canada; WO 03/025020 (=EP 1 433 793) by the Institute of Antibodies; as well as WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863, WO 04/062551 by Ablynx NV and the further published patent applications by Ablynx NV; Hamers-Casterman et al., Nature 1993 Jun. 3; 363 (6428): 446-8; Davies and Riechmann, FEBS Lett. 1994 Feb. 21; 339(3): 285-90; Muyldermans et al., Protein Eng. 1994 September; 7(9): 1129-3; Davies and Riechmann, Biotechnology (NY) 1995 May; 13(5): 475-9; Gharoudi et al., 9th Forum of Applied Biotechnology, Med. Fac. Landbouw Univ. Gent. 1995; 60/4a part I: 2097-2100; Davies and Riechmann, Protein Eng. 1996 June; 9(6): 531-7; Desmyter et al., Nat Struct Biol. 1996 September; 3(9): 803-11; Sheriff et al., Nat Struct Biol. 1996 September; 3(9): 733-6; Spinelli et al., Nat Struct Biol. 1996 September; 3(9): 752-7; Arbabi Ghahroudi et al., FEBS Lett. 1997 Sep. 15; 414(3): 521-6; Vu et al., Mol. Immunol. 1997 November-December; 34(16-17): 1121-31; Atarhouch et al., Journal of Carvel Practice and Research 1997; 4: 177-182; Nguyen et al., J. Mol. Biol. 1998 Jan. 23; 275(3): 413-8; Lauwereys et al., EMBO J. 1998 Jul. 1; 17(13): 3512-20; Frenken et al., Res Immunol. 1998 July-August; 149(6):589-99; Transue et al., Proteins 1998 Sep. 1; 32(4): 515-22; Muyldermans and Lauwereys, J. Mol. Recognit. 1999 March-April; 12 (2): 131-40; van der Linden et al., Biochim. Biophys. Acta 1999 Apr. 12; 1431(1): 37-46; Decanniere et al., Structure Fold. Des. 1999 Apr. 15; 7(4): 361-70; Ngyuen et al., Mol. Immunol. 1999 June; 36(8): 515-24; Woolven et al., Immunogenetics 1999 October; 50 (1-2): 98-101; Riechmann and Muyldermans, J. Immunol. Methods 1999 Dec. 10; 231 (1-2): 25-38; Spinelli et al., Biochemistry 2000 Feb. 15; 39(6): 1217-22; Frenken et al., J. Biotechnol. 2000 Feb. 28; 78(1): 11-21; Nguyen et al., EMBO J. 2000 Mar. 1; 19(5): 921-30; van der Linden et al., J. Immunol. Methods 2000 Jun. 23; 240 (1-2): 185-95; Decanniere et al., J. Mol. Biol. 2000 Jun. 30; 300 (1): 83-91; van der Linden et al., J. Biotechnol. 2000 Jul. 14; 80(3): 261-70; Harmsen et al., Mol. Immunol. 2000 August; 37(10): 579-90; Perez et al., Biochemistry 2001 Jan. 9; 40(1): 74-83; Conrath et al., J. Biol. Chem. 2001 Mar. 9; 276 (10): 7346-50; Muyldermans et al., Trends Biochem Sci. 2001 April; 26(4):230-5; Muyldermans S., J. Biotechnol. 2001 June; 74 (4): 277-302; Desmyter et al., J. Biol. Chem. 2001 Jul. 13; 276 (28): 26285-90; Spinelli et al., J. Mol. Biol. 2001 Aug. 3; 311 (1): 123-9; Conrath et al., Antimicrob Agents Chemother. 2001 October; 45 (10): 2807-12; Decanniere et al., J. Mol. Biol. 2001 Oct. 26; 313(3): 473-8; Nguyen et al., Adv Immunol. 2001; 79: 261-96; Muruganandam et al., FASEB J. 2002 February; 16 (2): 240-2; Ewert et al., Biochemistry 2002 Mar. 19; 41 (11): 3628-36; Dumoulin et al., Protein Sci. 2002 March; 11 (3): 500-15; Cortez-Retamozo et al., Int. J. Cancer. 2002 Mar. 20; 98 (3): 456-62; Su et al., Mol. Biol. Evol. 2002 March; 19 (3): 205-15; van der Vaart J M., Methods Mol. Biol. 2002; 178: 359-66; Vranken et al., Biochemistry 2002 Jul. 9; 41 (27): 8570-9; Nguyen et al., Immunogenetics 2002 April; 54 (1): 39-47; Renisio et al., Proteins 2002 Jun. 1; 47 (4): 546-55; Desmyter et al., J. Biol. Chem. 2002 Jun. 28; 277 (26): 23645-50; Ledeboer et al., J. Dairy Sci. 2002 June; 85 (6): 1376-82; De Genst et al., J. Biol. Chem. 2002 Aug. 16; 277 (33): 29897-907; Ferrat et al., Biochem. J. 2002 Sep. 1; 366 (Pt 2): 415-22; Thomassen et al., Enzyme and Microbial Technol. 2002; 30: 273-8; Harmsen et al., Appl. Microbiol. Biotechnol. 2002 December; 60 (4): 449-54; Jobling et al., Nat. Biotechnol. 2003 January; 21 (1): 77-80; Conrath et al., Dev. Comp. Immunol. 2003 February; 27 (2): 87-103; Pleschberger et al., Bioconjug. Chem. 2003 March-April; 14 (2): 440-8; Lah et al., J. Biol. Chem. 2003 Apr. 18; 278 (16): 14101-11; Nguyen et al., Immunology. 2003 May; 109 (1): 93-101; Joosten et al., Microb. Cell Fact. 2003 Jan. 30; 2 (1): 1; Li et al., Proteins 2003 Jul. 1; 52 (1): 47-50; Loris et al., Biol. Chem. 2003 Jul. 25; 278 (30): 28252-7; van Koningsbruggen et al., J. Immunol. Methods. 2003 August; 279 (1-2): 149-61; Dumoulin et al., Nature. 2003 Aug. 14; 424 (6950): 783-8; Bond et al., J. Mol. Biol. 2003 Sep. 19; 332 (3): 643-55; Yau et al., J. Immunol. Methods. 2003 Oct. 1; 281 (1-2): 161-75; Dekker et al., J. Virol. 2003 November; 77 (22): 12132-9; Meddeb-Mouelhi et al., Toxicon. 2003 December; 42 (7): 785-91; Verheesen et al., Biochim. Biophys. Acta 2003 Dec. 5; 1624 (1-3): 21-8; Zhang et al., J Mol Biol. 2004 Jan. 2; 335 (1): 49-56; Stijlemans et al., J Biol. Chem. 2004 Jan. 9; 279 (2): 1256-61; Cortez-Retamozo et al., Cancer Res. 2004 Apr. 15; 64 (8): 2853-7; Spinelli et al., FEBS Lett. 2004 Apr. 23; 564 (1-2): 35-40; Pleschberger et al., Bioconjug. Chem. 2004 May-June; 15 (3): 664-71; Nicaise et al., Protein Sci. 2004 July; 13 (7): 1882-91; Omidfar et al., Tumour Biol. 2004 July-August; 25 (4): 179-87; Omidfar et al., Tumour Biol. 2004 September-December; 25(5-6): 296-305; Szynol et al., Antimicrob Agents Chemother. 2004 September; 48(9):3390-5; Saerens et al., J. Biol. Chem. 2004 Dec. 10; 279 (50): 51965-72; De Genst et al., J. Biol. Chem. 2004 Dec. 17; 279 (51): 53593-601; Dolk et al., Appl. Environ. Microbiol. 2005 January; 71(1): 442-50; Joosten et al., Appl Microbiol Biotechnol. 2005 January; 66(4): 384-92; Dumoulin et al., J. Mol. Biol. 2005 Feb. 25; 346 (3): 773-88; Yau et al., J Immunol Methods. 2005 February; 297 (1-2): 213-24; De Genst et al., J. Biol. Chem. 2005 Apr. 8; 280 (14): 14114-21; Huang et al., Eur. J. Hum. Genet. 2005 Apr. 13; Dolk et al., Proteins. 2005 May 15; 59 (3): 555-64; Bond et al., J. Mol. Biol. 2005 May 6; 348(3):699-709; Zarebski et al., J. Mol. Biol. 2005 Apr. 21.
[0169] Generally, it should be noted that the term heavy chain variable domain as used herein in its broadest sense is not limited to a specific biological source or to a specific method of preparation. For example, as will be discussed in more detail below, the heavy chain variable domains derived from heavy chain antibodies (i.e. V.sub.HH's) as disclosed herein can be obtained (1) by isolating the V.sub.HH domain of a naturally occurring heavy chain antibody; (2) by expression of a nucleotide sequence encoding a naturally occurring V.sub.HH domain; (3) by camelization (as described below) of a naturally occurring V.sub.H domain from any animal species, in particular a species of mammal, such as from a human being, or by expression of a nucleic acid encoding such a camelized V.sub.H domain; (4) by camelisation of a domain antibody or Dab as described by Ward et al (supra), or by expression of a nucleic acid encoding such a camelized V.sub.H domain (5) using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences; (6) by preparing a nucleic acid encoding a V.sub.HH using techniques for nucleic acid synthesis, followed by expression of the nucleic acid thus obtained; and/or (7) by any combination of the foregoing. Suitable methods and techniques for performing the foregoing will be clear to the skilled person based on the disclosure herein and for example include the methods and techniques described in more detail hereinbelow.
[0170] The term affinity, as used herein, refers to the degree to which a polypeptide, in particular an immunoglobulin, such as an antibody, or an immunoglobulin fragment, such as a V.sub.HH, binds to an antigen so as to shift the equilibrium of antigen and polypeptide toward the presence of a complex formed by their binding. Thus, for example, where an antigen and antibody (fragment) are combined in relatively equal concentration, an antibody (fragment) of high affinity will bind to the available antigen so as to shift the equilibrium toward high concentration of the resulting complex. The dissociation constant is commonly used to describe the affinity between the protein binding domain and the antigenic target. Typically, the dissociation constant is lower than 10.sup.5 M. Preferably, the dissociation constant is lower than 10.sup.6 M, more preferably, lower than 10.sup.7 M. Most preferably, the dissociation constant is lower than 10.sup.8 M, such as lower than 10.sup.9 M.
[0171] The terms specifically bind and specific binding, as used herein, generally refers to the ability of a polypeptide, in particular an immunoglobulin, such as an antibody, or an immunoglobulin fragment, such as a V.sub.HH or functional fragments thereof, to preferentially bind to a particular antigen that is present in a homogeneous mixture of different antigens. In certain embodiments, a specific binding interaction will discriminate between desirable and undesirable antigens in a sample, in some embodiments more than about 10 to 100-fold or more (e.g., more than about 1000- or 10,000-fold).
[0172] Accordingly, an amino acid sequence, in particular an antibody fragment, such as a V.sub.HH or functional fragments thereof, as disclosed herein is said to specifically bind to a particular target when that amino acid sequence has affinity for, specificity for and/or is specifically binding to that target (or for at least one part or fragment thereof).
[0173] An amino acid sequence, in particular an antibody fragment, such as a V.sub.HH or functional fragments thereof, as disclosed herein is said to be specific for a first target antigen of interest as opposed to a second target antigen of interest when it binds to the first target antigen of interest with an affinity that is at least 5 times, such as at least 10 times, such as at least 100 times, and preferably at least 1000 times higher than the affinity with which that amino acid sequence as disclosed herein binds to the second target antigen of interest. Accordingly, in certain embodiments, when an amino acid sequence as disclosed herein is said to be specific for a first target antigen of interest as opposed to a second target antigen of interest, it may specifically bind to (as defined herein) the first target antigen of interest, but not to the second target antigen of interest.
[0174] The specificity of an amino acid sequence, in particular an antibody fragment, such as a V.sub.HH, or functional fragments thereof as disclosed herein can be determined based on affinity and/or avidity. The affinity of an amino acid sequence as disclosed herein is represented by the equilibrium constant for the dissociation of the amino acid sequence as disclosed herein and the target protein of interest to which it binds. The lower the KD value, the stronger the binding strength between the amino acid sequence as disclosed herein and the target protein of interest to which it binds. Alternatively, the affinity can also be expressed in terms of the affinity constant (KA), which corresponds to 1/KD. The binding affinity of an amino acid sequence as disclosed herein can be determined in a manner known to the skilled person, depending on the specific target protein of interest.
[0175] The avidity of an amino acid sequence as disclosed herein is the measure of the strength of binding between the amino acid sequence as disclosed herein and the pertinent target protein of interest. Avidity is related to both the affinity between a binding site on the target protein of interest and a binding site on the amino acid sequence as disclosed herein and the number of pertinent binding sites present on the amino acid sequence as disclosed herein. Typically, the amino acid sequences as disclosed herein will bind to a target protein of interest with a dissociation constant (KD) of less than about 1 micromolar (1 M), and preferably less than about 1 nanomolar (1 nM) [i.e., with an association constant (KA) of about 1,000,000 per molar (10.sup.6 M.sup.1, 1E6 /M) or more and preferably about 1,000,000,000 per molar (10.sup.9 M.sup.1, 1E9 /M) or more]. A KD value greater than about 1 millimolar is generally considered to indicate non-binding or non-specific binding. It is generally known in the art that the KD can also be expressed as the ratio of the dissociation rate constant of a complex, denoted as kOff (expressed in seconds.sup.1 or s.sup.1), to the rate constant of its association, denoted kOn (expressed in molar.sup.1 seconds.sup.1 or M.sup.1 s.sup.1). In particular, an amino acid sequence as disclosed herein will bind to the target protein of interest with a kOff ranging between 0.1 and 0.0001s.sup.1 and/or a kOn ranging between 1,000 and 1,000,000 M.sup.1 s.sup.1. Binding affinities, kOff and kOn rates may be determined by means of methods known to the person skilled in the art, for example ELISA methods, isothermal titration calorimetry, surface plasmon resonance, fluorescence-activated cell sorting analysis, and the more.
[0176] An amino acid sequence, in particular an antibody fragment, such as a V.sub.HH, as disclosed herein is considered to be (in) essentially isolated (form) as used herein, when it has been extracted or purified from the host cell and/or medium in which it is produced.
[0177] In respect of the amino acid sequences, in particular antibody fragments, such as a V.sub.HH's or functional fragments thereof, as disclosed herein, the terms binding region, binding site or interaction site present on the amino acid sequences as disclosed herein shall herein have the meaning of a particular site, part, domain or stretch of amino acid residues present on the amino acid sequence as disclosed herein that is responsible for binding to a target molecule. Such binding region essentially consists of specific amino acid residues from the amino acid sequence as disclosed herein which are in contact with the target molecule.
[0178] The half-life of an amino acid sequence, in particular an antibody fragment, such as a V.sub.HH or functional fragments thereof, as disclosed herein can generally be defined as the time that is needed for the in vivo serum concentration of the amino acid sequence as disclosed herein to be reduced by 50%. The in vivo half-life of an amino acid sequence as disclosed herein can be determined in any manner known to the person skilled in the art, such as by pharmacokinetic analysis. As will be clear to the skilled person, the half-life can be expressed using parameters such as the t1/2-alpha, t1/2-beta and the area under the curve (AUC). An increased half-life in vivo is generally characterized by an increase in one or more and preferably in all three of the parameters t1/2-alpha, t1/2-beta and the area under the curve (AUC).
[0179] Aptamers that bind specifically to the biomarker of the invention can be obtained using the so called SELEX or Systematic Evolution of Ligands by EXponential enrichment. In this system, multiple rounds of selection and amplification can be used to select for DNA or RNA molecules with high specificity for a target of choice, developed by Larry Gold and coworkers and described in U.S. Pat. No. 6,329,145. Recently a more refined method of designing co-called photoaptamers with even higher specificity has been described in U.S. Pat. No. 6,458,539 by the group of Larry Gold.
[0180] Methods of identifying binding agents such as interacting proteins and small molecules are also known in the art. Examples are two-hybrid analysis, immunoprecipitation methods and the like.
[0181] In addition, the invention also provides tools and methods for the identification of binding molecules, such as peptides or small molecules, monoclonal- or polyclonal antibodies, nanobodies, affibodies, minibodies, diabodies, single chain antibodies, antibody fragments, aptamers, photoaptamers, lipocalins, specifically interacting small molecules, Molecular Imprinting Polymers (MIPs), DARPins, ankyrins, specifically interacting proteins or peptides, and other molecules that specifically bind to the biomarker, e.g. using cells or cell-lines that do or do not express DPP6-K.
[0182] To this end, the invention provides several cells and/or cell-lines (rodent pancreatic islets, rat INS-1E, cells and the human beta cell line EndoC-BH1) that are DPP6-K positive and two cell-lines (human PANC-1 and CAPAN-2 cells) that are DPP6-K negative. These cells or cell-lines can be used to screen for binding agents or compounds that specifically bind to cells positive for DPP6-K, but not to cells negative for DPP6-K in order to identify new tracer molecules for visualization of beta-cells e.g. in PET, PET-CT or SPECT analysis.
[0183] The invention further provides methods for preparing or generating V.sub.HH domain sequences or functional fragments thereof specifically binding to the extracellular domain of DPP6-K, as well as methods for producing nucleic acids encoding these and host cells, products and compositions comprising these heavy chain variable domain sequences. Some preferred but non-limiting examples of such methods will become clear from the further description herein.
[0184] As will be clear to the skilled person, one particularly useful method for preparing heavy chain variable domain sequences as disclosed herein generally comprises the steps of:
[0185] (a) expressing a nucleotide sequence encoding a heavy chain variable domain sequence as disclosed herein or a vector or genetic construct a nucleotide sequence encoding that heavy chain variable domain sequence and
[0186] (b) optionally isolating and/or purifying the heavy chain variable domain sequence.
[0187] In particular embodiments envisaged herein, the heavy chain variable domain sequences specifically binding to the extracellular domain of DPP6-K can be obtained by methods which involve generating a random library of V.sub.HH sequences and screening this library for an V.sub.HH sequence capable of specifically binding to the extracellular domain of DPP6-K.
[0188] Accordingly, in particular embodiments, methods for preparing a heavy chain variable domain sequence as disclosed herein comprise the steps of [0189] a) providing a set, collection or library of amino acid sequences of V.sub.HH domains; and [0190] b) screening said set, collection or library of V.sub.HH domains for amino acid sequences that can bind to and/or have affinity for the extracellular domain of DPP6-K. [0191] and
c) isolating the V.sub.HH domains that can bind to and/or have affinity for the extracellular domain of DPP6-K.
[0192] In such a method, the set, collection or library of V.sub.HH sequences may be any suitable set, collection or library of amino acid sequences. For example, the set, collection or library of V.sub.HHs sequences may be a set, collection or library of immunoglobulin fragment sequences (as described herein), such as a nave set, collection or library of immunoglobulin fragment sequences; a synthetic or semi-synthetic set, collection or library of immunoglobulin fragment sequences; and/or a set, collection or library of immunoglobulin fragment sequences that have been subjected to affinity maturation.
[0193] In particular embodiments of this method, the set, collection or library of V.sub.HH sequences may be an immune set, collection or library of immunoglobulin fragment sequences, for example derived from a mammal that has been suitably immunized with the extracellular domain of DPP6 or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof. In one particular aspect, said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
[0194] In the above methods, the set, collection or library of V.sub.HH sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening. Suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005).
[0195] In other embodiments, the methods for generating the heavy chain variable domain sequences as disclosed herein comprises at least the steps of: [0196] a) providing a collection or sample of cells expressing V.sub.HH domain amino acid sequences; [0197] b) screening said collection or sample of cells for cells that express a V.sub.HH amino acid sequence that can bind to and/or have affinity for the extracellular domain of DPP6-K;
and [0198] c) either (i) isolating said amino acid sequence; or (ii) isolating from said cell a nucleic acid sequence that encodes said amino acid sequence, followed by expressing said amino acid sequence.
[0199] The collection or sample of cells may for example be a collection or sample of B-cells. Also, in this method, the sample of cells may be derived from a mammal that has been suitably immunized with the extracellular domain of DPP6or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof. In one particular embodiment, the antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
[0200] In other embodiments, the method for generating a heavy chain variable domain sequence specifically binding to the extracellular domain of DPP6-K, may comprise at least the steps of: [0201] a) providing a set, collection or library of nucleic acid sequences encoding a V.sub.HH domain amino acid sequence; [0202] b) screening said set, collection or library of nucleic acid sequences for nucleic acid sequences that encode a V.sub.HH amino acid sequence that can bind to and/or has affinity for the extracellular domain of DPP6-K;
and [0203] c) isolating said nucleic acid sequence, followed by expressing said amino acid sequence.
[0204] In the above methods, the set, collection or library of nucleic acid sequences encoding amino acid sequences may for example be a set, collection or library of nucleic acid sequences encoding a nave set, collection or library of immunoglobulin fragment sequences; a set, collection or library of nucleic acid sequences encoding a synthetic or semi-synthetic set, collection or library of immunoglobulin fragment sequences; and/or a set, collection or library of nucleic acid sequences encoding a set, collection or library of immunoglobulin fragment sequences that have been subjected to affinity maturation.
[0205] In particular, in such a method, the set, collection or library of nucleic acid sequences encodes a set, collection or library of V.sub.HH domains specifically binding to the extracellular domain of DPP6-K.
[0206] In the above methods, the set, collection or library of nucleotide sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening. Suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) nucleotide sequences encoding amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005).
[0207] The invention also relates to V.sub.HH sequences that are obtainable or obtained by the above methods, or alternatively by a method that comprises one of the above methods and in addition at least the steps of determining the nucleotide sequence or amino acid sequence of said V.sub.HH sequence; and of expressing or synthesizing said V.sub.HH sequence in a manner known per se, such as by expression in a suitable host cell or host organism or by chemical synthesis.
[0208] In some cases, the methods for producing the V.sub.HH amino acid sequences binding specifically to the extracellular domain of DPP6-K as envisaged herein may further comprise the step of isolating from the amino acid sequence library at least one V.sub.HH domain having detectable binding affinity for, or detectable in vitro effect on DPP6-K.
[0209] These methods may further comprise the step of amplifying a sequence encoding at least one V.sub.HH domain having detectable binding affinity for, or detectable in vitro effect on the activity of DPP6-K. For example, a phage clone displaying a particular amino acid sequence, obtained from a selection step of a method described herein, may be amplified by reinfection of a host bacteria and incubation in a growth medium.
[0210] In particular embodiments, these methods may encompass determining the sequence of the one or more amino acid sequences capable of binding to the extracellular domain of DPP6-K.
[0211] Where a heavy chain variable domain sequence, comprised in a set, collection or library of amino acid sequences, is displayed on a suitable cell or phage or particle, it is possible to isolate from said cell or phage or particle, the nucleotide sequence that encodes that amino acid sequence. In this way, the nucleotide sequence of the selected amino acid sequence library member(s) can be determined by a routine sequencing method.
[0212] In further particular embodiments, the methods for producing a V.sub.HH domain as envisaged herein comprise the step of expressing said nucleotide sequence(s) in a host organism under suitable conditions, so as to obtain the actual desired amino acid sequence. This step can be performed by methods known to the person skilled in the art.
[0213] In addition, the obtained V.sub.HH domain sequences having detectable binding affinity for, or detectable in vitro effect on the activity of DPP6-K, may be synthesized as soluble protein construct, optionally after their sequence has been identified.
[0214] For instance, the V.sub.HH domain sequences obtained, obtainable or selected by the above methods can be synthesized using recombinant or chemical synthesis methods known in the art. Also, the amino acid sequences obtained, obtainable or selected by the above methods can be produced by genetic engineering techniques. Thus, methods for synthesizing the V.sub.HH sequences obtained, obtainable or selected by the above methods may comprise transforming or infecting a host cell with a nucleic acid or a vector encoding an amino acid sequence having detectable binding affinity for, or detectable in vitro effect on the activity of DPP6-K. Accordingly, the V.sub.HH sequences having detectable binding affinity for, or detectable in vitro effect on the activity of DPP6-K can be made by recombinant DNA methods. DNA encoding the amino acid sequences can be readily synthesized using conventional procedures. Once prepared, the DNA can be introduced into expression vectors, which can then be transformed or transfected into host cells such as E. coli or any suitable expression system, in order to obtain the expression of amino acid sequences in the recombinant host cells and/or in the medium in which these recombinant host cells reside.
[0215] It should be understood, as known by someone skilled in the art of protein expression and purification, that the V.sub.HH domain produced from an expression vector using a suitable expression system may be tagged (typically at the N-terminal or C-terminal end of the amino acid sequence) with e.g. a His-tag or other sequence tag for easy purification.
[0216] Transformation or transfection of nucleic acids or vectors into host cells may be accomplished by a variety of means known to the person skilled in the art including calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, lipofection, protoplast fusion, retroviral infection, and biolistics.
[0217] Suitable host cells for the expression of the desired heavy chain variable domain sequences may be any eukaryotic or prokaryotic cell (e.g., bacterial cells such as E. coli, yeast cells, mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo. For example, host cells may be located in a transgenic plant.
[0218] Thus, the application also provides methods for the production of V.sub.HH domain sequences having detectable binding affinity for, or detectable in vitro effect on the activity of DPP6-K comprising transforming, transfecting or infecting a host cell with nucleic acid sequences or vectors encoding such V.sub.HH sequences and expressing their amino acid sequences under suitable conditions.
[0219] In yet another embodiment, the invention further provides methods for the manufacture (or the production of which is equivalent wording) a pharmaceutical composition as disclosed herein.
[0220] In particular embodiments, the invention provides methods for producing a pharmaceutical composition as disclosed herein, at least comprising the steps of: [0221] obtaining at least one V.sub.HH or a functional fragment thereof, which specifically binds to DPP6-K, and [0222] formulating said V.sub.HH or functional fragment thereof in a pharmaceutical composition.
[0223] In particular embodiments of these methods, the step of obtaining at least one heavy chain variable domain or functional fragment thereof, which specifically binds to DPP6-K comprises:
[0224] (a) expressing a nucleotide sequence encoding a V.sub.HH or functional fragment thereof, which specifically binds to DPP6-K, and optionally
[0225] (b) isolating and/or purifying the V.sub.HH or functional fragment thereof.
[0226] In other particular embodiments of these methods, the step of obtaining at least one V.sub.HH or functional fragment thereof, which specifically binds to DPP6-K comprises: [0227] a) providing a set, collection or library of V.sub.HH domain sequences or functional fragments of V.sub.HH sequences; [0228] b) screening said set, collection or library of V.sub.HH domain sequences or sequences of functional fragments thereof for sequences that specifically bind to and/or have affinity for DPP6-K, and [0229] c) optionally isolating the V.sub.HH sequences or sequences of functional fragments thereof that specifically bind to and/or have affinity for DPP6-K.
[0230] In certain aspects, the V.sub.HH domains or functional fragments thereof specifically binding to DPP6-K as disclosed herein may be optionally linked to one or more further groups, moieties, or residues via one or more linkers. These one or more further groups, moieties or residues can serve for binding to other targets of interest. It should be clear that such further groups, residues, moieties and/or binding sites may or may not provide further functionality to the heavy chain variable domains as disclosed herein and may or may not modify the properties of the heavy chain variable domain as disclosed herein. Such groups, residues, moieties or binding units may also for example be chemical groups which can be biologically active.
[0231] These groups, moieties or residues are, in particular embodiments, linked N- or C-terminally to the heavy chain variable domain, in particularly C-terminally linked.
[0232] In particular embodiments, the V.sub.HH domains or functional fragments thereof specifically binding to DPP6-K as disclosed herein may also have been chemically modified. For example, such a modification may involve the introduction or linkage of one or more functional groups, residues or moieties into or onto the heavy chain variable domain.
[0233] These groups, residues or moieties may confer one or more desired properties or functionalities to the heavy chain variable domain. Examples of such functional groups will be clear to the skilled person.
[0234] For example, the introduction or linkage of such functional groups to a heavy chain variable domain can result in an increase in the solubility and/or the stability of the heavy chain variable domain, in a reduction of the toxicity of the heavy chain variable domain, or in the elimination or attenuation of any undesirable side effects of the heavy chain variable domain, and/or in other advantageous properties.
[0235] In particular embodiments, the one or more groups, residues, moieties are linked to the heavy chain variable domain via one or more suitable linkers or spacers.
[0236] While the V.sub.HH domains specifically binding to DPP6-K as disclosed herein are preferably in monomeric form (as further described herein), in particular alternative embodiments, two or more of the V.sub.HH domains or functional fragments thereof, specifically binding to DPP6-K as disclosed herein may be linked to each other or may be interconnected. In particular embodiments, the two or more heavy chain variable domains or functional fragments thereof are linked to each other via one or more suitable linkers or spacers. Suitable spacers or linkers for use in the coupling of different heavy chain variable domains as disclosed herein will be clear to the skilled person and may generally be any linker or spacer used in the art to link peptides and/or proteins.
[0237] Some particularly suitable linkers or spacers include for example, but are not limited to, polypeptide linkers such as glycine linkers, serine linkers, mixed glycine/serine linkers, glycine- and serine-rich linkers or linkers composed of largely polar polypeptide fragments, or homo- or heterobifunctional chemical crosslinking compounds such as glutaraldehyde or, optionally PEG-spaced, maleimides or NHS esters.
[0238] For example, a polypeptide linker or spacer may be a suitable amino acid sequence having a length between 1 and 50 amino acids, such as between 1 and 30, and in particular between 1 and 10 amino acid residues. It should be clear that the length, the degree of flexibility and/or other properties of the linker(s) may have some influence on the properties of the heavy chain variable domains, including but not limited to the affinity, specificity or avidity for the fungal target. It should be clear that when two or more linkers are used, these linkers may be the same or different. In the context and disclosure of the present invention, the person skilled in the art will be able to determine the optimal linkers for the purpose of coupling heavy chain variable domains as disclosed herein without any undue experimental burden.
[0239] The present invention also encompasses parts, fragments, analogs, mutants, variants, and/or derivatives of the radiolabelled V.sub.HH domains specifically binding to of DPP6-K as disclosed herein and/or polypeptides comprising or essentially consisting of one or more of such parts, fragments, analogs, mutants, variants, and/or derivatives, as long as these parts, fragments, analogs, mutants, variants, and/or derivatives are suitable for the purposes envisaged herein.
[0240] Such parts, fragments, analogs, mutants, variants, and/or derivatives according to the invention are still capable of specifically binding to DPP6-K.
[0241] For example, the invention provides a number of stretches of amino acid residues (i.e. small peptides), also referred to herein as CDR sequences of the V.sub.HH's as disclosed herein, that are particularly suited for binding to DPP6-K. These stretches may be regarded as being functional fragments of the V.sub.HH's as disclosed herein and may be present in, and/or may be incorporated into any suitable scaffold (protein), such as but not limited to the V.sub.HH's as disclosed herein, in particular in such a way that they form (part of) the antigen binding site of that suitable scaffold or V.sub.HH. It should however be noted that the invention in its broadest sense is not limited to a specific structural role or function that these stretches of amino acid residues may have in the scaffolds or V.sub.HH's as disclosed herein, as long as these stretches of amino acid residues allow these scaffolds or V.sub.HH's as disclosed herein to specifically bind to DPP6-K.
[0242] In a further aspect, the present invention provides nucleic acid sequences encoding the V.sub.HH domain amino acid sequences in the compositions as disclosed herein (or suitable fragments thereof). These nucleic acid sequences can also be in the form of a vector or a genetic construct or polynucleotide. The nucleic acid sequences as disclosed herein may be synthetic or semi-synthetic sequences, nucleotide sequences that have been isolated from a library (and in particular, an expression library), nucleotide sequences that have been prepared by PCR using overlapping primers, or nucleotide sequences that have been prepared using techniques for DNA synthesis known per se.
[0243] The genetic constructs as disclosed herein may be DNA or RNA, and are preferably double-stranded DNA. The genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism. For instance, the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon. In particular, the vector may be an expression vector, i.e., a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system).
[0244] Accordingly, in another further aspect, the present invention also provides vectors comprising one or more nucleic acid sequences as disclosed herein.
[0245] In still a further aspect, the present invention provides hosts or host cells that express or are capable of expressing one or more amino acid sequences as disclosed herein. Suitable examples of hosts or host cells for expression of the V.sub.HH sequences, polypeptides of the invention will be clear to the skilled person.
[0246] In a further aspect, the present invention provides polypeptides (also referred to herein as polypeptides as disclosed herein) that comprise or essentially consist of at least one V.sub.HH sequence of the present invention that specifically binds to DPP6-K. The polypeptides of the invention may comprise at least one V.sub.HH or functional fragments thereof as disclosed herein and optionally one or more further groups, moieties, residues optionally linked via one or more linkers.
[0247] In particularly preferred embodiments, the present invention provides polypeptides and pharmaceutical compositions comprising a V.sub.HH domain in its monomeric form, i.e. comprising only one V.sub.HH domain so as to minimize the in vivo half-life of said polypeptides and pharmaceutical compositions as much as possible.
[0248] In alternative embodiments, however the present invention also provides polypeptides and pharmaceutical compositions comprising two or more identical or different V.sub.HH domains resulting in a bivalent (or multivalent) or a bispecific or (multispecific) polypeptide.
[0249] The polypeptides as disclosed herein may at least contain one or more further groups, moieties or residues for binding to other targets or target proteins of interest. It should be clear that such further groups, residues, moieties and/or binding sites may or may not provide further functionality to the amino acid sequences as disclosed herein (and/or to the polypeptide or composition in which it is present) and may or may not modify the properties of the amino acid sequence as disclosed herein. Such groups, residues, moieties or binding units may also for example be chemical groups which can be biologically and/or pharmacologically active.
[0250] These groups, moieties or residues are, in particular embodiments, linked N- or C-terminally to the amino acid sequence as disclosed herein.
[0251] It should be noted that the invention is not limited as to the origin of the V.sub.HH sequences or functional fragments thereof, polypeptides or compositions of the invention (or of the nucleotide sequences of the invention used to express them). Furthermore, the present invention is also not limited as to the way that the V.sub.HH sequences, polypeptides or nucleotide sequences as disclosed herein have been generated or obtained. Thus, the amino acid sequences as disclosed herein may be synthetic or semi-synthetic amino acid sequences, polypeptides or proteins.
[0252] The amino acid sequences, polypeptides and compositions provided by the invention can be in essentially isolated form (as defined herein), or alternatively can form part of a polypeptide or composition as disclosed herein, which may comprise or essentially consist of at least one amino acid sequence as disclosed herein and which may optionally further comprise one or more other groups, moieties or residues (all optionally linked via one or more suitable linkers).
[0253] In one such aspect, the invention provides a method for identifying new tracer molecules that specifically bind DPP6-K positive cells comprising the steps of:
[0254] a) contacting the candidate tracer molecule with a cell-type or cell-line positive for DPP6-K and measure the interaction between the candidate tracer molecule and the cells;
[0255] b) contacting the candidate tracer molecule with a cell-type or cell-line negative for DPP6-K and measure the interaction between the candidate tracer molecule and the cells;
[0256] c) wherein these candidate tracer molecules that bind the cells of step a) but not the cells of step b) are retained as beta-cell-mass tracer molecules. In a preferred embodiment of said method, the cell-type or cell-line positive for DPP6-K is selected from the group comprising: rodent pancreatic islets, rat INS-1E cells and the human beta cell line EndoC-BH1; and the cell-type or cell-line negative for DPP6-K are PANC-1 or CAPAN-2.
[0257] The invention further provides kits for identifying new tracer molecules that specifically bind DPP6-K positive cells comprising two cell types or cell-lines, one being a cell-type or cell-line positive for DPP6-K and one being a cell-type or cell-line negative for DPP6-K. In a preferred embodiment, the DPP6-K positive cell-type or cell-line is selected from the group comprising: rodent pancreatic islets, rat INS-1E cells and the human beta cell line EndoC-BH1; and the DPP6-K negative cell-types or cell-lines are PANC-1 or CAPAN-2.
[0258] In addition to the use of cell-lines, biochemical binding assays known in the art using the DPP6-K biomarker as a target can also be used.
[0259] The term label includes all suitable isotopic labels for use in PET, PET-CT or SPECT analysis, labels suitable for specific extraction such as magnetic or paramagnetic beads, labels suitable for diagnosis in vitro such as fluorescent dyes or other luminescent labels, known in the art.
[0260] The term beta cell related disorder described in the methods or uses or kits of the invention encompasses all disorders related to beta cells such as: type 1 diabetes mellitus (T1D), type 2 diabetes mellitus (T2D), hyperinsulinemia, obesity, neuroendocrine tumors or occurrence of insulinoma.
[0261] Additionally, the biomarker of the invention can also be used in in-vitro methods for the analysis of the amount or characteristics of beta cells in a cell culture, either obtained from a biopsy or from a cell-line derived culture. Beta cell specific markers of the invention can further be used to characterize the differentiation state of cells such as modified stem cells, differentiated in vitro as beta cells.
[0262] The invention further provides a method for in vivo diagnosis of beta cell deficiency in a subject comprising the steps of:
[0263] a) creating an expression matrix by constructing features on a computer from in vivo measurements obtained from a reference pool of healthy subjects, wherein the expression matrix comprises the expression data of the DPP6-K biomarker;
[0264] b) storing the expression data of the DPP6-Kin said reference pool;
[0265] c) determining the in vivo expression of DPP6-K in the pancreas of the subject to be diagnosed;
[0266] d) comparing the expression data obtained in step c) with the expression data obtained in step (b)
[0267] e) determining whether there is a deviation of the DPP6-K expression in the subject to be diagnosed, compared to the expression of DPP6-K in the reference pool of healthy subjects, wherein a decrease in DPP6-K expression in the subject as compared to the expression in the reference pool of healthy subjects is indicative for beta cell deficiency.
[0268] The invention further provides a method for in vivo diagnosis of beta cell deficiency in a subject comprising the steps of:
[0269] a) creating an expression matrix by constructing features on a computer from in vivo measurements obtained from a reference pool of subjects having a condition related to beta cell deficiency, wherein the expression matrix comprises the expression data of the DPP6-K biomarker;
[0270] b) storing the expression data of the DPP6-K in said reference pool;
[0271] c) determining the in vivo expression of DPP6-K in the pancreas of the subject to be diagnosed;
[0272] d) comparing the expression data obtained in step c) with the expression data obtained in step (b);
[0273] e) determining whether there is a deviation of the DPP6-K expression in the subject to be diagnosed, compared to the expression of DPP6-K in the reference pool of subjects having a condition related to beta cell deficiency, wherein no deviation in DPP6-K expression in the subject as compared to the expression in the reference pool of subjects having a condition related to beta cell deficiency is indicative for said beta cell deficiency.
[0274] In a further aspect the invention relates to a system comprising: [0275] a computer data repository that comprises a reference value of the quantity of DPP6-K in a pool of subjects representing a known diagnosis, prediction and/or prognosis of beta cell deficiency; and [0276] a computer system programmed to access the data repository and to use information from the data repository in combination with information on the quantity of DPP6-K in a subject under diagnosis to make a diagnosis, prediction and/or prognosis of beta cell deficiency in said subject.
[0277] Related embodiments of the invention concern a method for making diagnosis, prediction and/or prognosis of beta cell deficiency in a subject comprising: [0278] (i) receiving data representative of values of the in vivo pancreatic quantity of DPP6-K from a subject; [0279] (ii) accessing a data repository on a computer, said data repository comprising a reference value of the in vivo pancreatic quantity of DPP6-K , said reference value representing a known diagnosis, prediction and/or prognosis of beta cell dysfunction; and [0280] (iii) comparing the data as received in (i) with the reference value in the data repository on the computer, thereby making a diagnosis, prediction and/or prognosis of beta cell dysfunction in the subject.
[0281] In certain embodiments, the determination of what action is to be taken, e.g., by a clinician, in view of said diagnosis, prediction and/or prognosis is performed by a (the) computer. In certain embodiments, a (the) computer reports (i.e., generates an electronic report of) the action to be taken, preferably substantially in real time.
[0282] In certain embodiments, the invention relates to a method for treating beta cell dysfunction in a subject in need of said treatment, the method comprising the steps of:
[0283] (i) in vivo measurement of the quantity of DPP6-K in the pancreas of the subject;
[0284] (ii) comparing the quantity of DPP6-K as measured in (i) with a reference value of the quantity of DPP6-K, said reference value representing a known diagnosis, prediction and/or prognosis of beta cell dysfunction;
[0285] (iii) finding a deviation or no deviation of the quantity of DPP6-K as measured in (i) from the reference value;
[0286] (iv) attributing said finding of deviation or no deviation to a particular diagnosis, prediction and/or prognosis of beta cell dysfunction in the subject;
[0287] (v) inferring from said particular diagnosis, prediction and/or prognosis of beta cell dysfunction in the subject the presence or absence of a need for a therapeutic or prophylactic treatment of beta cell dysfunction in the subject; and
[0288] (vi) subjecting the subject to a therapeutic or prophylactic treatment of beta cell dysfunction when the subject is in need of said treatment.
[0289] Illustrative therapeutic and prophylactic treatment of beta cell dysfunction, e.g. diabetes can encompass one or more of the following: the regular administration of insulin, the physiological control of glycemia, the normalization of glycemia, to restore insulin secretion in vivo from cells. Several strategies for said in vivo restoration have been proposed: xenotransplantation of insulin-producing cells from animals, in vitro differentiation of isolated stem cells into insulin-secreting cells and re-implantation thereof in the patient or allotransplantation of isolated pancreatic islets from another subject.
[0290] The invention is illustrated by the following non-limiting examples
EXAMPLES
Example 1
Selection Strategy for the Identification of Beta Cell Specific Plasma Membrane Proteins and Validation of the Islet Specific Expression of the Selected Biomarkers
[0291] Material and Methods
[0292] Ethical Statements
[0293] Human pancreatic islet collection and handling were approved by the local Ethical Committee in Pisa, Italy and performed as previously described (1). Female SCID CB-17/Icr-Prkdcscid/Rj mice (Janvier labs, Le Genest-Saint-Isle, France), were used according to the rules of the Belgian regulations for animal care, with approval by the Ethical Committee for Animal Experiments of the ULB, Brussels, Belgium.
[0294] Cell Culturing, Generation of DPP6 Overexpressing Cells and Cytokine Exposure
[0295] To generate DPP6 overexpressing cells the Chinese Hamster Ovary (CHO) cells (ATCC, Manassas, USA) were selected for these experiments, as they do not express Human DPP6. CHO cells were cultured in Ham's F-12 Nutrient mix+GlutaMax, supplemented with Penicillin-Streptomycin and 5% Fetal Bovine Serum (FBS) all from (ThermoFisher Scientific, Aalst, Belgium), at 37 C., 5% CO2. To induce transient DPP6 overexpression 0.8-110.sup.5 CHO cells were transfected with a pCMV6 vector containing the HumanDPP6-001-sp3 variant, catalogue number SC310075 (Origene, Rockville, USA), construct and the transfection was confirmed by-galactosidase staining, with 60-70% positive cells (K1465-01) (ThermoFisher Scientific). The transfection was performed overnight with Lipofectamine 2000 (2 l/1 g vector) in Opti-MEM media without FBS (ThermoFisher Scientific), and the media was replaced with Ham's culture medium (same as above) in the subsequent day.
[0296] Clonal human insulin-producing EndoC-H1 cells (2) and human pancreatic islets were cultured as described previously (3). To determine if the expression of DPP6 is affected by inflammatory mediators, EndoC-H1 cells or human pancreatic islets were exposed to recombinant human interleukin (IL)-1 (R&D Systems, Abingdon, U.K.) at 50 units/mL; and human IFN- (PeproTech, Rocky Hill, USA) at 1,000 units/mL for 48 hours (4).
[0297] mRNA Expression
[0298] mRNA extraction, reverse transcription and quantitative PCR (qPCR) were performed as described previously (5). Briefly, poly(A)+ mRNA was isolated from 50-100 human pancreatic islets or from 1105 EndoC-H1 cells, using the Dynabeads mRNA DIRECT kit (ThermoFisher Scientific). qPCR amplification of Dipeptidyl-Peptidase 6 (DPP6) was performed using IQ SyBR Green Supermix on iCycler MyiQ Single Color (BIO-RAD, Hercules, USA) and compared to a standard curve; Beta-actin (ACTB) was used as a reference (housekeeping) gene. To compare the EndoC-H1 cells and the human pancreatic islets to other tissues we used cDNA from 14 human normal tissues (BioChain, San Francisco, Calif., USA). Primers for qPCR were: Human DPP6 forward: 5-ACAGTGAGACTGTGGAATGTTGA-3 (SEQ ID NO. 4), reverse: 5-GAGGATCCCCATGAGGAATTTTG-3 (SEQ ID NO. 5), (yielding a 199bp fragment); human actin (ACTB) forward: 5-GCCTGGAGAAACCTGCCAAGTATGA-3 (SEQ ID NO. 6), reverse: 5-AACCTGGTCCTCAGTGTAGCCC-3 (SEQ ID NO. 7) (yielding a 101bp fragment);
[0299] Western Blot
[0300] 1105 EndoC-H1 cells were collected with Laemmli buffer, loaded on an 8% SDS-PAGE gel and transferred to a nitrocellulose membrane. Immunoblot analyses was performed after 1 hour blocking in 5% dry milk powder with a DPP6 monoclonal antibody (mAb), diluted 1:1000, ab198506 (Abcam, Cambridge, UK); alpha-Tubulin mAb, diluted 1:5000, T5168, (Sigma-Aldrich, Schnelldorf, Germany) was used as a reference protein. The secondary anti-rabbit and anti-mouse mAb-HRP (catalogue numbers: 715-036-150 and 711-036-152 (Jackson ImmunoResearch Laboratories, Inc., West Grove, USA) were used at a dilution of 1:10000, the membranes were developed with SuperSignal West Femto Maximum Sensitivity Substrate (ThermoFisher Scientific) and the images were acquired with Chemidoc XRS+ (BIO-RAD). Densitometric analyses were performed with Image studio Lite v5.0 (Li-Cor Biotechnology, Lincoln, USA).
[0301] Humanized Mouse Models of Beta Cells
[0302] Female SCID CB-17 mice were transplanted with human insulin-producing EndoC-H1 cells as described (7). These mice accept well xenotransplants (8; 9); in addition to this, the SCID CB-17 lack B-cells, providing a more favorable environment for the tumor to grow (10). The SCID CB-17-EndoC-H1 model displayed a modest decrease in their glycemic levels, and their hypoglycemia could be prevented by glucose-supplemented water (see below) for long enough to perform the imaging. At the day of inoculation, 4-6106 EndoC-H1 cells were seeded on a rubber toric joint (EFJM, St Lubin des
[0303] Joncherets, France) with Matrigel HC (Corning, New York, USA) supplemented with MmVEGF-164 (1 ng/ml) (BioLegend, San Diego, USA). The cell-containing or empty ring (negative control for imaging; see below) were then inserted into the fascia in the biceps or quadriceps femoris muscle. The mice were also operated on the left side, where the vehicle rubber ring, with Matrigel and MmVEGF-164 but without cells, was inserted. For the surgery, the mice were anesthetized with isoflurane (AbbVie SA, Wavre, Belgium). After the procedure they received both short-term analgesic (Buprenorphine 0.1 mg/kg, Reckitt Benckiser AG, Wallisellen, Switzerland) and long-term analgesic (Acetaminophen supplemented water (3 mg/ml) (Bristol-Myers Squibb, Chausse de La Hulpe, Belgium)) for consecutive 10 days. Random glycemia was measured with ACCU-CHEK Nano glucometer (ROCHE, Basel, Switzerland) every second week until the tumor was palpable; thereafter this was done once a week between 10 am and 2 pm. The mice received water supplemented with 20% glucose (Sigma-Aldrich) to counter the progressive hypoglycemia induced by the growing EndoC-H1 cells. Human C-peptide was evaluated in plasma. The blood samples were collected with a heparin treated syringe from a tail cut. Human C-peptide was measured with a human Ultra-sensitive C-peptide ELISA (Mercodia AB, Uppsala, Sweden).
[0304] Statistical Analyses
[0305] Data in all experiments are presented as meanSEM. One-way ANOVA with Bidak correction for multiple comparisons was used to analyse the differences between more than two groups. When comparing two groups, the two-tailed paired or unpaired Student's t-test was utilized, unpaired was used to test the glycemic values and HuC-peptide of the EndoC-mice. Statistical testing was performed using Graph Pad Prism 6 software (Graph Software Inc., La Jolla, USA). P-values of <_0.05 were considered as significant for all tests.
[0306] Results:
[0307] Expression of DPP6
[0308] DPP6 mRNA expression was determined by qPCR in 14 different normal human tissues (
[0309] SCID CB-17/Icr-Prkdcscid/Rj (SCID-EndoC)-Endoc-BH1 Grafted Mice.
[0310] In order to validate the Nbs in vivo we created humanized mouse models that contained EndoC-H1 cells. These cells generated palpable tumors in immunocompromised mice after 9-10 weeks, and shortly after this the mice became hypoglycemic (SCID-EndoC-H1 mice, p<0.001, n=24) (
Example 2
Identifying and Validating Specificity of Nanobodies Against DPP6
[0311] A recombinant extracellular domain protein (SEQ ID NO.3) was used as a source to generate nanobodies. This protein was used to immunize a dromedary, and a phage-display nanobody library from these animals was generated and biopannings were performed with said phage-displayed nanobody library and the resulting nanobodies were screened for binding to the recombinant protein.
[0312] The sequences of the nanobodies retrieved are displayed in
TABLE-US-00003 Nb IMGT CDR1 CDR2 CDR3 name sequence sequence sequence sequence 4hD29 SEQ ID NO. 8 SEQ ID NO. 9 SEQ ID NO. 10 SEQ ID NO. 11
[0313] The affinity of different Nbs was analysed versus the human DPP6 protein. The best scoring nanobody was designated 4hD29 and had an affinity towards DPP6 of 1.2 K.sub.D; nM.
[0314] Subsequently, said Nbs were screened on cells for recognition of the mouse and human DPP6 receptor on cells. For this, CHO cells were transiently transfected with a plasmid construct expressing either human or mouse DPP6 protein (SEQ ID NO.1 or 2 respectively). Nb 4hD29 specifically recognized human DPP6 transfected cells (
[0315] In a next step, the Nbs were tested for binding to human DPP6 cells that express the receptor endogenously. The human Kelly neuroblastoma cell line expresses medium levels of DPP6. 6 out of the 8 Nbs that bound to human DPP6 in transiently transfected CHO cells also recognized human DPP6 on Kelly cells. Nanobody 4hD29 indeed bound to Kelly cells (
[0316] Subsequently, the ability of the Nbs to perform FACS analysis of endocrine versus non endocrine tissue was tested for nanobody 4hD29, which was indeed shown to bind more to endocrine tissue than to exocrine tissue of dissociated pancreas from a normal donor (
[0317] Imaging studies were performed with Nb 4hD29 on Kelly neuroblastoma cells in vivo. Human DPP6+ Kelly neuroblastoma cells were grown subcutaneously in nude mice. 4hD29 nanobody and an irrelevant control nanobody were labeled with .sup.99mTc and injected i.v. in tumor-bearing mice. Mice were imaged by SPECT/CT at 1 h post-injection, and at 1.5 h postinjection mice were euthanized, dissected and radioactivity levels quantified in various organs (n=3). Nb 4hD29 cleared fast and radioactivity signals were low in all normal organs (except kidneys which is the normal route of nanobody excretion). Nb 4hD29 signals in all normal organs were lower as compared to the control nanobody
[0318] Bcll10. In contrast, uptake in the DPP6+ Kelly tumor was higher resulting in higher tumor-to-blood and tumor-to-muscle ratios, and a clear visualisation of the tumor on the images was reached (
[0319] Next, FACS analysis was performed of DPP6 Nbs on EndoC human beta cells. Nb 4hD29 and ctrl NbBcll10 were tested for binding to the Endoc-beta human beta cell line. 4hD29 specifically bound to the cells (as well as 2hD1 which was tested in parallel) (
[0320] Finally, Endoc cells were grown in rings implanted subcutaneously in mice. Mice were injected i.v. with .sup.99mTc-labeled Nb 4hD29 or ctrl Nb and imaged 1 h (not shown) or 3 h p.i. Shown are the quantifications of the signals (n=2). These data clearly show that 4hD29 Nb accumulates in the Endoc graft, but not in the control ring. Ctrl Nb does not accumulate in either of them (
REFERENCES
[0321] 1. Del Guerra S, Lupi R, Marselli L, Masini M, Bugliani M, Sbrana S, Torri S, Pollera M, Boggi U, Mosca F, Del Prato S, Marchetti P: Functional and Molecular Defects of Pancreatic Islets in Human Type 2 Diabetes. Diabetes 2005; 54:727-735
[0322] 2. Ravassard P, Hazhouz Y, Pechberty S, Bricout-Neveu E, Armanet M, Czernichow P, Scharfmann R: A genetically engineered human pancreatic beta cell line exhibiting glucose-inducible insulin secretion. J Clin Invest 2011; 121:3589-3597
[0323] 3. Brozzi F, Gerlo S, Grieco F A, Nardelli T R, Lievens S, Gysemans C, Marselli L, Marchetti P, Mathieu C, Tavernier J, Eizirik D L: A Combined Omics Approach Identifies N-Myc Interactor as a Novel Cytokine-induced Regulator of IRE1 Protein and c-Jun N-terminal Kinase in Pancreatic Beta Cells. Journal of Biological Chemistry 2014; 289:20677-20693
[0324] 4. Eizirik D L, Sammeth M, Bouckenooghe T, Bottu G, Sisino G, Igoillo-Esteve M, Ortis F, Santin I, Colli M L, Barthson J, Bouwens L, Hughes L, Gregory L, Lunter G, Marselli L, Marchetti P, McCarthy M I, Cnop M: The human pancreatic islet transcriptome: expression of candidate genes for type 1 diabetes and the impact of pro-inflammatory cytokines. PLoS genetics 2012; 8:e1002552
[0325] 5. Cardozo A K, Ortis F, Storling J, Feng Y-M, Rasschaert J, Tonnesen M, Van Eylen F, Mandrup-Poulsen T, Herchuelz A, Eizirik D L: Cytokines Downregulate the Sarcoendoplasmic Reticulum Pump Ca2+ ATPase 2b and Deplete Endoplasmic Reticulum Ca2+, Leading to Induction of Endoplasmic Reticulum Stress in Pancreatic -Cells. Diabetes 2005; 54:452-461
[0326] 6. Marroqui L, Masini M, Merino B, Grieco F A, Millard I, Dubois C, Quesada I, Marchetti P, Cnop M, Eizirik D L: Pancreatic Cells are Resistant to Metabolic Stress-induced Apoptosis in Type 2 Diabetes. EBioMedicine 2015; 2:378-385
[0327] 7. Capito C, Simon M-T, Aiello V, Clark A, Aigrain Y, Ravassard P, Scharfmann R: Mouse Muscle As an Ectopic Permissive Site for Human Pancreatic Development. Diabetes 2013; 62:3479-3487
[0328] 8. Fridman R, Benton G, Aranoutova I, Kleinman H K, Bonfil R D: Increased initiation and growth of tumor cell lines, cancer stem cells and biopsy material in mice using basement membrane matrix protein (Cultrex or Matrigel) co-injection. Nat Protocols 2012; 7:1138-1144
[0329] 9. Notta F, Doulatov S, Dick J E: Engraftment of human hematopoietic stem cells is more efficient in female NOD/SCID/IL-2Rgc-null recipients. Blood 2010; 115:3704-3707
[0330] 10. Shultz L D, Ishikawa F, Greiner D L: Humanized mice in translational biomedical research. Nat Rev Immunol 2007; 7:118-130
[0331] 11. Farrell C M, O'Leary N A, Harte R A, Loveland J E, Wilming L G, Wallin C, Diekhans M, Barrell D, Searle S M J, Aken B, Hiatt S M, Frankish A, Suner M-M, Rajput B, Steward C A, Brown G R, Bennett R, Murphy M, Wu W, Kay M P, Hart J, Rajan J, Weber J, Snow C, Riddick L D, Hunt T, Webb D, Thomas M, Tamez P, Rangwala S H, McGarvey K M, Pujar S, Shkeda A, Mudge J M, Gonzalez J M, Gilbert J G R, Trevanion S J, Baertsch R, Harrow J L, Hubbard T, Ostell J M, Haussler D, Pruitt K D: Current status and new features of the Consensus Coding Sequence database. Nucleic Acids Research 2014; 42:D865-D872.