Mutated Immunoglobulin-Binding Polypeptides

20190144496 · 2019-05-16

    Inventors

    Cpc classification

    International classification

    Abstract

    An Fc-binding polypeptide of improved alkali stability, comprising a mutant of a parental Fc-binding domain of Staphylococcus Protein A (SpA), as defined by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:22, SEQ ID NO 51 or SEQ ID NO 52, wherein at least the asparagine or serine residue at the position corresponding to position 11 in SEQ ID NO: 4-7 has been mutated to an amino acid selected from the group consisting of glutamic acid, lysine, tyrosine, threonine, phenylalanine, leucine, isoleucine, tryptophan, methionine, valine, alanine, histidine and arginine.

    Claims

    1. An Fc-binding polypeptide comprising a mutant of a parental Fc-binding domain of Staphylococcus Protein A (SpA), as defined by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:22, SEQ ID NO 51 or SEQ ID NO 52, wherein at least the asparagine or serine residue at the position corresponding to position 11 in SEQ ID NO:4-7 has been mutated to an amino acid selected from the group consisting of glutamic acid, lysine, tyrosine, threonine, phenylalanine, leucine, isoleucine, tryptophan, methionine, valine, alanine, histidine and arginine.

    2. The polypeptide of claim 1, comprising a mutant of a parental Fc-binding domain of Staphylococcus Protein A (SpA), as defined by SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO 51 or SEQ ID NO 52.

    3. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 11 in SEQ ID NO:4-7 is a glutamic acid.

    4. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 11 in SEQ ID NO:4-7 is a lysine.

    5. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 29 in SEQ ID NO:4-7 is a glycine, serine, tyrosine, glutamine, threonine, asparagine, phenylalanine, leucine, tryptophan, isoleucine, methionine, valine, aspartic acid, glutamic acid, histidine, arginine or lysine.

    6. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 9 in SEQ ID NO:4-7 is an alanine.

    7. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 9 in SEQ ID NO:4-7 has been deleted.

    8. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 50 in SEQ ID NO:4-7 is an arginine or a glutamic acid, such as an arginine.

    9. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 3 in SEQ ID NO:4-7 is an alanine and/or the amino acid residue at the position corresponding to position 6 in SEQ ID NO:4-7 is an aspartic acid.

    10. The polypeptide of claim 1, wherein at least one, such as both, of the amino acid residues at the positions corresponding to positions 3 and 6 in SEQ ID NO:4-7 is an asparagine.

    11. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 43 in SEQ ID NO:4-7 is an alanine or a glutamic acid, such as an alanine.

    12. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 43 in SEQ ID NO:4-7 has been deleted.

    13. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 28 in SEQ ID NO:4-7 is an alanine or an asparagine.

    14. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 40 in SEQ ID NO:4-7 is selected from the group consisting of asparagine, alanine, glutamic acid and valine.

    15. The polypeptide of claim 1, wherein the amino acid residue at the position corresponding to position 40 in SEQ ID NO:4-7 has been deleted.

    16. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 42 in SEQ ID NO:4-7 is an alanine, lysine or arginine, such as an arginine.

    17. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 42 in SEQ ID NO:4-7 has been deleted.

    18. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 44 in SEQ ID NO:4-7 is a leucine or an isoleucine, such as an isoleucine.

    19. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 44 in SEQ ID NO:4-7 has been deleted.

    20. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 53 in SEQ ID NO:4-7 is a phenylalanine, a tyrosine, a tryptophan, an arginine or a lysine.

    21. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 18 in SEQ ID NO:4-7 is a lysine or a histidine, such as a lysine.

    22. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 33 in SEQ ID NO:4-7 is a lysine or a serine, such as a lysine.

    23. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 37 in SEQ ID NO:4-7 is a glutamic acid or an aspartic acid, such as a glutamic acid.

    24. The polypeptide according to claim 1, wherein the amino acid residue at the position corresponding to position 51 in SEQ ID NO:4-7 is a tyrosine or a leucine, such as a tyrosine.

    25. The polypeptide according to claim 1, wherein one or more of the amino acid residues at the positions corresponding to positions 1, 2, 3, 4, 5, 6, 7, 8, 56, 57 or 58 in SEQ ID NO: 4-7 have been deleted.

    26. The polypeptide according to claim 1, which is a mutant of Zvar as defined by SEQ ID NO:7, wherein the amino acid residue at position 9 is alanine or has been deleted and the amino acid residue at position 11 is lysine or glutamic acid, such as lysine.

    27. The polypeptide according to claim 26, wherein the amino acid residue at position 43 is alanine or glutamic acid or has been deleted.

    28. The polypeptide according to claim 26, wherein the amino acid residue at position 40 is valine or has been deleted.

    29. The polypeptide according to claim 26, wherein the amino acid residue at position 44 is isoleucine or has been deleted.

    30. The polypeptide according to claim 26, wherein the mutation is selected from the group consisting of: Q9A,N11E,A29G,Q40V,A42K,N43A,L44I; Q9A,N11E,A29S,Q40V,A42K,N43A,L44I; Q9A,N11E,A29Y,Q40V,A42K,N43A,L44I; Q9A,N11E,A29Q,Q40V,A42K,N43A,L44I; Q9A,N11E,A29T,Q40V,A42K,N43A,L44I; Q9A,N11E,A29N,Q40V,A42K,N43A,L44I; Q9A,N11E,A29F,Q40V,A42K,N43A,L44I; Q9A,N11E,A29L,Q40V,A42K,N43A,L44I; Q9A,N11E,A29W,Q40V,A42K,N43A,L44I; Q9A,N11E,A29L,Q40V,A42K,N43A,L44I; Q9A,N11E,A29M,Q40V,A42K,N43A,L44I; Q9A,N11E,A29V,Q40V,A42K,N43A,L44I; Q9A,N11E,A29D,Q40V,A42K,N43A,L44I; Q9A,N11E,A29E,Q40V,A42K,N43A,L44I; Q9A,N11E,A29H,Q40V,A42K,N43A,L44I; Q9A,N11E,A29R,Q40V,A42K,N43A,L44I; and Q9A,N11E,A29K,Q40V,A42K,N43A,L44I.

    31. The polypeptide according to claim 26, wherein the mutation is selected from the group consisting of: Q9A,N11E,Q40V,A42K,N43A,L44I,D53F; Q9A,N11E,Q40V,A42K,N43A,L44I,D53Y; Q9A,N11E,Q40V,A42K,N43A,L44I,D53W; Q9A,N11E,Q40V,A42K,N43A,L44I,D53K; and Q9A,N11E,Q40V,A42K,N43A,L44I,D53R.

    32. The polypeptide according to claim 26, wherein the mutation is selected from the group consisting of: Q9del,N11E,Q40V,A42K,N43A,L44I; Q9A,N11E,Q40del,A42K,N43A,L44I; Q9A,N11E,Q40V,A42del,N43A,L44I; and Q9A,N11E,Q40V,A42K,N43del,L44I.

    33. The polypeptide according to claim 26, wherein the mutation is selected from the group consisting of: D2del,A3del,K4del,Q9A,N11E,Q40V,A42K,N43A,L44I; V1del,D2del,Q9A,N11E,Q40V,A42K,N43A,L44I,K58del; V1del,D2del,A3del,Q9A,N11E,Q40V,A42K,N43A,L44I,P57del,K58del; K4del,F5del,D6del,K7del,E8del,Q9A,N11E,Q40V,A42K,N43A,L44I; Q9A,N11E,Q40V,A42K,N43A,L44I,A56del,P57del,K58del; V1del,D2del,A3del,Q9A,N11E,Q40V,A42K,N43A,L44I; V1del,D2del,A3del,K4del,F5del,D6del,K7del,E8del,Q9A,N11E,Q40V,A42K,N43A,L44I; and Q9A,N11E,Q40V,A42K,N43A,L44I,K58_insYEDG.

    34. The polypeptide according to claim 1, comprising or consisting essentially of a sequence having at least 90%, such as 95% or 98%, identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 54, SEQ ID NO 55, SEQ ID NO 56, SEQ ID NO 57, SEQ ID NO 58, SEQ ID NO 59, SEQ ID NO 60, SEQ ID NO 61, SEQ ID NO 62, SEQ ID NO 63, SEQ ID NO 64, SEQ ID NO 65, SEQ ID NO 66, SEQ ID NO 67, SEQ ID NO 68, SEQ ID NO 69 and SEQ ID NO 70.

    35. The polypeptide according to claim 1, comprising or consisting essentially of a sequence having at least 90%, such as 95% or 98%, identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 71, SEQ ID NO 72, SEQ ID NO 73, SEQ ID NO 74 and SEQ ID NO 75.

    36. The polypeptide according to claim 1, comprising or consisting essentially of a sequence having at least 90%, such as 95% or 98%, identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 76, SEQ ID NO 77, SEQ ID NO 78 and SEQ ID NO 79.

    37. The polypeptide according to claim 1, comprising or consisting essentially of a sequence having at least 90%, such as 95% or 98%, identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 89, SEQ ID NO 90, SEQ ID NO 91, SEQ ID NO 92, SEQ ID NO 93, SEQ ID NO 94 and SEQ ID NO 95.

    38. The polypeptide according to claim 34, wherein said polypeptide does not comprise any sequence defined by an amino acid sequence selected from the group consisting of SEQ ID NO 1-16, 17-34 and 36-52.

    39. The polypeptide according to claim 1, which polypeptide has an improved alkaline stability compared to a polypeptide as defined by SEQ ID NO 1, SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5, SEQ ID NO 6 or SEQ ID NO 7, such as by SEQ ID NO 7.

    40. The polypeptide according to claim 1, which polypeptide has an improved alkaline stability compared to a parental polypeptide as defined by SEQ ID NO 1, SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5, SEQ ID NO 6 or SEQ ID NO 7, such as by SEQ ID NO 7.

    41. The polypeptide according to claim 38, wherein the alkaline stability is improved as measured by the remaining IgG-binding capacity after 24 or 25 h incubation in 0.5 M or 1.0 M aqueous NaOH at 22+/2 C.

    42. An Fc-binding polypeptide which comprises a sequence as defined by, or having at least 90% or at least 95% or 98% identity to SEQ ID NO 53; TABLE-US-00009 SEQIDNO53 KEX1QX2AFYEILX3LPNLTEEQRX4X5FIX6X7LKDX8PSX9 SX10X11X12LAEAKX13X14NX15AQAPK wherein individually of each other: X1=A or Q or is deleted X2=E,K,Y,T,F,L,W,I,M,V,A,H or R X3=H or K X4=A or N X5=A, G, S,Y,Q,T,N,F,L,W,I,M,V,D,E,H,R or K X6=Q or E X7=S or K X8=E or D X9=Q or V or is deleted X10=K,R or A or is deleted X11=A,E or N or is deleted X12=I or L X13=K or R X14=L or Y X15=D, F,Y,W,K or R.

    42. The polypeptide of claim 41, wherein: X1=A or is deleted X2=E X3=H X4=N X6=Q X7=S X8=D X9=V or is deleted X10=K or is deleted X11=A or is deleted X12=I X13=K X14=L.

    43. The polypeptide of claim 41, wherein: X1=A, X2=E, X3=H, X4=N, X5=S,Y,Q,T,N,F,L,W,I,M,V,D,E,H,R or K, X6=Q, X7=S, X8=D, X9=V, X10=K, X11=A, X12=I, X13=K, X14=L, X15=D.

    44. The polypeptide of claim 41, wherein: X1 is deleted, X2=E, X3=H, X4=N, X5=A, X6=Q, X7=S, X8=D, X9=V, X10=K, X11=A, X12=I, X13=K, X14=L, X15=D.

    45. The polypeptide of claim 41, wherein: X1=A, X2=E, X3=H, X4=N, X5=A, X6=Q, X7=S, X8=D, X9 is deleted, X10=K, X11=A, X12=I, X13=K, X14=L, X15=D.

    46. The polypeptide of claim 41, wherein: X1=A, X2=E, X3=H, X4=N, X5=A, X6=Q, X7=S, X8=D, X9=V, X10 is deleted, X11=A, X12=I, X13=K, X14=L, X15=D.

    47. The polypeptide of claim 41, wherein: X1=A, X2=E, X3=H, X4=N, X5=A, X6=Q, X7=S, X8=D, X9=V, X10=K, X11 is deleted, X12=I, X13=K, X14=L, X15=D.

    48. The polypeptide of claim 41, wherein: X1=A, X2=E, X3=H, X4=N, X5=A, X6=Q, X7=S, X8=D, X9=V, X10=K, X11=A, X12=I, X13=K, X14=L, X15=F,Y,W,K or R.

    49. The polypeptide of claim 41, wherein said polypeptide does not comprise any sequence defined by an amino acid sequence selected from the group consisting of SEQ ID NO 1-16, 17-34 and 36-52.

    50. A multimer comprising or consisting essentially of a plurality of polypeptides as defined by claim 1.

    51. The multimer according to claim 50, wherein the polypeptides are linked by linkers comprising up to 15 amino acids.

    52. The multimer according to claim 50, which is a dimer, trimer, tetramer, pentamer, hexamer, heptamer, octamer or nonamer.

    53. The multimer according to claim 50, which comprises or consists essentially of a sequence selected from the group of sequences defined by SEQ ID NO 17, SEQ ID NO 18, SEQ ID NO 19, SEQ ID NO 20, SEQ ID NO 30, SEQ ID NO 31, SEQ ID NO 32, SEQ ID NO 33, SEQ ID NO 34 and SEQ ID NO 35.

    54. The polypeptide or multimer according to claim 1, further comprising at, or within 1-5 amino acid residues from, the C-terminal or N-terminal one or more coupling element, selected from the group consisting of one or more cysteine residues, a plurality of lysine residues and a plurality of histidine residues.

    55. A nucleic acid or a vector encoding a polypeptide or multimer according to claim 1.

    56. An expression system, which comprises a nucleic acid or vector according to claim 55.

    57. A separation matrix, wherein a plurality of polypeptides or multimers according to claim 1 have been coupled to a solid support.

    58. The separation matrix according to claim 57, wherein the polypeptides or multimers have been coupled to the solid support via thioether bonds.

    59. The separation matrix according to claim 57, wherein the solid support is a polysaccharide.

    60. The separation matrix according to claim 57, wherein the IgG capacity of the matrix after 24 incubation in 0.5 M NaOH at 22+/2 C. is at least 80, such as at least 85, at least 90 or at least 95% of the IgG capacity before the incubation.

    61. The separation matrix according to claim 57, wherein the IgG capacity of the matrix after 24 incubation in 1.0 M NaOH at 22+/2 C. is at least 70, such as at least 80 or at least 90% of the IgG capacity before the incubation.

    62. A method of isolating an immunoglobulin, wherein a separation matrix according to claim 57 is used.

    63. The method of claim 62, comprising the steps of: a) contacting a liquid sample comprising an immunoglobulin with a separation matrix according to any one of claims 57-61, b) washing said separation matrix with a washing liquid, c) eluting the immunoglobulin from the separation matrix with an elution liquid, and d) cleaning the separation matrix with a cleaning liquid.

    64. The method of claim 63, wherein the cleaning liquid is alkaline, such as with a pH of 13-14.

    65. The method of claim 63, wherein the cleaning liquid comprises 0.1-1.0 M NaOH or KOH, such as 0.5-1.0 M NaOH or KOH.

    66. The method of claim 63, wherein steps a)-d) are repeated at least 10 times, such as at least 50 times or 50-200 times.

    67. The method of claim 63, wherein steps a)-c) are repeated at least 10 times, such as at least 50 times or 50-200 times and wherein step d) is performed after a plurality of instances of step c), such as at least 10 or at least 50 times.

    Description

    BRIEF DESCRIPTION OF FIGURES

    [0021] FIG. 1 shows an alignment of the Fc-binding domains as defined by SEQ ID NO:1-7 and 51-52.

    [0022] FIG. 2 shows results from Example 2 for the alkali stability of parental and mutated tetrameric Zvar (SEQ ID NO 7) polypeptide variants coupled to an SPR biosensor chip.

    [0023] FIG. 3 shows results from Example 4 for the alkali stability (0.5 M NaOH) of parental and mutated tetrameric Zvar (SEQ ID NO 7) polypeptide variants coupled to agarose beads.

    [0024] FIG. 4 shows results from Example 4 for the alkali stability (1.0 M NaOH) of parental and mutated tetrameric Zvar (SEQ ID NO 7) polypeptide variants coupled to agarose beads.

    DETAILED DESCRIPTION OF EMBODIMENTS

    [0025] In one aspect the present invention discloses an Fc-binding polypeptide, which comprises, or consists essentially of, a mutant of a parental Fc-binding domain of Staphylococcus Protein A (SpA), as defined by (or having at least 90%, at least 95% or at least 98% identity to) SEQ ID NO: 1 (E-domain), SEQ ID NO: 2 (D-domain), SEQ ID NO:3 (A-domain), SEQ ID NO:22 (variant A-domain), SEQ ID NO: 4 (B-domain), SEQ ID NO: 5 (C-domain), SEQ ID NO:6 (Protein Z), SEQ ID NO:7 (Zvar), SEQ ID NO 51 (Zvar without the linker region amino acids 1-6) or SEQ ID NO 52 (C-domain without the linker region amino acids 1-6) as illustrated in FIG. 1, wherein, in the mutant, at least the asparagine (or serine, in the case of SEQ ID NO 2) residue at the position* corresponding to position 11 in SEQ ID NO:4-7 has been mutated to an amino acid selected from the group consisting of glutamic acid, lysine, tyrosine, threonine, phenylalanine, leucine, isoleucine, tryptophan, methionine, valine, alanine, histidine and arginine. Protein Z (SEQ ID NO:6) is a mutated B-domain as disclosed in U.S. Pat. No. 5,143,844, while SEQ ID NO 7 denotes a further mutated variant of Protein Z, here called Zvar, with the mutations N3A,N6D,N23T. SEQ ID NO:22 is a natural variant of the A-domain in Protein A from Staphylococcus aureus strain N315, having an A46S mutation, using the position terminology of FIG. 1. The mutation of N11 in these domains confers an improved alkali stability in comparison with the parental domain/polypeptide, without impairing the immunoglobulin-binding properties. Hence, the polypeptide can also be described as an Fc- or immunoglobulin-binding polypeptide, or alternatively as an Fc- or immunoglobulin-binding polypeptide unit.

    [0026] *Throughout this description, the amino acid residue position numbering convention of FIG. 1 is used, and the position numbers are designated as corresponding to those in SEQ ID NO 4-7. This applies also to multimers, where the position numbers designate the positions in the polypeptide units or monomers according to the convention of FIG. 1.

    [0027] In alternative language, the invention discloses an Fc-binding polypeptide which comprises a sequence as defined by, or having at least 90%, at least 95% or at least 98% identity to SEQ ID NO 53.

    TABLE-US-00001 SEQIDNO53 KEX.sub.1QX.sub.2AFYEILX.sub.3LPNLTEEQRX.sub.4X.sub.5FIX.sub.6X.sub.7LKDX.sub.8PSX.sub.9 SX.sub.10X.sub.11X.sub.12LAEAKX.sub.13X.sub.14NX.sub.15AQAPK
    where individually of each other:
    X.sub.1=A or Q or is deleted

    X.SUB.2.=E,K,Y,T,F,L,W,I,M,V,A,H or R

    X.SUB.3.=H or K

    X.SUB.4.=A or N

    [0028] X.sub.5=A, G, S,Y,Q,T,N,F,L,W,I,M,V,D,E,H,R or K, such as S,Y,Q,T,N,F,L,W,I,M,V,D,E,H,R or K

    X.SUB.6.=Q or E

    X.SUB.7.=S or K

    X.SUB.8.=E or D

    [0029] X.sub.9=Q or V or is deleted
    X.sub.10=K,R or A or is deleted
    X.sub.11=A,E or N or is deleted

    X.SUB.12.=I or L

    X.SUB.13.=K or R

    X.SUB.14.=L or Y

    X.SUB.15.=D, F,Y,W,K or R

    [0030] Specifically, the amino acid residues in SEQ ID NO 53 may individually of each other be:

    X.sub.1=A or is deleted

    X.SUB.2.=E

    X.SUB.3.=H

    X.SUB.4.=N

    X.SUB.6.=Q

    X.SUB.7.=S

    X.SUB.8.=D

    [0031] X.sub.9=V or is deleted
    X.sub.10=K or is deleted
    X.sub.11=A or is deleted

    X.SUB.12.=I

    X.SUB.13.=K

    X.SUB.14.=L.

    [0032] In some embodiments X.sub.1=A, X.sub.2=E, X.sub.3=H, X.sub.4=N, X.sub.5=S,Y,Q,T,N,F,L,W,I,M,V,D,E,H,R or K, X.sub.6=Q, X.sub.7=S, X.sub.8=D, X.sub.9=V, X.sub.10=K, X.sub.11=A, X.sub.12=I, X.sub.13=K, X.sub.14=L, X.sub.15=D.

    [0033] In certain embodiments X.sub.1 is deleted, X.sub.2=E, X.sub.3=H, X.sub.4=N, X.sub.5=A, X.sub.6=Q, X.sub.7=S, X.sub.8=D, X.sub.9=V, X.sub.10=K, X.sub.11=A, X.sub.12=I, X.sub.13=K, X.sub.14=L, X.sub.15=D.

    [0034] In some embodiments X.sub.1=A, X.sub.2=E, X.sub.3=H, X.sub.4=N, X.sub.5=A, X.sub.6=Q, X.sub.7=S, X.sub.8=D, X.sub.9 is deleted, X.sub.10=K, X.sub.11=A, X.sub.12=I, X.sub.13=K, X.sub.14=L, X.sub.15=D.

    [0035] In certain embodiments X.sub.1=A, X.sub.2=E, X.sub.3=H, X.sub.4=N, X.sub.5=A, X.sub.6=Q, X.sub.7=S, X.sub.8=D, X.sub.9=V, X.sub.10 is deleted, X.sub.11=A, X.sub.12=I, X.sub.13=K, X.sub.14=L, X.sub.15=D.

    [0036] In some embodiments X.sub.1=A, X.sub.2=E, X.sub.3=H, X.sub.4=N, X.sub.5=A, X.sub.6=Q, X.sub.7=S, X.sub.8=D, X.sub.9=V, X.sub.10=K, X.sub.11 is deleted, X.sub.12=I, X.sub.13=K, X.sub.14=L, X.sub.15=D.

    [0037] In certain embodiments X.sub.1=A, X.sub.2=E, X.sub.3=H, X.sub.4=N, X.sub.5=A, X.sub.6=Q, X.sub.7=S, X.sub.8=D, X.sub.9=V, X.sub.10=K, X.sub.11=A, X.sub.12=I, X.sub.13=K, X.sub.14=L, X.sub.15=F,Y,W,K or R.

    [0038] In the embodiments discussed above, the polypeptide may in some cases further not comprise any sequence defined by an amino acid sequence selected from the group consisting of SEQ ID NO 1-16, 17-34 and 36-52.

    [0039] The N11 (X.sub.2) mutation (e.g. a N11E or N11K mutation) may be the only mutation or the polypeptide may also comprise further mutations, such as substitutions in at least one of the positions corresponding to positions 3, 6, 9, 10, 15, 18, 23, 28, 29, 32, 33, 36, 37, 40, 42, 43, 44, 47, 50, 51, 55 and 57 in SEQ ID NO:4-7. In one or more of these positions, the original amino acid residue may e.g. be substituted with an amino acid which is not asparagine, proline or cysteine. The original amino acid residue may e.g. be substituted with an alanine, a valine, a threonine, a serine, a lysine, a glutamic acid or an aspartic acid. Further, one or more amino acid residues may be deleted, e.g. from positions 1-6 and/or from positions 56-58.

    [0040] In some embodiments, the amino acid residue at the position corresponding to position 9 in SEQ ID NO:4-7 (X.sub.1) is an amino acid other than glutamine, asparagine, proline or cysteine, such as an alanine or it can be deleted. The combination of the mutations at positions 9 and 11 provides particularly good alkali stability, as shown by the examples. In specific embodiments, in SEQ ID NO: 7 the amino acid residue at position 9 is an alanine and the amino acid residue at position 11 is a lysine or glutamic acid, such as a lysine. Mutations at position 9 are also discussed in copending application PCT/SE2014/050872, which is hereby incorporated by reference in its entirety.

    [0041] In some embodiments, the amino acid residue at the position corresponding to position 50 in SEQ ID NO:4-7 (X.sub.13) is an arginine or a glutamic acid.

    [0042] In certain embodiments, the amino acid residue at the position corresponding to position 3 in SEQ ID NO:4-7 is an alanine and/or the amino acid residue at the position corresponding to position 6 in SEQ ID NO:4-7 is an aspartic acid. One of the amino acid residues at positions 3 and 6 may be an asparagine and in an alternative embodiment both amino acid residues at positions 3 and 6 may be asparagines.

    [0043] In some embodiments the amino acid residue at the position corresponding to position 43 in SEQ ID NO:4-7 (X.sub.11) is an alanine or a glutamic acid, such as an alanine or it can be deleted. In specific embodiments, the amino acid residues at positions 9 and 11 in SEQ ID NO: 7 are alanine and lysine/glutamic acid respectively, while the amino acid residue at position 43 is alanine or glutamic acid.

    [0044] In certain embodiments the amino acid residue residue at the position corresponding to position 28 in SEQ ID NO:4-7 (X.sub.5) is an alanine or an asparagine, such as an alanine.

    [0045] In some embodiments the amino acid residue at the position corresponding to position 40 in SEQ ID NO:4-7 (X.sub.9) is selected from the group consisting of asparagine, alanine, glutamic acid and valine, or from the group consisting of glutamic acid and valine or it can be deleted. In specific embodiments, the amino acid residues at positions 9 and 11 in SEQ ID NO: 7 are alanine and glutamic acid respectively, while the amino acid residue at position 40 is valine. Optionally, the amino acid residue at position 43 may then be alanine or glutamic acid.

    [0046] In certain embodiments, the amino acid residue at the position corresponding to position 42 in SEQ ID NO:4-7 (X.sub.10) is an alanine, lysine or arginine or it can be deleted.

    [0047] In some embodiments the amino acid residue at the position corresponding to position 18 in SEQ ID NO:4-7 (X.sub.3) is a lysine or a histidine, such as a lysine.

    [0048] In certain embodiments the amino acid residue at the position corresponding to position 33 in

    [0049] SEQ ID NO:4-7 (X.sub.7) is a lysine or a serine, such as a lysine.

    [0050] In some embodiments the amino acid residue at the position corresponding to position 37 in SEQ ID NO:4-7 (X.sub.8) is a glutamic acid or an aspartic acid, such as a glutamic acid.

    [0051] In certain embodiments the amino acid residue at the position corresponding to position 51 in SEQ ID NO:4-7 (X.sub.14) is a tyrosine or a leucine, such as a tyrosine.

    [0052] In some embodiments, the amino acid residue at the position corresponding to position 44 in SEQ ID NO:4-7 (X.sub.12) is a leucine or an isoleucine. In specific embodiments, the amino acid residues at positions 9 and 11 in SEQ ID NO: 7 are alanine and lysine/glutamic acid respectively, while the amino acid residue at position 44 is isoleucine. Optionally, the amino acid residue at position 43 may then be alanine or glutamic acid.

    [0053] In some embodiments, the amino acid residues at the positions corresponding to positions 1, 2, 3 and 4 or to positions 3, 4, 5 and 6 in SEQ ID NO: 4-7 have been deleted. In specific variants of these embodiments, the parental polypeptide is the C domain of Protein A (SEQ ID NO: 5). The effects of these deletions on the native C domain are described in U.S. Pat. Nos. 9,018,305 and 8,329,860, which are hereby incorporated by reference in their entireties.

    [0054] In certain embodiments, the mutation in SEQ ID NO 4-7, such as in SEQ ID NO 7, is selected from the group consisting of: N11K; N11E; N11Y; N11T; N11F; N11L; N11W; N11I; N11M; N11V; N11A; N11H; N11R; N11E,Q32A; N11E,Q32E,Q40E; N11E,Q32E,K50R; Q9A,N11E,N43A; Q9A,N11E,N28A,N43A; Q9A,N11E,Q40V,A42K,N43E,L44I; Q9A,N11E,Q40V,A42K,N43A,L44I; N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y; Q9A,N11E,N28A,Q40V,A42K,N43A,L44I; Q9A,N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y; N11K, H18K, D37E, A42R, N43A, L44I; Q9A, N11K, H18K, D37E, A42R, N43A, L44I; Q9A, N11K, H18K, D37E, A42R, N43A, L44I, K50R; Q9A,N11K,H18K,D37E,A42R; Q9A,N11E,D37E,Q40V,A42K,N43A,L44I and Q9A,N11E,D37E,Q40V,A42R,N43A,L44I. These mutations provide particularly high alkaline stabilities. The mutation in SEQ ID NO 4-7, such as in SEQ ID NO 7, can also be selected from the group consisting of N11K; N11Y; N11F; N11L; N11W; N11I; N11M; N11V; N11A; N11H; N11R; Q9A,N11E,N43A; Q9A,N11E,N28A,N43A; Q9A,N11E,Q40V,A42K,N43E,L44I; Q9A,N11E,Q40V,A42K,N43A,L44I; Q9A,N11E,N28A,Q40V,A42K,N43A,L44I; N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y; Q9A,N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y; N11K, H18K, D37E, A42R, N43A, L44I; Q9A, N11K, H18K, D37E, A42R, N43A, L44I and Q9A, N11K, H18K, D37E, A42R, N43A, L44I, K50R.

    [0055] In some embodiments, the polypeptide comprises or consists essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 11, SEQ ID NO 12, SEQ ID NO 13, SEQ ID NO 14, SEQ ID NO 15, SEQ ID NO 16, SEQ ID NO 23, SEQ ID NO 24, SEQ ID NO 25, SEQ ID NO 26, SEQ ID NO 27, SEQ ID NO 28, SEQ ID NO 29, SEQ ID NO 36, SEQ ID NO 37, SEQ ID NO 38, SEQ ID NO 39, SEQ ID NO 40, SEQ ID NO 41, SEQ ID NO 42, SEQ ID NO 43, SEQ ID NO 44, SEQ ID NO 45, SEQ ID NO 46, SEQ ID NO 47, SEQ ID NO 48, SEQ ID NO 49 and SEQ ID NO 50. It may e.g. comprise or consist essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 11, SEQ ID NO 16, SEQ ID NO 23, SEQ ID NO 24, SEQ ID NO 25, SEQ ID NO 26, SEQ ID NO 27, SEQ ID NO 28 and SEQ ID NO 29. It can also comprise or consist essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 11, SEQ ID NO 16, SEQ ID NO 23, SEQ ID NO 24, SEQ ID NO 25, SEQ ID NO 27, SEQ ID NO 28, SEQ ID NO 38, SEQ ID NO 40; SEQ ID NO 41; SEQ ID NO 42; SEQ NO 43, SEQ ID NO 44, SEQ ID NO 45, SEQ ID NO 46, SEQ ID NO 47 and SEQ ID NO 48.

    [0056] In certain embodiments, the polypeptide comprises or consists essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of SEQ ID NO 54-70. comprises or consists essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of SEQ ID NO 71-75, or it may comprise or consist essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of SEQ ID NO 76-79. It may further comprise or consist essentially of a sequence defined by or having at least 90%, 95% or 98% identity to an amino acid sequence selected from the group consisting of SEQ ID NO 89-95. In the embodiments discussed above, the polypeptide may in some cases further not comprise any sequence defined by an amino acid sequence selected from the group consisting of SEQ ID NO 1-16, 17-34 and 36-52.

    [0057] The polypeptide may e.g. be defined by a sequence selected from the groups above or from subsets of these groups, but it may also comprise additional amino acid residues at the N- and/or C-terminal end, e.g. a leader sequence at the N-terminal end and/or a tail sequence at the C-terminal end.

    TABLE-US-00002 Zvar(Q9A,N11E,N43A) SEQIDNO8 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSQSAALLAEAKK LNDAQAPK Zvar(Q9A,N11E,N28A,N43A) SEQIDNO9 VDAKFDKEAQEAFYEILHLPNLTEEQRAAFIQSLKDDPSQSAALLAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43E,L44I) SEQIDNO10 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKEILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I) SEQIDNO11 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(N11E,Q32A) SEQIDNO12 VDAKFDKEQQEAFYEILHLPNLTEEQRNAFIASLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11E) SEQIDNO13 VDAKFDKEQQEAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11E,Q32E,Q40E) SEQIDNO14 VDAKFDKEQQEAFYEILHLPNLTEEQRNAFIESLKDDPSESANLLAEAKK LNDAQAPK Zvar(N11E,Q32E,K50R) SEQIDNO15 VDAKFDKEQQEAFYEILHLPNLTEEQRNAFIESLKDDPSQSANLLAEAKR LNDAQAPK Zvar(N11K) SEQIDNO16 VDAKFDKEQQKAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y) SEQIDNO23 VDAKFDKEQQKAFYEILKLPNLTEEQRNAFIQKLKDEPSQSRAILAEAKR YNDAQAPK Zvar(Q9A,N11E,N28A,Q40V,A42K,N43A,L44I) SEQIDNO24 VDAKFDKEAQEAFYEILHLPNLTEEQRAAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y) SEQIDNO25 VDAKFDKEAQKAFYEILKLPNLTEEQRAAFIQKLKDEPSQSRAILAEAKR YNDAQAPK Zvar(N11K,H18K,D37E,A42R,N43A,L44I) SEQIDNO26 VDAKFDKEQQKAFYEILKLPNLTEEQRNAFIQSLKDEPSQSRAILAEAKK LNDAQAPK Zvar(Q9A,N11K,H18K,D37E,A42R,N43A,L44I) SEQIDNO27 VDAKFDKEAQKAFYEILKLPNLTEEQRNAFIQSLKDEPSQSRAILAEAKK LNDAQAPK Zvar(Q9A,N11K,H18K,D37E,A42R,N43A,L44I,K50R) SEQIDNO28 VDAKFDKEAQKAFYEILKLPNLTEEQRNAFIQSLKDEPSQSRAILAEAKR LNDAQAPK Zvar(Q9A,N11K,H18K,D37E,A42R) SEQIDNO29 VDAKFDKEAQKAFYEILKLPNLTEEQRNAFIQSLKDEPSQSRNLLAEAKK LNDAQAPK B(Q9A,N11E,Q40V,A42K,N43A,L44I) SEQIDNO36 ADNKFNKEAQEAFYEILHLPNLNEEQRNGFIQSLKDDPSVSKAILAEAKK LNDAQAPK C(Q9A,N11E,E43A) SEQIDNO37 ADNKFNKEAQEAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(N11Y) SEQIDNO38 VDAKFDKEQQYAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11T) SEQIDNO39 VDAKFDKEQQTAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11F) SEQIDNO40 VDAKFDKEQQFAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11L) SEQIDNO41 VDAKFDKEQQLAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11W) SEQIDNO42 VDAKFDKEQQWAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11I) SEQIDNO43 VDAKFDKEQQIAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11M) SEQIDNO44 VDAKFDKEQQMAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11V) SEQIDNO45 VDAKFDKEQQVAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11A) SEQIDNO46 VDAKFDKEQQAAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11H) SEQIDNO47 VDAKFDKEQQHAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(N11R) SEQIDNO48 VDAKFDKEQQRAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPK Zvar(Q9A,N11E,D37E,Q40V,A42K,N43A,L44I) SEQIDNO49 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDEPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,D37E,Q40V,A42R,N43A,L44I) SEQIDNO50 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDEPSVSRAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29G,Q40V,A42K,N43A,L44I) SEQIDNO54 VDAKFDKEAQEAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29S,Q40V,A42K,N43A,L44I) SEQIDNO55 VDAKFDKEAQEAFYEILHLPNLTEEQRNSFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29Y,Q40V,A42K,N43A,L44I) SEQIDNO56 VDAKFDKEAQEAFYEILHLPNLTEEQRNYFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29Q,Q40V,A42K,N43A,L44I) SEQIDNO57 VDAKFDKEAQEAFYEILHLPNLTEEQRNQFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29T,Q40V,A42K,N43A,L44I) SEQIDNO58 VDAKFDKEAQEAFYEILHLPNLTEEQRNTFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29N,Q40V,A42K,N43A,L44I) SEQIDNO59 VDAKFDKEAQEAFYEILHLPNLTEEQRNNFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29F,Q40V,A42K,N43A,L44I) SEQIDNO60 VDAKFDKEAQEAFYEILHLPNLTEEQRNFFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29L,Q40V,A42K,N43A,L44I) SEQIDNO61 VDAKFDKEAQEAFYEILHLPNLTEEQRNLFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29W,Q40V,A42K,N43A,L44I) SEQIDNO62 VDAKFDKEAQEAFYEILHLPNLTEEQRNWFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29I,Q40V,A42K,N43A,L44I) SEQIDNO63 VDAKFDKEAQEAFYEILHLPNLTEEQRNIFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29M,Q40V,A42K,N43A,L44I) SEQIDNO64 VDAKFDKEAQEAFYEILHLPNLTEEQRNMFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29V,Q40V,A42K,N43A,L44I) SEQIDNO65 VDAKFDKEAQEAFYEILHLPNLTEEQRNVFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29D,Q40V,A42K,N43A,L44I) SEQIDNO66 VDAKFDKEAQEAFYEILHLPNLTEEQRNDFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29E,Q40V,A42K,N43A,L44I) SEQIDNO67 VDAKFDKEAQEAFYEILHLPNLTEEQRNEFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29H,Q40V,A42K,N43A,L44I) SEQIDNO68 VDAKFDKEAQEAFYEILHLPNLTEEQRNHFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29R,Q40V,A42K,N43A,L44I) SEQIDNO69 VDAKFDKEAQEAFYEILHLPNLTEEQRNRFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,A29K,Q40V,A42K,N43A,L44I) SEQIDNO70 VDAKFDKEAQEAFYEILHLPNLTEEQRNKFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53F) SEQIDNO71 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNFAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53Y) SEQIDNO72 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNYAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53W) SEQIDNO73 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNWAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53K) SEQIDNO74 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNKAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53R) SEQIDNO75 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNRAQAPK Zvar(Q9del,N11E,Q40V,A42K,N43A,L44I) SEQIDNO76 VDAKFDKE_QEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40del,A42K,N43A,L44I) SEQIDNO77 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPS_SKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42del,N43A,L44I) SEQIDNO78 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVS_AILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43del,L44I) SEQIDNO79 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSK_ILAEAKK LNDAQAPK Zvar(D2del,A3del,K4del,Q9A,N11E,Q40V,A42K,N43A,L44I) SEQIDNO89 V___FDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(V1del,D2del,Q9A,N11E,Q40V,A42K,N43A,L44I,K58del) SEQIDNO90 __AKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAP Zvar(K4del,F5del,D6del,K7del,E8del,Q9A,N11E,Q40V,A42K,N43A,L44I) SEQIDNO91 VDA_____AQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,A56del,P57del,K58del) SEQIDNO92 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQ___ Zvar(V1del,,D2del,A3del,Q9A,N11E,Q40V,A42K,N43A,L44I) SEQIDNO93 ___KFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(V1del,D2del,A3del,K4del,F5del,D6del,K7del,E8del,Q9A,N11E, Q40V,A42K,N43A,L44I) SEQIDNO94 _______AQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPK Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,K58_insYEDG) SEQIDNO95 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKYEDG

    [0058] In a second aspect the present invention discloses a multimer comprising, or consisting essentially of, a plurality of polypeptide units as defined by any embodiment disclosed above. The use of multimers may increase the immunoglobulin binding capacity and multimers may also have a higher alkali stability than monomers. The multimer can e.g. be a dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octamer or a nonamer. It can be a homomultimer, where all the units in the multimer are identical or it can be a heteromultimer, where at least one unit differs from the others. Advantageously, all the units in the multimer are alkali stable, such as by comprising the mutations disclosed above. The polypeptides can be linked to each other directly by peptide bonds between the C-terminal and N-terminal ends of the polypeptides. Alternatively, two or more units in the multimer can be linked by linkers comprising oligomeric or polymeric species, such as elements comprising up to 15 or 30 amino acids, such as 1-5, 1-10 or 5-10 amino acids. This is the case in particular for mutations of SEQ ID NO 51 and 52 and for the SEQ ID NO 53 polypeptide, where specific examples of linkers can e.g. be VDAKFD or ADNKFN, such as VDAKFD. The nature of such a linker should preferably not destabilize the spatial conformation of the protein units. This can e.g. be achieved by avoiding the presence of proline in the linkers. Furthermore, said linker should preferably also be sufficiently stable in alkaline environments not to impair the properties of the mutated protein units. For this purpose, it is advantageous if the linkers do not contain asparagine. It can additionally be advantageous if the linkers do not contain glutamine. The multimer may further at the N-terminal end comprise a plurality of amino acid residues e.g. originating from the cloning process or constituting a residue from a cleaved off signaling sequence. The number of additional amino acid residues may e.g. be 15 or less, such as 10 or less or 5 or less. As a specific example, the multimer may comprise an AQ sequence at the N-terminal end.

    [0059] In certain embodiments, the multimer may comprise, or consist essentially, of a sequence selected from the group consisting of: SEQ ID NO 17, SEQ ID NO 18, SEQ ID NO 19, SEQ ID NO 20, SEQ ID NO 30, SEQ ID NO 31, SEQ ID NO 32, SEQ ID NO 33, SEQ ID NO 34 and SEQ ID NO 35. These sequences are listed below and named as Parent(Mutations)n, where n is the number of monomer units in a multimer.

    TABLE-US-00003 Zvar(Q9A,N11E,N43A)4 SEQIDNO17 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSQSAALLAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSQ SAALLAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAF IQSLKDDPSQSAALLAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRNAFIQSLKDDPSQSAALLAEAKKLNDAQAPKC Zvar(Q9A,N11E,N28A,N43A)4 SEQIDNO18 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRAAFIQSLKDDPSQSAALLAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRAAFIQSLKDDPSQ SAALLAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRAAF IQSLKDDPSQSAALLAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRAAFIQSLKDDPSQSAALLAEAKKLNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43E,L44I)4 SEQIDNO19 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKEILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSV SKEILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAF IQSLKDDPSVSKEILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRNAFIQSLKDDPSVSKEILAEAKKLNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)4 SEQIDNO20 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSV SKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAF IQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRNAFIQSLKDDPSVSKAILAEAKKLNDAQAPKC Zvar(N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y)4 SEQIDNO30 AQGTVDAKFDKEQQKAFYEILKLPNLTEEQRNAFIQKLKDEPSQSRAILAEAKR YNDAQAPKVDAKFDKEQQKAFYEILKLPNLTEEQRNAFIQKLKDEPSQ SRAILAEAKRYNDAQAPKVDAKFDKEQQKAFYEILKLPNLTEEQRNAF IQKLKDEPSQSRAILAEAKRYNDAQAPKVDAKFDKEQQKAFYEILKLP NLTEEQRNAFIQKLKDEPSQSRAILAEAKRYNDAQAPKC Zvar(Q9A,N11K,H18K,D37E,A42R)4 SEQIDNO31 AQGTVDAKFDKEAQKAFYEILKLPNLTEEQRNAFIQSLKDEPSQSRNLLAEAKK LNDAQAPKVDAKFDKEAQKAFYEILKLPNLTEEQRNAFIQSLKDEPSQ SRNLLAEAKKLNDAQAPKVDAKFDKEAQKAFYEILKLPNLTEEQRNAF IQSLKDEPSQSRNLLAEAKKLNDAQAPKVDAKFDKEAQKAFYEILKLP NLTEEQRNAFIQSLKDEPSQSRNLLAEAKKLNDAQAPKC Zvar(Q9A,N11E,N28A,Q40V,A42K,N43A,L44I)4 SEQIDNO32 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRAAFIQSLKDDPSVSKAILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRAAFIQSLKDDPSV SKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRAAF IQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRAAFIQSLKDDPSVSKAILAEAKKLNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)6 SEQIDNO33 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSV SKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAF IQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRNAFIQSLKDDPSVSKAILAEAKKLNDAQAPKVDAKFDKEAQ EAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKKLNDAQAPK VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,D37E,Q40V,A42K,N43A,L44I)4 SEQIDNO34 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDEPSVSKAILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDEPSV SKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAF IQSLKDEPSVSKAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRNAFIQSLKDEPSVSKAILAEAKKLNDAQAPKC Zvar(Q9A,N11E,D37E,Q40V,A42R,N43A,L44I)4 SEQIDNO35 AQGTVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDEPSVSRAILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDEPSV SRAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAF IQSLKDEPSVSRAILAEAKKLNDAQAPKVDAKFDKEAQEAFYEILHLP NLTEEQRNAFIQSLKDEPSVSRAILAEAKKLNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)2withD2,A3andK4inlinkerdeleted SEQIDNO80 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKVFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)2withK58,V1andD2inlinker deleted SEQIDNO81 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)2withP57,K58,V1,D2andA3in linkerdeleted SEQIDNO82 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)2withK4,F5,D6,K7andE8inlinker deleted SEQIDNO83 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKVDAAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)2withA56,P57andK58inlinker deleted SEQIDNO84 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKKLNDAQ VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)2withV1,D2andA3inlinkerdeleted SEQIDNO85 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L441)2withV1,D2,A3,K4,F5,D6,K7and E8inlinkerdeleted SEQIDNO86 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKC Zvar(Q9A,N11E,Q40V,A42K,N43A,L441)2withYEDGinsertedinlinkerbetween K58andV1 SEQIDNO87 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKYEDGVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSV SKAILAEAKKLNDAQAPKC Zvar2 SEQIDNO88 VDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSVSKAILAEAKK LNDAQAPKVDAKFDKEAQEAFYEILHLPNLTEEQRNAFIQSLKDDPSV SKAILAEAKKLNDAQAPKC

    [0060] In some embodiments, the polypeptide and/or multimer, as disclosed above, further comprises at the C-terminal or N-terminal end one or more coupling elements, selected from the group consisting of one or more cysteine residues, a plurality of lysine residues and a plurality of histidine residues. The coupling element(s) may also be located within 1-5 amino acid residues, such as within 1-3 or 1-2 amino acid residues from the C-terminal or N-terminal end. The coupling element may e.g. be a single cysteine at the C-terminal end. The coupling element(s) may be directly linked to the C- or N-terminal end, or it/they may be linked via a stretch comprising up to 15 amino acids, such as 1-5, 1-10 or 5-10 amino acids. This stretch should preferably also be sufficiently stable in alkaline environments not to impair the properties of the mutated protein. For this purpose, it is advantageous if the stretch does not contain asparagine. It can additionally be advantageous if the stretch does not contain glutamine. An advantage of having a C-terminal cysteine is that endpoint coupling of the protein can be achieved through reaction of the cysteine thiol with an electrophilic group on a support. This provides excellent mobility of the coupled protein which is important for the binding capacity.

    [0061] The alkali stability of the polypeptide or multimer can be assessed by coupling it to an SPR chip, e.g. to Biacore CM5 sensor chips as described in the examples, using e.g. NHS or maleimide coupling chemistries, and measuring the immunoglobulin-binding capacity of the chip, typically using polyclonal human IgG, before and after incubation in alkaline solutions at a specified temperature, e.g. 22+/2 C. The incubation can e.g. be performed in 0.5 M NaOH for a number of 10 min cycles, such as 100, 200 or 300 cycles. The IgG capacity of the matrix after 100 10 min incubation cycles in 0.5 M NaOH at 22+/2 C. can be at least 55, such as at least 60, at least 80 or at least 90% of the IgG capacity before the incubation. Alternatively, the remaining IgG capacity after 100 cycles for a particular mutant measured as above can be compared with the remaining IgG capacity for the parental polypeptide/multimer. In this case, the remaining IgG capacity for the mutant may be at least 105%, such as at least 110%, at least 125%, at least 150% or at least 200% of the parental polypeptide/multimer.

    [0062] In a third aspect the present invention discloses a nucleic acid encoding a polypeptide or multimer according to any embodiment disclosed above. Thus, the invention encompasses all forms of the present nucleic acid sequence such as the RNA and the DNA encoding the polypeptide or multimer. The invention embraces a vector, such as a plasmid, which in addition to the coding sequence comprises the required signal sequences for expression of the polypeptide or multimer according the invention. In one embodiment, the vector comprises nucleic acid encoding a multimer according to the invention, wherein the separate nucleic acids encoding each unit may have homologous or heterologous DNA sequences.

    [0063] In a fourth aspect the present invention discloses an expression system, which comprises, a nucleic acid or a vector as disclosed above. The expression system may e.g. be a gram-positive or gram-negative prokaryotic host cell system, e.g. E. coli or Bacillus sp. which has been modified to express the present polypeptide or multimer. In an alternative embodiment, the expression system is a eukaryotic host cell system, such as a yeast, e.g. Pichia pastoris or Saccharomyces cerevisiae, or mammalian cells, e.g. CHO cells.

    [0064] In a fifth aspect, the present invention discloses a separation matrix, wherein a plurality of polypeptides or multimers according to any embodiment disclosed above have been coupled to a solid support. Such a matrix is useful for separation of immunoglobulins or other Fc-containing proteins and, due to the improved alkali stability of the polypeptides/multimers, the matrix will withstand highly alkaline conditions during cleaning, which is essential for long-term repeated use in a bioprocess separation setting. The alkali stability of the matrix can be assessed by measuring the immunoglobulin-binding capacity, typically using polyclonal human IgG, before and after incubation in alkaline solutions at a specified temperature, e.g. 22+/2 C. The incubation can e.g. be performed in 0.5 M or 1.0 M NaOH for a number of 15 min cycles, such as 100, 200 or 300 cycles, corresponding to a total incubation time of 25, 50 or 75 h. The IgG capacity of the matrix after 96-100 15 min incubation cycles or a total incubation time of 24 or 25 h in 0.5 M NaOH at 22+/2 C. can be at least 80, such as at least 85, at least 90 or at least 95% of the IgG capacity before the incubation. The capacity of the matrix after a total incubation time of 24 h in 1.0 M NaOH at 22+/2 C. can be at least 70, such as at least 80 or at least 90% of the IgG capacity before the incubation.

    [0065] As the skilled person will understand, the expressed polypeptide or multimer should be purified to an appropriate extent before being immobilized to a support. Such purification methods are well known in the field, and the immobilization of protein-based ligands to supports is easily carried out using standard methods. Suitable methods and supports will be discussed below in more detail.

    [0066] The solid support of the matrix according to the invention can be of any suitable well-known kind. A conventional affinity separation matrix is often of organic nature and based on polymers that expose a hydrophilic surface to the aqueous media used, i.e. expose hydroxy (OH), carboxy (COOH), carboxamido (CONH.sub.2, possibly in N-substituted forms), amino (NH.sub.2, possibly in substituted form), oligo- or polyethylenoxy groups on their external and, if present, also on internal surfaces. The solid support can suitably be porous. The porosity can be expressed as a Kay or Kd value (the fraction of the pore volume available to a probe molecule of a particular size) measured by inverse size exclusion chromatography, e.g. according to the methods described in Gel Filtration Principles and Methods, Pharmacia LKB Biotechnology 1991, pp 6-13. By definition, both Kd and Kay values always lie within the range 0-1. The Kay value can advantageously be 0.6-0.95, e.g. 0.7-0.90 or 0.6-0.8, as measured with dextran of Mw 110 kDa as a probe molecule. An advantage of this is that the support has a large fraction of pores able to accommodate both the polypeptides/multimers of the invention and immunoglobulins binding to the polypeptides/multimers and to provide mass transport of the immunoglobulins to and from the binding sites.

    [0067] The polypeptides or multimers may be attached to the support via conventional coupling techniques utilising e.g. thiol, amino and/or carboxy groups present in the ligand. Bisepoxides, epichlorohydrin, CNBr, N-hydroxysuccinimide (NHS) etc are well-known coupling reagents. Between the support and the polypeptide/multimer, a molecule known as a spacer can be introduced, which improves the availability of the polypeptide/multimer and facilitates the chemical coupling of the polypeptide/multimer to the support. Depending on the nature of the polypeptide/multimer and the coupling conditions, the coupling may be a multipoint coupling (e.g. via a plurality of lysines) or a single point coupling (e.g. via a single cysteine). Alternatively, the polypeptide/multimer may be attached to the support by non-covalent bonding, such as physical adsorption or biospecific adsorption.

    [0068] In some embodiments the matrix comprises 5-25, such as 5-20 mg/ml, 5-15 mg/ml, 5-11 mg/ml or 6-11 mg/ml of the polypeptide or multimer coupled to the support. The amount of coupled polypeptide/multimer can be controlled by the concentration of polypeptide/multimer used in the coupling process, by the activation and coupling conditions used and/or by the pore structure of the support used. As a general rule the absolute binding capacity of the matrix increases with the amount of coupled polypeptide/multimer, at least up to a point where the pores become significantly constricted by the coupled polypeptide/multimer. The relative binding capacity per mg coupled polypeptide/multimer will decrease at high coupling levels, resulting in a cost-benefit optimum within the ranges specified above.

    [0069] In certain embodiments the polypeptides or multimers are coupled to the support via thioether bonds. Methods for performing such coupling are well-known in this field and easily performed by the skilled person in this field using standard techniques and equipment. Thioether bonds are flexible and stable and generally suited for use in affinity chromatography. In particular when the thioether bond is via a terminal or near-terminal cysteine residue on the polypeptide or multimer, the mobility of the coupled polypeptide/multimer is enhanced which provides improved binding capacity and binding kinetics. In some embodiments the polypeptide/multimer is coupled via a C-terminal cysteine provided on the protein as described above. This allows for efficient coupling of the cysteine thiol to electrophilic groups, e.g. epoxide groups, halohydrin groups etc. on a support, resulting in a thioether bridge coupling.

    [0070] In certain embodiments the support comprises a polyhydroxy polymer, such as a polysaccharide. Examples of polysaccharides include e.g. dextran, starch, cellulose, pullulan, agar, agarose etc. Polysaccharides are inherently hydrophilic with low degrees of nonspecific interactions, they provide a high content of reactive (activatable) hydroxyl groups and they are generally stable towards alkaline cleaning solutions used in bioprocessing.

    [0071] In some embodiments the support comprises agar or agarose. The supports used in the present invention can easily be prepared according to standard methods, such as inverse suspension gelation (S Hjertn: Biochim Biophys Acta 79(2), 393-398 (1964). Alternatively, the base matrices are commercially available products, such as crosslinked agarose beads sold under the name of SEPHAROSE FF (GE Healthcare). In an embodiment, which is especially advantageous for large-scale separations, the support has been adapted to increase its rigidity using the methods described in U.S. Pat. Nos. 6,602,990 or 7,396,467, which are hereby incorporated by reference in their entirety, and hence renders the matrix more suitable for high flow rates.

    [0072] In certain embodiments the support, such as a polysaccharide or agarose support, is crosslinked, such as with hydroxyalkyl ether crosslinks. Crosslinker reagents producing such crosslinks can be e.g. epihalohydrins like epichlorohydrin, diepoxides like butanediol diglycidyl ether, allylating reagents like allyl halides or allyl glycidyl ether. Crosslinking is beneficial for the rigidity of the support and improves the chemical stability. Hydroxyalkyl ether crosslinks are alkali stable and do not cause significant nonspecific adsorption.

    [0073] Alternatively, the solid support is based on synthetic polymers, such as polyvinyl alcohol, polyhydroxyalkyl acrylates, polyhydroxyalkyl methacrylates, polyacrylamides, polymethacrylamides etc. In case of hydrophobic polymers, such as matrices based on divinyl and monovinyl-substituted benzenes, the surface of the matrix is often hydrophilised to expose hydrophilic groups as defined above to a surrounding aqueous liquid. Such polymers are easily produced according to standard methods, see e.g. Styrene based polymer supports developed by suspension polymerization (R Arshady: Chimica e L'Industria 70(9), 70-75 (1988)). Alternatively, a commercially available product, such as SOURCE (GE Healthcare) is used. In another alternative, the solid support according to the invention comprises a support of inorganic nature, e.g. silica, zirconium oxide etc.

    [0074] In yet another embodiment, the solid support is in another form such as a surface, a chip, capillaries, or a filter (e.g. a membrane or a depth filter matrix).

    [0075] As regards the shape of the matrix according to the invention, in one embodiment the matrix is in the form of a porous monolith. In an alternative embodiment, the matrix is in beaded or particle form that can be porous or non-porous. Matrices in beaded or particle form can be used as a packed bed or in a suspended form. Suspended forms include those known as expanded beds and pure suspensions, in which the particles or beads are free to move. In case of monoliths, packed bed and expanded beds, the separation procedure commonly follows conventional chromatography with a concentration gradient. In case of pure suspension, batch-wise mode will be used.

    [0076] In a sixth aspect, the present invention discloses a method of isolating an immunoglobulin, wherein a separation matrix as disclosed above is used.

    [0077] In certain embodiments, the method comprises the steps of:

    a) contacting a liquid sample comprising an immunoglobulin with a separation matrix as disclosed above,
    b) washing said separation matrix with a washing liquid,
    c) eluting the immunoglobulin from the separation matrix with an elution liquid, and
    d) cleaning the separation matrix with a cleaning liquid, which can alternatively be called a cleaning-in-place (CIP) liquid, e.g. with a contact (incubation) time of at least 10 min.

    [0078] The method may also comprise steps of, before step a), providing an affinity separation matrix according to any of the embodiments described above and providing a solution comprising an immunoglobulin and at least one other substance as a liquid sample and of, after step c), recovering the eluate and optionally subjecting the eluate to further separation steps, e.g. by anion or cation exchange chromatography, multimodal chromatography and/or hydrophobic interaction chromatography. Suitable compositions of the liquid sample, the washing liquid and the elution liquid, as well as the general conditions for performing the separation are well known in the art of affinity chromatography and in particular in the art of Protein A chromatography. The liquid sample comprising an Fc-containing protein and at least one other substance may comprise host cell proteins (HCP), such as CHO cell, E Coli or yeast proteins. Contents of CHO cell and E Coli proteins can conveniently be determined by immunoassays directed towards these proteins, e.g. the CHO HCP or E Coli HCP ELISA kits from Cygnus Technologies. The host cell proteins or CHO cell/E Coli proteins may be desorbed during step b).

    [0079] The elution may be performed by using any suitable solution used for elution from Protein A media. This can e.g. be a solution or buffer with pH 5 or lower, such as pH 2.5-5 or 3-5. It can also in some cases be a solution or buffer with pH 11 or higher, such as pH 11-14 or pH 11-13. In some embodiments the elution buffer or the elution buffer gradient comprises at least one mono- di- or trifunctional carboxylic acid or salt of such a carboxylic acid. In certain embodiments the elution buffer or the elution buffer gradient comprises at least one anion species selected from the group consisting of acetate, citrate, glycine, succinate, phosphate, and formiate.

    [0080] In some embodiments, the cleaning liquid is alkaline, such as with a pH of 13-14. Such solutions provide efficient cleaning of the matrix, in particular at the upper end of the interval

    [0081] In certain embodiments, the cleaning liquid comprises 0.1-2.0 M NaOH or KOH, such as 0.5-2.0 or 0.5-1.0 M NaOH or KOH. These are efficient cleaning solutions, and in particular so when the NaOH or KOH concentration is above 0.1 M or at least 0.5 M. The high stability of the polypeptides of the invention enables the use of such strongly alkaline solutions.

    [0082] The method may also include a step of sanitizing the matrix with a sanitization liquid, which may e.g. comprise a peroxide, such as hydrogen peroxide and/or a peracid, such as peracetic acid or performic acid.

    [0083] In some embodiments, steps a)-d) are repeated at least 10 times, such as at least 50 times, 50-200, 50-300 or 50-500 times. This is important for the process economy in that the matrix can be re-used many times.

    [0084] Steps a)-c) can also be repeated at least 10 times, such as at least 50 times, 50-200, 50-300 or 50-500 times, with step d) being performed after a plurality of instances of step c), such that step d) is performed at least 10 times, such as at least 50 times. Step d) can e.g. be performed every second to twentieth instance of step c).

    EXAMPLES

    Mutagenesis of Protein

    [0085] Site-directed mutagenesis was performed by a two-step PCR using oligonucleotides coding for the mutations. As template a plasmid containing a single domain of either Z, B or C was used. The PCR fragments were ligated into an E. coli expression vector. DNA sequencing was used to verify the correct sequence of inserted fragments.

    [0086] To form multimers of mutants an Acc I site located in the starting codons (GTA GAC) of the B, C or Z domain was used, corresponding to amino acids VD. The vector for the monomeric domain was digested with Acc I and phosphatase treated. Acc I sticky-ends primers were designed, specific for each variant, and two overlapping PCR products were generated from each template. The PCR products were purified and the concentration was estimated by comparing the PCR products on a 2% agarose gel. Equal amounts of the pair wise PCR products were hybridized (90 C.>25 C. in 45 min) in ligation buffer. The resulting product consists approximately to of fragments likely to be ligated into an Acc I site (correct PCR fragments and/or the digested vector). After ligation and transformation colonies were PCR screened to identify constructs containing the desired mutant. Positive clones were verified by DNA sequencing.

    [0087] Construct Expression and Purification

    [0088] The constructs were expressed in the bacterial periplasm by fermentation of E. coli K12 in standard media. After fermentation the cells were heat-treated to release the periplasm content into the media. The constructs released into the medium were recovered by microfiltration with a membrane having a 0.2 m pore size.

    [0089] Each construct, now in the permeate from the filtration step, was purified by affinity. The permeate was loaded onto a chromatography medium containing immobilized IgG (IgG Sepharose 6FF, GE Healthcare). The loaded product was washed with phosphate buffered saline and eluted by lowering the pH.

    [0090] The elution pool was adjusted to a neutral pH (pH 8) and reduced by addition of dithiothreitol. The sample was then loaded onto an anion exchanger. After a wash step the construct was eluted in a NaCl gradient to separate it from any contaminants. The elution pool was concentrated by ultrafiltration to 40-50 mg/ml. It should be noted that the successful affinity purification of a construct on an immobilized IgG medium indicates that the construct in question has a high affinity to IgG.

    [0091] The purified ligands were analyzed with RPC LC-MS to determine the purity and to ascertain that the molecular weight corresponded to the expected (based on the amino acid sequence).

    Example 1

    [0092] The purified monomeric ligands listed in Table 1, further comprising for SEQ ID NO 8-16, 23-28 and 36-48 an AQGT leader sequence at the N-terminus and a cysteine at the C terminus, were immobilized on Biacore CM5 sensor chips (GE Healthcare, Sweden), using the amine coupling kit of GE Healthcare (for carbodiimide coupling of amines on the carboxymethyl groups on the chip) in an amount sufficient to give a signal strength of about 200-1500 RU in a Biacore surface plasmon resonance (SPR) instrument (GE Healthcare, Sweden). To follow the IgG binding capacity of the immobilized surface 1 mg/ml human polyclonal IgG (Gammanorm) was flowed over the chip and the signal strength (proportional to the amount of binding) was noted. The surface was then cleaned-in-place (CIP), i.e. flushed with 500 mM NaOH for 10 minutes at room temperature (22+/2 C.). This was repeated for 96-100 cycles and the immobilized ligand alkaline stability was followed as the remaining IgG binding capacity (signal strength) after each cycle. The results are shown in Table 1 and indicate that at least the ligands Zvar(N11K)1, Zvar(N11E)1, Zvar(N11Y)1, Zvar(N11T)1, Zvar(N11F)1, Zvar(N11L)1, Zvar(N11W)1, ZN11I)1, Zvar(N11M)1, Zvar(N11V)1, Zvar(N11A)1, Zvar(N11H1), Zvar(N11R)1, Zvar(N11E,Q32A)1, Zvar(N11E,Q32E,Q40E)1 and Zvar(N11E,Q32E,K50R)1, Zvar(Q9A,N11E,N43A)1, Zvar(Q9A,N11E,N28A,N43A)1, Zvar(Q9A,N11E,Q40V,A42K,N43E,L44I)1, Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)1, Zvar(Q9A,N11E,N28A,Q40V,A42K,N43A,L44I)1, Zvar(N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y)1, Zvar(Q9A,N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y)1, Zvar(N11K, H18K, D37E, A42R, N43A, L44I)1, Zvar(Q9A, N11K, H18K, D37E, A42R, N43A, L44I)1 and Zvar(Q9A, N11K, H18K, D37E, A42R, N43A, L44I, K50R)1, as well as the varieties of Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)1 having G,S,Y,Q,T,N,F,L,W,I,M,V,D,E,H,R or K in position 29, the varieties of Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)1 having F,Y,W,K or R in position 53 and the varieties of Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)1 where Q9, Q40,A42 or N43 has been deleted, have an improved alkali stability compared to the parental structure Zvar1, used as the reference. Further, the ligands B(Q9A,N11E,Q40V,A42K,N43A,L44I)1 and C(Q9A,N11E,E43A)1 have an improved stability compared to the parental B and C domains, used as references.

    TABLE-US-00004 TABLE 1 Monomeric ligands, evaluated by Biacore (0.5M NaOH). Reference Capacity Capacity capacity relative after 96- after 96- to Ligand Sequence 100 cycles 100 cycles reference Zvar(N11E,Q32A)1 SEQ ID 57% 55% 1.036 NO 12 Zvar(N11E)1 SEQ ID 59% 55% 1.073 NO 13 Zvar(N11E,Q32E,Q40E)1 SEQ ID 52% 51% 1.020 NO 14 Zvar(N11E,Q32E,K50R)1 SEQ ID 53% 51% 1.039 NO 15 Zvar(N11K)1 SEQ ID 62% 49% 1.270 NO 16 Zvar(N11Y)1 SEQ ID 55% 46% 1.20 NO 38 Zvar(N11T)1 SEQ ID 50% 46% 1.09 NO 39 Zvar(N11F)1 SEQ ID 55% 46% 1.20 NO 40 Zvar(N11L)1 SEQ ID 57% 47% 1.21 NO 41 Zvar(N11W)1 SEQ ID 57% 47% 1.21 NO 42 Zvar(N11I)1 SEQ ID 57% 47% 1.21 NO 43 Zvar(N11M)1 SEQ ID 58% 46% 1.26 NO 44 Zvar(N11V)1 SEQ ID 56% 46% 1.22 NO 45 Zvar(N11A)1 SEQ ID 58% 46% 1.26 NO 46 Zvar(N11H)1 SEQ ID 57% 46% 1.24 NO 47 Zvar(N11R)1 SEQ ID 59% 46% 1.28 NO 48 Zvar(Q9A,N11E,N43A)1 SEQ ID 70% 47% 1.49 NO 8 Zvar(Q9A,N11E,N28A,N43A)1 SEQ ID 68% 47% 1.45 NO 9 Zvar(Q9A,N11E,Q40V,A42K,N43E,L44I)1 SEQ ID 67% 47% 1.43 NO 10 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)1 SEQ ID 66% 47% 1.40 NO 11 Zvar(Q9A,N11E,N28A,Q40V,A42K,N43A,L44I)1 SEQ ID 65% 48% 1.35 NO 24 Zvar(N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y)1 SEQ ID 67% 46% 1.46 NO 23 Zvar(Q9A,N11K,H18K,S33K,D37E,A42R,N43A,L44I,K50R,L51Y)1 SEQ ID 59% 46% 1.28 NO 25 Zvar(N11K,H18K,D37E,A42R,N43A,L44I)1 SEQ ID 59% 45% 1.31 NO 26 Zvar(Q9A,N11K,H18K,D37E,A42R,N43A,L44I)1 SEQ ID 63% 45% 1.40 NO 27 Zvar(Q9A,N11K,H18K,D37E,A42R,N43A,L44I,K50R)1 SEQ ID 67% 45% 1.49 NO 28 B(Q9A,N11E,Q40V,A42K,N43A,L44I)1 SEQ ID 39% 35% 1.11 NO 36 C(Q9A,N11E,E43A)1 SEQ ID 60% 49% 1.22 NO 37 Zvar(Q9A,N11E,A29G,Q40V,A42K,N43A,L44I)1 SEQ ID 69% 48% 1.44 NO 54 Zvar(Q9A,N11E,A29S,Q40V,A42K,N43A,L44I)1 SEQ ID 66% 48% 1.38 NO 55 Zvar(Q9A,N11E,A29Y,Q40V,A42K,N43A,L44I)1 SEQ ID 61% 48% 1.27 NO 56 Zvar(Q9A,N11E,A29Q,Q40V,A42K,N43A,L44I)1 SEQ ID 60% 47% 1.28 NO 57 Zvar(Q9A,N11E,A29T,Q40V,A42K,N43A,L44I)1 SEQ ID 60% 47% 1.28 NO 58 Zvar(Q9A,N11E,A29N,Q40V,A42K,N43A,L44I)1 SEQ ID 61% 47% 1.30 NO 59 Zvar(Q9A,N11E,A29F,Q40V,A42K,N43A,L44I)1 SEQ ID 62% 46% 1.35 NO 60 Zvar(Q9A,N11E,A29L,Q40V,A42K,N43A,L44I)1 SEQ ID 61% 46% 1.33 NO 61 Zvar(Q9A,N11E,A29W,Q40V,A42K,N43A,L44I)1 SEQ ID 60% 46% 1.30 NO 62 Zvar(Q9A,N11E,A29I,Q40V,A42K,N43A,L44I)1 SEQ ID 58% 47% 1.23 NO 63 Zvar(Q9A,N11E,A29M,Q40V,A42K,N43A,L44I)1 SEQ ID 62% 47% 1.32 NO 64 Zvar(Q9A,N11E,A29V,Q40V,A42K,N43A,L44I)1 SEQ ID 62% 47% 1.32 NO 65 Zvar(Q9A,N11E,A29D,Q40V,A42K,N43A,L44I)1 SEQ ID 56% 47% 1.19 NO 66 Zvar(Q9A,N11E,A29E,Q40V,A42K,N43A,L44I)1 SEQ ID 57% 47% 1.21 NO 67 Zvar(Q9A,N11E,A29H,Q40V,A42K,N43A,L44I)1 SEQ ID 57% 47% 1.21 NO 68 Zvar(Q9A,N11E,A29R,Q40V,A42K,N43A,L44I)1 SEQ ID 58% 46% 1.26 NO 69 Zvar(Q9A,N11E,A29K,Q40V,A42K,N43A,L44I)1 SEQ ID 59% 46% 1.28 NO 70 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53F)1 SEQ ID 58% 46% 1.26 NO 71 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53Y)1 SEQ ID 59% 46% 1.28 NO 72 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53W)1 SEQ ID 62% 46% 1.35 NO 73 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53K)1 SEQ ID 65% 46% 1.41 NO 74 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I,D53R)1 SEQ ID 60% 46% 1.30 NO 75 Zvar(Q9del,N11E,Q40V,A42K,N43A,L44I)1 SEQ ID 60% 46% 1.30 NO 76 Zvar(Q9A,N11E,Q40del,A42K,N43A,L44I)1 SEQ ID 59% 46% 1.28 NO 77 Zvar(Q9A,N11E,Q40V,A42del,N43A,L44I)1 SEQ ID 57% 46% 1.24 NO 78 Zvar(Q9A,N11E,Q40V,A42K,N43del,L44I)1 SEQ ID 55% 46% 1.20 NO 79

    Example 2

    [0093] The purified dimeric, tetrameric and hexameric ligands listed in Table 2 were immobilized on Biacore CM5 sensor chips (GE Healthcare, Sweden), using the amine coupling kit of GE Healthcare (for carbodiimide coupling of amines on the carboxymethyl groups on the chip) in an amount sufficient to give a signal strength of about 200-1500 RU in a Biacore instrument (GE Healthcare, Sweden). To follow the IgG binding capacity of the immobilized surface 1 mg/ml human polyclonal IgG (Gammanorm) was flowed over the chip and the signal strength (proportional to the amount of binding) was noted. The surface was then cleaned-in-place (CIP), i.e. flushed with 500 mM NaOH for 10 minutes at room temperature (22+/2 C.). This was repeated for 300 cycles and the immobilized ligand alkaline stability was followed as the remaining IgG binding capacity (signal strength) after each cycle. The results are shown in Table 2 and in FIG. 2 and indicate that at least the ligands Zvar(Q9A,N11E,N43A)4, Zvar(Q9A,N11E,N28A,N43A)4, Zvar(Q9A,N11E,Q40V,A42K,N43E,L44I)4 and Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)4, Zvar(Q9A,N11E,D37E,Q40V,A42K,N43A,L44I)4 and Zvar(Q9A,N11E,D37E,Q40V,A42R,N43A,L44I)4 have an improved alkali stability compared to the parental structure Zvar4, which was used as a reference. The hexameric ligand Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)6 also has improved alkali stability compared to the parental structure Zvar6, used as a reference. Further, Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I) dimers with deletions of a) D2,A3,K4; b) K58,V1,D2; c) P57,K58,V1,D2,A3; d) K4,F5,D6,K7,E8; e) A56,P57,K58; V1,D2,A3 or f) V1,D2,A3,K4,F5,D6,K7,E8 from the linker region between the two monomer units have improved alkali stability compared to the parental structure Zvar2, used as a reference. Also Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I) dimers with an insertion of YEDG between K58 and V1 in the linker region have improved alkali stability compared to Zvar2.

    TABLE-US-00005 TABLE 2 Dimeric, tetrameric and hexameric ligands, evaluated by Biacore (0.5M NaOH). Remaining Capacity Remaining Capacity Remaining Capacity capacity relative capacity relative capacity relative SEQ 100 cycles to ref. 200 cycles to ref. 300 cycles to ref. Ligand ID NO: (%) 100 cycles (%) 200 cycles (%) 300 cycles Zvar4 21 67 1 36 1 16 1 Zvar(Q9A, N11E, N43A)4 17 81 1.21 62 1.72 41 2.56 Zvar(Q9A, N11E, N28A, 18 80 1.19 62 1.72 42 2.62 N43A)4 Zvar(Q9A, N11E, Q40V, 19 84 1.25 65 1.81 48 3.00 A42K, N43E, L44I)4 Zvar(Q9A, N11E, Q40V, 20 90 1.34 74 2.06 57 3.56 A42K, N43A, L44I)4 Zvar(Q9A, N11E, N28A, 32 84 1.24 Not tested Not tested Not tested Not tested Q40V, A42K, N43A, L44I)4 Zvar(Q9A, N11E, Q40V, 33 87 1.30 Not tested Not tested Not tested Not tested A42K, N43A, L44I)6 Zvar(Q9A, N11E, D37E, 34 81 1.13 Not tested Not tested Not tested Not tested Q40V, A42K, N43A, L44I)4 Zvar(Q9A, N11E, D37E, 35 84 1.17 Not tested Not tested Not tested Not tested Q40V, A42R, N43A, L44I)4 Zvar(Q9A, N11E, Q40V, 80 70 1.27 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with D2, A3 and K4 in linker deleted Zvar(Q9A, N11E, Q40V, 81 76 1.38 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with K58, V1 and D2 in linker deleted Zvar(Q9A, N11E, Q40V, 82 74 1.35 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with P57, K58, V1, D2 and A3 in linker deleted Zvar(Q9A, N11E, Q40V, 83 70 1.30 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with K4, F5, D6, K7 and E8 in linker deleted Zvar(Q9A, N11E, Q40V, 84 68 1.26 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with A56, P57 and K58 in linker deleted Zvar(Q9A, N11E, Q40V, 85 75 1.39 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with V1, D2 and A3 in linker deleted Zvar(Q9A, N11E, Q40V, 86 62 1.13 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with V1, D2, A3, K4, F5, D6, K7 and E8 in linker deleted Zvar(Q9A, N11E, Q40V, 87 72 1.31 Not tested Not tested Not tested Not tested A42K, N43A, L44I)2 with YEDG inserted in linker between K58 and V1 Zvar2 88 55 1 Not tested Not tested Not tested Not tested

    Example 3

    [0094] Example 2 was repeated with 100 CIP cycles of three ligands using 1 M NaOH instead of 500 mM as in Example 2. The results are shown in Table 3 and show that all three ligands have an improved alkali stability also in 1M NaOH, compared to the parental structure Zvar4 which was used as a reference.

    TABLE-US-00006 TABLE 3 Tetrameric ligands, evaluated by Biacore (1M NaOH). Remaining Capacity capacity 100 relative to Ligand Sequence cycles (%) ref. 100 cycles Zvar4 SEQ ID NO 21 27 1 Zvar(Q9A,N11E,N28A,N43A)4 SEQ ID NO 18 55 2.04 Zvar(Q9A,N11E,Q40V,A42K,N43E,L44I)4 SEQ ID NO 19 54 2.00 Zvar(Q9A,N11E,Q40V,A42K,N43A,L44I)4 SEQ ID NO 20 56 2.07

    Example 4

    [0095] The purified tetrameric ligands of Table 2 (all with an additional N-terminal cysteine) were immobilized on agarose beads using the methods described below and assessed for capacity and stability. The results are shown in Table 4 and FIG. 3.

    TABLE-US-00007 TABLE 4 Matrices with tetrametric ligands, evaluated in columns (0.5M NaOH). Remaining IgG Remaining Capacity Initial capacity IgG retention IgG Qb10 capacity relative Ligand capacity after six after six to ref. SEQ content Qb10 4 h cycles 4 h cycles after six Ligand ID NO. (mg/ml) (mg/ml) (mg/ml) (%) 4 h cycles Zvar4 21 7 52.5 36.5 60 1 Zvar4 21 12 61.1 43.4 71 1 Zvar(Q9A, N11E, N28A, N43A)4 18 7.0 49.1 44.1 90 1.50 Zvar(Q9A, N11E, N28A, N43A)4 18 12.1 50.0 46.2 93 1.31 Zvar(Q9A, N11E, Q40V, A42K, N43A, L44I)4 20 7.2 49.0 44.2 90 1.50 Zvar(Q9A, N11E, Q40V, A42K, N43A, L44I)4 20 12.8 56.3 53.6 95 1.34 Zvar(N11K, H18K, S33K, D37E, A42R, N43A, 30 9.7 56.3 52.0 92 1.53 L44I, K50R, L51Y)4 Zvar(Q9A, N11K, H18K, D37E, A42R)4 31 10.8 56.9 52.5 92 1.30

    [0096] Activation

    [0097] The base matrix used was rigid cross-linked agarose beads of 85 micrometers (volume-weighted, d50V) median diameter, prepared according to the methods of U.S. Pat. No. 6,602,990 and with a pore size corresponding to an inverse gel filtration chromatography Kay value of 0.70 for dextran of Mw 110 kDa, according to the methods described in Gel Filtration Principles and Methods, Pharmacia LKB Biotechnology 1991, pp 6-13.

    [0098] 25 mL (g) of drained base matrix, 10.0 mL distilled water and 2.02 g NaOH (s) was mixed in a 100 mL flask with mechanical stirring for 10 min at 25 C. 4.0 mL of epichlorohydrin was added and the reaction progressed for 2 hours. The activated gel was washed with 10 gel sediment volumes (GV) of water.

    [0099] Coupling

    [0100] To 20 mL of ligand solution (50 mg/mL) in a 50 ml Falcon tube, 169 mg NaHCO.sub.3, 21 mg Na.sub.2CO.sub.3, 175 mg NaCl and 7 mg EDTA, was added. The Falcon tube was placed on a roller table for 5-10 min, and then 77 mg of DTE was added. Reduction proceeded for >45 min. The ligand solution was then desalted on a PD10 column packed with Sephadex G-25. The ligand content in the desalted solution was determined by measuring the 276 nm UV absorption.

    [0101] The activated gel was washed with 3-5 GV {0.1 M phosphate/1 mM EDTA pH 8.6} and the ligand was then coupled according to the method described in U.S. Pat. No. 6,399,750. All buffers used in the experiments had been degassed by nitrogen gas for at least 5-10 min. The ligand content of the gels could be controlled by varying the amount and concentration of the ligand solution.

    [0102] After immobilization the gels were washed 3GV with distilled water. The gels+1 GV {0.1 M phosphate/1 mM EDTA/10% thioglycerol pH 8.6} was mixed and the tubes were left in a shaking table at room temperature overnight. The gels were then washed alternately with 3GV {0.1 M TRIS/0.15 M NaCl pH 8.6} and 0.5 M HAc and then 8-10GV with distilled water. Gel samples were sent to an external laboratory for amino acid analysis and the ligand content (mg/ml gel) was calculated from the total amino acid content.

    [0103] Protein

    [0104] Gammanorm 165 mg/ml (Octapharma), diluted to 2 mg/ml in Equilibration buffer.

    [0105] Equilibration Buffer

    [0106] PBS Phosphate buffer 10 mM+0.14 M NaCl+0.0027 M KCl, pH 7.4 (Medicago)

    [0107] Adsorption Buffer

    [0108] PBS Phosphate buffer 10 mM+0.14 M NaCl+0.0027 M KCl, pH 7.4 (Medicago)

    [0109] Elution Buffers

    [0110] 100 mM acetate pH 2.9

    [0111] Dynamic Binding Capacity

    [0112] 2 ml of resin was packed in TRICORN 5 100 columns. The breakthrough capacity was determined with an KTAExplorer 10 system at a residence time of 6 minutes (0.33 ml/min flow rate). Equilibration buffer was run through the bypass column until a stable baseline was obtained. This was done prior to auto zeroing. Sample was applied to the column until a 100% UV signal was obtained. Then, equilibration buffer was applied again until a stable baseline was obtained.

    [0113] Sample was loaded onto the column until a UV signal of 85% of maximum absorbance was reached. The column was then washed with 5 column volumes (CV) equilibration buffer at flow rate 0.5 ml/min. The protein was eluted with 5 CV elution buffer at a flow rate of 0.5 ml/min. Then the column was cleaned with 0.5M NaOH at flow rate 0.2 ml/min and re-equilibrated with equilibration buffer.

    [0114] For calculation of breakthrough capacity at 10%, the equation below was used. That is the amount of IgG that is loaded onto the column until the concentration of IgG in the column effluent is 10% of the IgG concentration in the feed.

    [00001] q 10 .Math. % = C 0 V C [ V app - V sys - V sys V app .Math. A .Math. ( V ) - A sub A 100 .Math. % - A sub * dv ]

    [0115] A.sub.100%=100% UV signal;

    [0116] A.sub.sub=absorbance contribution from non-binding IgG subclass;

    [0117] A(V)=absorbance at a given applied volume;

    [0118] V.sub.c=column volume;

    [0119] V.sub.app=volume applied until 10% breakthrough;

    [0120] V.sub.sys=system dead volume;

    [0121] C.sub.0=feed concentration.

    [0122] The dynamic binding capacity (DBC) at 10% breakthrough was calculated. The dynamic binding capacity (DBC) was calculated for 10 and 80% breakthrough.

    [0123] CIP0.5 M NaOH

    [0124] The 10% breakthrough DBC (Qb10) was determined both before and after repeated exposures to alkaline cleaning solutions. Each cycle included a CIP step with 0.5 M NaOH pumped through the column at a rate of 0.5/min for 20 min, after which the column was left standing for 4 h. The exposure took place at room temperature (22+/2 C.). After this incubation, the column was washed with equilibration buffer for 20 min at a flow rate of 0.5 ml/min. Table 4 shows the remaining capacity after six 4 h cycles (i.e. 24 h cumulative exposure time to 0.5 M NaOH), both in absolute numbers and relative to the initial capacity.

    Example 5

    [0125] Example 4 was repeated with the tetrameric ligands shown in Table 5, but with 1.0 M NaOH used in the CIP steps instead of 0.5 M. The results are shown in Table 5 and in FIG. 4.

    TABLE-US-00008 TABLE 5 Matrices with tetrametric ligands, evaluated in columns - 1.0M NaOH. Remaining IgG Remaining Capacity Initial capacity IgG retention IgG Qb10 capacity relative Ligand capacity after six after six to ref. SEQ content Qb10 4 h cycles 4 h cycles after six Ligand ID NO. (mg/ml) (mg/ml) (mg/ml) (%) 4 h cycles Zvar4 21 12 60.1 33.5 56 1 Zvar(Q9A, N11E, Q40V, A42K, N43A, L44I)4 20 12.8 60.3 56.0 93 1.67 Zvar(N11K, H18K, S33K, D37E, A42R, N43A, 30 9.7 62.1 48.1 77 1.44 L44I, K50R, L51Y)4

    [0126] This written description uses examples to disclose the invention, including the best mode, and also to enable any person skilled in the art to practice the invention, including making and using any devices or systems and performing any incorporated methods. The patentable scope of the invention is defined by the claims, and may include other examples that occur to those skilled in the art. Such other examples are intended to be within the scope of the claims if they have structural elements that do not differ from the literal language of the claims, or if they include equivalent structural elements with insubstantial differences from the literal languages of the claims. All patents and patent applications mentioned in the text are hereby incorporated by reference in their entireties, as if they were individually incorporated.