Luciferase showing orange luminescence

10287556 ยท 2019-05-14

Assignee

Inventors

Cpc classification

International classification

Abstract

A luciferase that includes an amino acid sequence in which a mutation is introduced into an amino acid sequence of a luciferase derived from Luciora kuroiwae. The luciferase catalyzes a luminescence reaction that generates luminescence having the maximum luminescent wavelength of 570 nm to 610 nm. The luminescence has an intensity at least 10 times higher than that of luminescence generated in a luminescence reaction catalyzed by a luciferase derived from Rhagophthalmus ohbai.

Claims

1. A luciferase comprising an amino acid sequence which has 95% or more homology to the entire length of the amino acid sequence of SEQ ID NO: 40 and which has a glycine residue and an alanine residue at positions corresponding to the 283rd and 256th positions from the N-terminal side of SEO ID NO: 40, respectively, wherein the amino acid sequence is a luciferase that catalyzes a luminescence reaction that generates luminescence having the maximum luminescent wavelength of 570 nm to 610 nm.

2. A luciferase comprising an amino acid sequence which has 95% or more homology to the entire length of the amino acid sequence of SEQ ID NO: 42 and which has a glycine residue and an alanine residue at positions corresponding to the 283rd and 256th positions from the N-terminal side of SEQ ID NO: 42, respectively, wherein the amino acid sequence is a luciferase that catalyzes a luminescence reaction that generates luminescence having the maximum luminescent wavelength of 570 nm to 610 nm.

3. The luciferase according to claim 1, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 40 is 98% or more.

4. The luciferase according to claim 1, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 40 is 99% or more.

5. The luciferase according to claim 1, wherein the luciferase has the amino acid sequence of SEQ ID NO: 40.

6. The luciferase according to claim 2, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 42 is 98% or more.

7. The luciferase according to claim 2, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 42 is 99% or more.

8. The luciferase according to claim 2, wherein the luciferase has the amino acid sequence of SEQ ID NO: 42.

9. A luciferase comprising an amino acid sequence which has 95% or more homology to the entire length of the amino acid sequence of SEQ ID NO: 38 and which has a glycine residue and an alanine residue at positions corresponding to the 283rd and 256th positions from the N-terminal side of SEQ ID NO: 38, respectively, wherein the amino acid sequence is a luciferase that catalyzes a luminescence reaction that generates luminescence having the maximum luminescent wavelength of 570 nm to 610 nm.

10. The luciferase according to claim 9, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 38 is 96% or more.

11. The luciferase according to claim 9, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 38 is 97% or more.

12. The luciferase according to claim 9, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 38 is 98% or more.

13. The luciferase according to claim 9, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 38 is 99% or more.

14. The luciferase according to claim 9, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 38 is 99.5% or more.

15. The luciferase according to claim 9, wherein the homology to the entire length of the amino acid sequence of SEQ ID NO: 38 is 99.8% or more.

16. The luciferase according to claim 9, wherein the luciferase has the amino acid sequence of SEQ ID NO: 38.

Description

BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING

(1) FIG. 1 is a view showing luminescence excited in HeLa cells containing various types of luciferases in a case where D-luciferin is used as a luminescent substrate.

(2) FIG. 2 is a view showing luminescence intensities of luminescence excited by various types of luciferases in a case where D-luciferin is used as a substrate.

(3) FIG. 3 is a view showing luminescence spectrums of luminescence excited by various types of luciferases in a case where D-luciferin is used as a substrate.

DETAILED DESCRIPTION OF THE INVENTION

(4) A first embodiment of the present invention is a luciferase.

(5) The luciferase generally refers to an enzyme which catalyzes a chemical reaction causing luminescence. A substance which serves as a substrate of the enzyme is called luciferin. When the luciferin is chemically changed by catalysis of the luciferase in the presence of ATP, luminescence occurs. At this time, luciferases derived from firefly and luciferases derived from a bacterium are obtained. The luciferase according to the embodiment has the same definition as described above, and the luciferase is derived from firefly described below.

(6) With respect to the embodiment, the luciferin means a luciferin and an analog thereof which serve as a substrate of firefly luciferase. The luciferin is, for example, substances described as a substrate in WO 2009/096197 and WO 2010/106896. Specifically, they include, for example, dimethylaniline-monoene type luciferins, dimethylaniline-diene type luciferins, dimethylaniline type luciferins, D-luciferin, and derivatives thereof.

(7) The luciferase according to the embodiment has an amino acid sequence in which a mutation is introduced into an amino acid sequence of SEQ ID NO: 38

(8) The amino acid sequence of SEQ ID NO: 38 is a sequence in which a mutation is introduced into the amino acid sequence (SEQ ID NO: 1) of a wild type luciferase obtained from Luciora kuroiwae. Luciora kuroiwae is a firefly belonging to the genus Luciola, the family Lampyridae, the order Coleoptera, the class Insecta, the phylum Arthropoda. The amino acid sequence of SEQ ID NO: 38 is a sequence in which a serine residue at the 283rd position from the N-terminal side in the amino acid sequence of SEQ ID NO: 1 is substituted by a glycine residue. In the present application, the substitution mutation as described above may be expressed as S283G mutation or S283G, and the luciferase having the amino acid sequence of SEQ ID NO: 38 may be expressed as S283G mutant or mutant 1.

(9) The wild type luciferase obtained from Luciora kuroiwae has the following amino acid sequence:

(10) TABLE-US-00001 (SEQIDNO:1) MEKEENVIYGPEPFYPVEEGSAGTQLHRFMERYAKMGAICFSNALTGQDV TYAEYFDRSVRLAEALRRHGLTPEKKIGICSENCLEFFIPVLSGAYIASP VAPTNEIYTIRELVHSFGISEPMIVFSSKKGLDKVLEVQKTVHSIKTIVI IDSSTTYRGYDSMDAFVKKYVPANFNLSEFKTVEVDNETHTLLIMNSSGS TGLPKGVLVRHCGAVTRFSHCRDPIFGNQVSPGTAILTVVPFHHGFGMFT TLGYFVCGYRIVMLTKFDDEVLLKTLQDYKCTSVILVPTLFAILNRSELL EKFDLSNLTEIASGGAPLAKEVGEAVARRFNLPGVRQGYGLTETTSAFII TPEGDDKPGASGKVVPLMKVKVIDLDTKKTLGPNRRGEICVKGPMLMTGY EKNPTETKEIIDEDGWLHSGDIGYWDEDHHFFIVDRLKSLIKYKGYQVPP AELESVLLQHPNIFDAGVAGIPDPEAGELPGAVVVLEKGKHLTEQEVLDY VAGQVYNAKRLRGGVRFVDEVPKGLTGKIDAKAIREILKKPQAKM

(11) The S283G mutant (mutant 1) has the following amino acid sequence:

(12) TABLE-US-00002 (SEQIDNO:38) MEKEENVIYGPEPFYPVEEGSAGTQLHRFMERYAKMGAICFSNALTGQDV TYAEYFDRSVRLAEALRRHGLTPEKKIGICSENCLEFFIPVLSGAYIASP VAPTNEIYTIRELVHSFGISEPMIVFSSKKGLDKVLEVQKTVHSIKTIVI IDSSTTYRGYDSMDAFVKKYVPANFNLSEFKTVEVDNETHTLLIMNSSGS TGLPKGVLVRHCGAVTRFSHCRDPIFGNQVSPGTAILTVVPFHHGFGMFT TLGYFVCGYRIVMLTKFDDEVLLKTLQDYKCTGVILVPTLFAILNRSELL EKFDLSNLTEIASGGAPLAKEVGEAVARRFNLPGVRQGYGLTETTSAFII TPEGDDKPGASGKVVPLMKVKVIDLDTKKTLGPNRRGEICVKGPMLMTGY EKNPTETKEIIDEDGWLHSGDIGYWDEDHHFFIVDRLKSLIKYKGYQVPP AELESVLLQHPNIFDAGVAGIPDPEAGELPGAVVVLEKGKHLTEQEVLDY VAGQVYNAKRLRGGVRFVDEVPKGLTGKIDAKAIREILKKPQAKM

(13) The mutation which is introduced into the amino acid sequence of SEQ ID NO: 38 is, for example, substitution, deletion and/or addition of the amino acid residue. The mutation may be introduced into one site on the amino acid sequence of SEQ ID NO: 38, or may be introduced into multiple sites on the amino acid sequence of SEQ ID NO: 38. The amino acid sequence of the luciferase according to the embodiment and the original amino acid sequence of SEQ ID NO: 38 may have a given homology. For example, the amino acid sequences have a homology of 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more, 99.5% or more, or 99.8% or more.

(14) The luciferase according to the embodiment catalyzes a luminescence reaction which generates luminescence having the maximum luminescent wavelength of 570 nm to 610 nm.

(15) The light having a wavelength of 570 nm to 610 nm is generally orange light. The maximum luminescent wavelength of the luminescence caused by the luciferase according to the embodiment is preferably within a range of 580 nm to 600 nm, more preferably 585 nm to 595 nm, most preferably about 590 nm.

(16) The luminescence caused by the luciferase according to the embodiment has the maximum luminescent wavelength in the range described above, but lights having wavelengths beyond the range may be contained. It is preferable, however, that the light intensity of the wavelengths beyond the range is small.

(17) According to the luciferase of the embodiment, the orange luminescence can be obtained at a temperature suitable for culture of organisms. Preferably, according to the luciferase of the embodiment, the orange luminescence can be obtained in a temperature range suitable for culture of mammal cells, where the temperature is, for example, from 32 C. to 42 C., more specifically from 35 C. to 39 C., particularly about 37 C.

(18) According to the luciferase of the embodiment, the luminescence having an intensity higher than that of the conventional orange luciferase can be obtained. For example, the luminescence has an intensity at least 10 times higher, preferably at least 20 times higher, more preferably at least 29 times higher, than that of an orange luciferase derived from Rhagophthalmus ohbai (which is commercially available as SLO luciferase from Toyobo Co., Ltd.).

(19) The SLO luciferase (manufactured by Toyobo Co., Ltd.) has the following amino acid sequence:

(20) TABLE-US-00003 (SEQIDNO:48) MANEIILHGAKPRDPLDLGTAGIQLYRALTNFSFLREALIDAHTEEVVSY ADILENSCRLAKCYENYGLRQNSVISVCSENSTIFFYPVIAALYMGVITA TVNDSYTERELLETLNISKPELVFCSKKAIKNMMALKRNVNFIKKVVLLD SKEDMGEAQCLSNFMARYSEPNLDVRNFKPRDFDAKEQVALIMSSSGTTG LPKGVVLTHRNLSVRFVHCKDPLFGNRTIPSTSILSIVPFHHAFGMFTTL SYFIVGLRVVLLKRFEEKFFLSTIEKYRIPTIVLAPPVMVFLAKSPLVDQ YDLSSIREVATGGAPVGTEVAVAVAKRLKIGGILQGYGLTETCCAVLITP HDDVKTGSTGRVAPYVQAKIVDLTTGKSLGPNKRGELCFKSEIIMKGYFN NKQATEEAIDKEGWLHSGDVGYYDDDGHFFVVDRLKELIKYKGYQVAPAE LEWLLLQHPSIKDAGVTGVPDEAAGELPGACIVLQEGKSLTEQEIIDYIA ERVSPTKRIRGGVVFVDDIPKGATGKLVRSELRKLLAQKKSKL

(21) In addition, the gene of the SLO luciferase (manufactured by Toyobo Co., Ltd.) has the following base sequence:

(22) TABLE-US-00004 (SEQIDNO:49) ATGGCTAACGAGATCATCCTGCACGGCGCCAAGCCCAGGGACCCCCTGGA CCTGGGCACCGCCGGCATTCAGCTCTACAGGGCCCTGACCAACTTCTCCT TCCTGAGGGAGGCCCTGATCGACGCCCACACCGAGGAGGTGGTGTCTTAC GCCGACATCCTGGAGAACAGCTGTAGACTGGCTAAGTGCTACGAGAACTA CGGCCTGCGCCAGAACAGCGTGATCTCCGTGTGCAGCGAGAATAGCACCA TCTTCTTCTACCCCGTGATCGCCGCCCTGTACATGGGCGTGATCACCGCC ACCGTGAACGACAGCTACACCGAGCGGGAGCTGCTGGAGACCCTGAACAT CTCCAAGCCCGAACTGGTGTTCTGCTCCAAGAAGGCCATCAAGAACATGA TGGCCCTGAAGAGGAACGTGAACTTCATCAAGAAGGTGGTGCTGCTGGAC AGCAAGGAGGATATGGGCGAGGCCCAGTGCCTGAGCAACTTCATGGCCCG GTACTCCGAGCCCAACCTGGACGTGAGAAACTTCAAGCCAAGGGACTTCG ACGCCAAGGAGCAGGTGGCCCTTATTATGTCCTCCTCTGGCACCACCGGC CTGCCAAAGGGCGTGGTGCTGACCCACAGGAACCTGAGCGTGCGCTTCGT CCACTGCAAGGACCCCCTGTTCGGCAACAGAACCATCCCCTCCACCTCCA TCCTGTCCATCGTGCCCTTCCACCACGCCTTCGGAATGTTCACAACCCTG TCCTACTTCATCGTGGGCCTGAGAGTGGTGCTGCTGAAGAGATTCGAGGA GAAGTTCTTCCTGAGCACCATCGAGAAGTACAGAATCCCAACAATCGTGC TGGCCCCTCCTGTGATGGTGTTCCTGGCTAAGAGCCCCCTGGTGGACCAG TACGACCTGTCCAGCATCAGAGAGGTGGCCACCGGCGGCGCCCCTGTGGG CACCGAGGTTGCCGTGGCCGTGGCCAAGCGGCTGAAGATCGGCGGCATCC TCCAGGGCTACGGCCTGACCGAGACCTGCTGCGCCGTGCTGATCACCCCC CACGACGACGTGAAGACCGGCTCCACCGGCAGGGTAGCCCCCTACGTGCA GGCTAAGATCGTGGACCTGACCACCGGCAAGTCCCTGGGACCTAACAAGA GAGGCGAGCTGTGCTTCAAGAGCGAGATCATCATGAAGGGCTACTTCAAC AACAAGCAGGCCACCGAGGAGGCCATCGACAAGGAGGGCTGGCTGCACTC CGGCGACGTGGGATACTACGACGACGATGGACATTTCTTCGTGGTGGACC GGCTGAAAGAGCTGATCAAGTACAAGGGCTACCAGGTGGCCCCCGCCGAG CTGGAGTGGCTGCTGCTCCAGCACCCATCCATCAAGGATGCCGGCGTGAC CGGCGTGCCCGACGAGGCCGCCGGCGAGCTGCCCGGCGCCTGCATCGTGC TCCAGGAGGGCAAGAGCCTGACCGAGCAGGAGATCATCGACTACATCGCC GAGCGAGTGTCTCCCACCAAGCGCATCCGGGGCGGAGTCGTCTTCGTGGA CGACATCCCCAAGGGCGCCACCGGCAAGCTGGTGAGAAGCGAGCTGCGGA AGCTGCTGGCCCAGAAGAAGTCCAAGCTGTAA

(23) One of specific examples of the luciferase according to the embodiment is a luciferase having the amino acid sequence of SEQ ID NO: 40. In this amino acid sequence, a substitution of one amino acid residue is introduced into the amino acid sequence of SEQ ID NO: 38. Specifically, a valine residue at the 256th position from the N-terminal side in the amino acid sequence of SEQ ID NO: 38 is substituted by an alanine residue. This substitution mutation may be expressed as V256A mutation or V256A in the present application. The luciferase having the amino acid sequence of SEQ ID NO: 40 has mutations of S283G and V256A, based on the amino acid sequence (SEQ ID NO: 1) of the wild type luciferase derived from Luciora kuroiwae. In the present application, the luciferase having the amino acid sequence of SEQ ID NO: 40 may be expressed as mutant 2.

(24) The mutant 2 has the following amino acid sequence:

(25) TABLE-US-00005 (SEQIDNO:40) MEKEENVIYGPEPFYPVEEGSAGTQLHRFMERYAKMGAICFSNALTGQDV TYAEYFDRSVRLAEALRRHGLTPEKKIGICSENCLEFFIPVLSGAYIASP VAPTNEIYTIRELVHSFGISEPMIVFSSKKGLDKVLEVQKTVHSIKTIVI IDSSTTYRGYDSMDAFVKKYVPANFNLSEFKTVEVDNETHTLLIMNSSGS TGLPKGVLVRHCGAVTRFSHCRDPIFGNQVSPGTAILTVVPFHHGFGMFT TLGYFACGYRIVMLTKFDDEVLLKTLQDYKCTGVILVPTLFAILNRSELL EKFDLSNLTEIASGGAPLAKEVGEAVARRFNLPGVRQGYGLTETTSAFII TPEGDDKPGASGKVVPLMKVKVIDLDTKKTLGPNRRGEICVKGPMLMTGY EKNPTETKEIIDEDGWLHSGDIGYWDEDHHFFIVDRLKSLIKYKGYQVPP AELESVLLQHPNIFDAGVAGIPDPEAGELPGAVVVLEKGKHLTEQEVLDY VAGQVYNAKRLRGGVRFVDEVPKGLTGKIDAKAIREILKKPQAKM

(26) Another specific example of the luciferase according to the embodiment is a further mutant having additional mutation(s) in the mutant 2 but maintaining the luminescence properties of the mutant 2. Specifically, the further mutant has an amino acid sequence which has 80% or more homology to the amino acid sequence of SEQ ID NO: 40 and which has a glycine residue and an alanine residue at the 283rd and 256th positions from the N-terminal side, respectively; the further mutant catalyzes a luminescence reaction generating luminescence having the maximum luminescent wavelength of 570 nm to 610 nm; and the luminescence has an intensity at least 10 times higher than that of luminescence generated in a luminescence reaction catalyzed by a luciferase having an amino acid sequence of SEQ ID NO: 48.

(27) The homology between the amino acid sequence of the mutant 2 and the amino acid sequence of the further mutant of the mutant 2 is preferably 85% or more, 90% or more, 95% or more, 98% or more, or 99% or more. The higher the homology, the higher the possibility in which the properties of the mutant 2 are maintained in the further mutant, and thus the sufficient effects can be expected on the practical use.

(28) Another specific example of the luciferase according to the embodiment is a luciferase having an amino acid sequence of SEQ ID NO: 42. In this amino acid sequence, substitutions of two amino acid residues are introduced into the amino acid sequence of SEQ ID NO: 38. The first substitution is the V256A as described above. The second substitution is a substitution in which an arginine residue at the 111th position from the N-terminal side in the amino acid sequence of SEQ ID NO: 38 is substituted by a histidine residue. This substitution mutation may be expressed as R111H mutation or R111H in the present application. The luciferase having the amino acid sequence of SEQ ID NO: 42 has mutations of R111H, S283G, and V256A, based on the amino acid sequence (SEQ ID NO: 1) of the wild type luciferase derived from Luciora kuroiwae. In the present application, the luciferase having the amino acid sequence of SEQ ID NO: 42 may be expressed as mutant 3.

(29) The mutant 3 has the following amino acid sequence:

(30) TABLE-US-00006 (SEQIDNO:42) MEKEENVIYGPEPFYPVEEGSAGTQLHRFMERYAKMGAICFSNALTGQDV TYAEYFDRSVRLAEALRRHGLTPEKKIGICSENCLEFFIPVLSGAYIASP VAPTNEIYTIHELVHSFGISEPMIVFSSKKGLDKVLEVQKTVHSIKTIVI IDSSTTYRGYDSMDAFVKKYVPANFNLSEFKTVEVDNETHTLLIMNSSGS TGLPKGVLVRHCGAVTRFSHCRDPIFGNQVSPGTAILTVVPFHHGFGMFT TLGYFACGYRIVMLTKFDDEVLLKTLQDYKCTGVILVPTLFAILNRSELL EKFDLSNLTEIASGGAPLAKEVGEAVARRFNLPGVRQGYGLTETTSAFII TPEGDDKPGASGKVVPLMKVKVIDLDTKKTLGPNRRGEICVKGPMLMTGY EKNPTETKEIIDEDGWLHSGDIGYWDEDHHFFIVDRLKSLIKYKGYQVPP AELESVLLQHPNIFDAGVAGIPDPEAGELPGAVVVLEKGKHLTEQEVLDY VAGQVYNAKRLRGGVRFVDEVPKGLTGKIDAKAIREILKKPQAKM

(31) Another specific example of the luciferase according to the embodiment is a further mutant having additional mutation(s) in the mutant 3 but maintaining the luminescence properties of the mutant 3. Specifically, the further mutant has an amino acid sequence which has 80% or more homology to the amino acid sequence of SEQ ID NO: 42 and which has a histidine residue, a glycine residue, and an alanine residue at the 111th, 283rd and 256th positions from the N-terminal side, respectively; the further mutant catalyzes a luminescence reaction generating luminescence having the maximum luminescent wavelength of 570 nm to 610 nm; and the luminescence has an intensity at least 10 times higher than that of luminescence generated in a luminescence reaction catalyzed by a luciferase having an amino acid sequence of SEQ ID NO: 48.

(32) The homology between the amino acid sequence of the mutant 3 and the amino acid sequence of the further mutant of the mutant 3 is preferably 85% or more, 90% or more, 95% or more, 98% or more, or 99% or more. The higher the homology, the higher the possibility in which the properties of the mutant 3 are maintained in the further mutant, and thus the sufficient effects can be expected on the practical use.

(33) The S283G mutant (mutant 1) may be excluded from the luciferase according to the embodiment.

(34) The luciferase according to the embodiment can be used in an observation or quantification of the luminescence in vivo, as with the general luciferases. Further, the luciferase according to the embodiment can be used in a multicolor assay together with luciferase(s) capable of inducing luminescence having a color other than orange. In particular, it can be used in a three-color assay together with red luciferase and green luciferase.

(35) A second embodiment of the present invention is a nucleic acid having a base sequence encoding the luciferase according to the embodiment.

(36) The nucleic acid according to the embodiment may have a sequence in which the codon is optimized to a specific species. The optimization herein means that a codon of a gene contained in a nucleic acid is replaced by a codon having a high codon usage frequency in a specific species. When the optimization is performed, expression of the gene in the specific species is more increased compared to a case where the optimization is not performed. For example, the codon can be optimized to a mammal cell, specifically, a mouse or human cell.

(37) The nucleic acid according to the embodiment may further contain a transcription factor-binding region such as a promoter, in addition to the base sequence of the luciferase.

(38) The nucleic acid according to the embodiment may be in the form of a vector. This vector may contain a factor contained in a general vector, such as an antibiotic resistant gene or a replication origin, in addition to the gene encoding the luciferase according to the embodiment and the transcription factor-binding region such as the promoter.

(39) One specific example of the nucleic acid according to the embodiment is a nucleic acid having a base sequence of SEQ ID NO: 41. The base sequence encodes the mutant 2.

(40) The base sequence encoding the mutant 2 is as follow:

(41) TABLE-US-00007 (SEQIDNO:41) ATGGAAAAAGAGGAAAACGTCATCTACGGCcCCGAGCCCTTCTACCCTGT GGAAGAAGGCAGCGCCGGCACCCAGCTGCACCGGTTCATGGAAAGATACG CCAAGATGGGCGCCATCTGCTTCAGCAATGCCCTGACCGGCCAGGACGTG ACCTACGCCGAGTACTTCGACAGAAGCGTGCGGCTGGCCGAGGCCCTGAG AAGGCATGGACTGACCCCCGAGAAGAAGATCGGCATCTGCAGCGAGAACT GCCTGGAATTTTTCATCCCCGTGCTGAGCGGCGCCTATATCGCCTCTCCT GTGGCCCCCACCAACGAGATCTACACCATCCGCGAGCTGGTGCACAGCTT CGGCATCAGCGAGCCCATGATCGTGTTCAGCAGCAAGAAAGGCCTGGACA AGGTGCTGGAAGTGCAGAAAACCGTGCACAGCATCAAGACCATCGTGATC ATCGACAGCAGCACCACCTACCGGGGCTACGACAGCATGGACGCCTTCGT GAAGAAATACGTGCCCGCCAACTTCAACCTGAGCGAGTTCAAGACCGTGG AAGTGGACAACGAGACACACACCCTGCTGATCATGAACAGCTCCGGCAGC ACCGGCCTGCCTAAAGGCGTGCTCGTCAGACATTGTGGCGCCGTGACCCG GTTCAGCCACTGCAGAGATCCCATCTTCGGAAACCAGGTGTCCCCCGGCA CCGCCATTCTGACCGTGGTGCCTTTCCACCACGGCTTCGGCATGTTCACC ACCCTGGGCTACTTCGCGTGCGGCTACCGGATCGTGATGCTGACCAAGTT CGACGACGAGGTGCTGCTGAAAACCCTGCAGGACTACAAGTGCACCGGCG TGATCCTGGTGCCCACCCTGTTCGCCATCCTGAACAGAAGCGAGCTGCTG GAAAAGTTCGACCTGAGCAATCTGACCGAGATTGCCTCTGGCGGAGCCCC TCTGGCCAAAGAAGTGGGAGAAGCCGTCGCCAGACGGTTCAATCTGCCCG GCGTGCGGCAGGGCTACGGACTGACTGAGACAACCAGCGCCTTCATCATC ACACCCGAGGGCGACGATAAGCCTGGCGCCTCTGGAAAGGTGGTGCCCCT GATGAAGGTCAAAGTGATCGACCTGGACACCAAGAAAACCCTGGGCCCCA ACAGACGGGGCGAGATCTGTGTGAAGGGCCCCATGCTGATGACCGGCTAC GAGAAGAACCCCACCGAGACAAAAGAGATCATCGACGAGGACGGCTGGCT GCACTCTGGCGACATCGGCTACTGGGACGAGGACCACCACTTCTTCATCG TGGACCGGCTGAAGTCCCTGATCAAGTACAAGGGCTACCAGGTGCCCCCT GCCGAGCTGGAATCTGTGCTGCTGCAGCATCCCAACATCTTCGATGCCGG CGTGGCCGGCATCCCTGATCCTGAAGCTGGCGAACTGCCAGGCGCTGTGG TGGTGCTGGAAAAAGGCAAGCACCTGACAGAGCAGGAAGTGCTGGACTAC GTCGCCGGCCAGGTGTACAACGCCAAGAGACTGAGAGGCGGCGTGCGCTT CGTGGATGAAGTGCCTAAGGGCCTGACCGGCAAGATCGACGCCAAGGCCA TCAGAGAGATCCTGAAGAAACCCCAGGCCAAGATGTGA

(42) Another specific example of the nucleic acid according to the embodiment is a nucleic acid having a base sequence of SEQ ID NO: 43. This base sequence encodes the mutant 3.

(43) The base sequence encoding the mutant 3 is as follow:

(44) TABLE-US-00008 (SEQIDNO:43) ATGGAAAAAGAGGAAAACGTCATCTACGGCCCCGAGCCCTTCTACCCTGT GGAAGAAGGCAGCGCCGGCACCCAGCTGCACCGGTTCATGGAAAGATACG CCAAGATGGGCGCCATCTGCTTCAGCAATGCCCTGACCGGCCAGGACGTG ACCTACGCCGAGTACTTCGACAGAAGCGTGCGGCTGGCCGAGGCCCTGAG AAGGCATGGACTGACCCCCGAGAAGAAGATCGGCATCTGCAGCGAGAACT GCCTGGAATTTTTCATCCCCGTGCTGAGCGGCGCCTATATCGCCTCTCCT GTGGCCCCCACCAACGAGATCTACACCATCCACGAGCTGGTGCACAGCTT CGGCATCAGCGAGCCCATGATCGTGTTCAGCAGCAAGAAAGGCCTGGACA AGGTGCTGGAAGTGCAGAAAACCGTGCACAGCATCAAGACCATCGTGATC ATCGACAGCAGCACCACCTACCGGGGCTACGACAGCATGGACGCCTTCGT GAAGAAATACGTGCCCGCCAACTTCAACCTGAGCGAGTTCAAGACCGTGG AAGTGGACAACGAGACACACACCCTGCTGATCATGAACAGCTCCGGCAGC ACCGGCCTGCCTAAAGGCGTGCTCGTCAGACATTGTGGCGCCGTGACCCG GTTCAGCCACTGCAGAGATCCCATCTTCGGAAACCAGGTGTCCCCCGGCA CCGCCATTCTGACCGTGGTGCCTTTCCACCACGGCTTCGGCATGTTCACC ACCCTGGGCTACTTCGCGTGCGGCTACCGGATCGTGATGCTGACCAAGTT CGACGACGAGGTGCTGCTGAAAACCCTGCAGGACTACAAGTGCACCGGCG TGATCCTGGTGCCCACCCTGTTCGCCATCCTGAACAGAAGCGAGCTGCTG GAAAAGTTCGACCTGAGCAATCTGACCGAGATTGCCTCTGGCGGAGCCCC TCTGGCCAAAGAAGTGGGAGAAGCCGTCGCCAGACGGTTCAATCTGCCCG GCGTGCGGCAGGGCTACGGACTGACTGAGACAACCAGCGCCTTCATCATC ACACCCGAGGGCGACGATAAGCCTGGCGCCTCTGGAAAGGTGGTGCCCCT GATGAAGGTCAAAGTGATCGACCTGGACACCAAGAAAACCCTGGGCCCCA ACAGACGGGGCGAGATCTGTGTGAAGGGCCCCATGCTGATGACCGGCTAC GAGAAGAACCCCACCGAGACAAAAGAGATCATCGACGAGGACGGCTGGCT GCACTCTGGCGACATCGGCTACTGGGACGAGGACCACCACTTCTTCATCG TGGACCGGCTGAAGTCCCTGATCAAGTACAAGGGCTACCAGGTGCCCCCT GCCGAGCTGGAATCTGTGCTGCTGCAGCATCCCAACATCTTCGATGCCGG CGTGGCCGGCATCCCTGATCCTGAAGCTGGCGAACTGCCAGGCGCTGTGG TGGTGCTGGAAAAAGGCAAGCACCTGACAGAGCAGGAAGTGCTGGACTAC GTCGCCGGCCAGGTGTACAACGCCAAGAGACTGAGAGGCGGCGTGCGCTT CGTGGATGAAGTGCCTAAGGGCCTGACCGGCAAGATCGACGCCAAGGCCA TCAGAGAGATCCTGAAGAAACCCCAGGCCAAGATGTGA

(45) A third embodiment of the present invention is a method for producing the luciferase according to the embodiment.

(46) The method according to the embodiment includes a step of introducing a mutation into the gene of the mutant 1. For example, a mutation is introduced into a base sequence encoding the mutant 1 (SEQ ID NO: 39).

(47) The base sequence encoding the mutant 1 is as follow:

(48) TABLE-US-00009 (SEQIDNO:39) ATGGAAAAAGAGGAAAACGTCATCTACGGCCCCGAGCCCTTCTACCCTGT GGAAGAAGGCAGCGCCGGCACCCAGCTGCACCGGTTCATGGAAAGATACG CCAAGATGGGCGCCATCTGCTTCAGCAATGCCCTGACCGGCCAGGACGTG ACCTACGCCGAGTACTTCGACAGAAGCGTGCGGCTGGCCGAGGCCCTGAG AAGGCATGGACTGACCCCCGAGAAGAAGATCGGCATCTGCAGCGAGAACT GCCTGGAATTTTTCATCCCCGTGCTGAGCGGCGCCTATATCGCCTCTCCT GTGGCCCCCACCAACGAGATCTACACCATCCGCGAGCTGGTGCACAGCTT CGGCATCAGCGAGCCCATGATCGTGTTCAGCAGCAAGAAAGGCCTGGACA AGGTGCTGGAAGTGCAGAAAACCGTGCACAGCATCAAGACCATCGTGATC ATCGACAGCAGCACCACCTACCGGGGCTACGACAGCATGGACGCCTTCGT GAAGAAATACGTGCCCGCCAACTTCAACCTGAGCGAGTTCAAGACCGTGG AAGTGGACAACGAGACACACACCCTGCTGATCATGAACAGCTCCGGCAGC ACCGGCCTGCCTAAAGGCGTGCTCGTCAGACATTGTGGCGCCGTGACCCG GTTCAGCCACTGCAGAGATCCCATCTTCGGAAACCAGGTGTCCCCCGGCA CCGCCATTCTGACCGTGGTGCCTTTCCACCACGGCTTCGGCATGTTCACC ACCCTGGGCTACTTCGTGTGCGGCTACCGGATCGTGATGCTGACCAAGTT CGACGACGAGGTGCTGCTGAAAACCCTGCAGGACTACAAGTGCACCGGCG TGATCCTGGTGCCCACCCTGTTCGCCATCCTGAACAGAAGCGAGCTGCTG GAAAAGTTCGACCTGAGCAACCTGACCGAGATCGCCTCTGGCGGAGCCCC TCTGGCCAAAGAAGTGGGAGAAGCCGTCGCCAGACGGTTCAATCTGCCCG GCGTGCGGCAGGGCTACGGACTGACAGAGACAACCAGCGCCTTCATCATC ACCCCCGAGGGCGACGATAAGCCTGGCGCCTCTGGAAAGGTGGTGCCCCT GATGAAGGTCAAAGTGATCGACCTGGACACCAAGAAAACCCTGGGCCCCA ACAGACGGGGCGAGATCTGTGTGAAGGGCCCCATGCTGATGACCGGCTAC GAGAAGAACCCCACCGAGACAAAAGAGATCATCGACGAGGACGGCTGGCT GCACTCTGGCGACATCGGCTACTGGGACGAGGACCACCACTTCTTCATCG TGGACCGGCTGAAGTCCCTGATCAAGTACAAGGGCTACCAGGTGCCCCCT GCCGAGCTGGAATCTGTGCTGCTGCAGCATCCCAACATCTTCGATGCCGG CGTGGCCGGCATCCCTGATCCTGAAGCTGGCGAACTGCCAGGCGCTGTGG TGGTGCTGGAAAAAGGCAAGCACCTGACAGAGCAGGAAGTGCTGGACTAC GTCGCCGGCCAGGTGTACAACGCCAAGAGACTGAGAGGCGGCGTGCGCTT CGTGGATGAAGTGCCTAAGGGCCTGACCGGCAAGATCGACGCCAAGGCCA TCAGAGAGATCCTGAAGAAACCCCAGGCCAAGATGTGA

(49) The mutation may be introduced in a general method. For example, the mutation may be randomly introduced by utilizing a mutagen such as nitrosoguanidine or ultraviolet rays. Alternatively, the mutation may be randomly introduced in a PCR method by using a DNA polymerase which induces mutation at a fixed frequency. Alternatively, the mutation may be introduced into a specific position using a gene recombination technique or the like.

(50) The method according to the embodiment includes a step of selecting a desired mutant from candidate mutants, after the step of introducing the mutation.

(51) The selection may be performed in a general screening technology. Specifically, for example, the mutation-introduced nucleic acid is inserted into an expression vector, and the obtained vector is incorporated into E. coli to express the mutant gene in the E. coli. After that, a substance necessary for the luminescence reaction, such as a luciferin, is added thereto to cause the luminescence reaction. From a luminescence state, E. coli expressing the luciferase according to the embodiment, i.e., E. coli showing orange luminescence at a high brightness, can be selected. After that, nucleic acids containing the luciferase gene may be extracted from the selected E. coli, or a base sequence of the gene may be confirmed.

(52) According to the embodiments described above, the following effects are obtained.

(53) According to the embodiments of the present invention, the orange luminescence can be realized at a high brightness.

(54) Hitherto, when a chemiluminescent sample having a low luminescence intensity is photographed by using a microscope, an exposure time necessary for capturing a clear image has been prolonged. Applicable research uses of such a chemiluminescent sample are restricted. For example, when an exposure time of 30 minutes is necessary due to a low luminescence intensity, it is possible to perform photographing in 30-minute intervals, but it is impossible to perform photographing in a shorter time interval, particularly, real-time photographing. Further, in the capturing of an image, it is necessary that multiple images are captured and compared in order to focus on the cell that emits light. Therefore, when a long exposure time is necessary due to the low luminescence intensity, time and labor are necessary in order to capture only one image.

(55) In contrast, the luciferase according to the embodiment can cause the orange luminescence having a higher brightness, compared to the already-known luciferase, and thus it exhibits particularly advantageous effects when it is used as a reporter for imaging a protein. Specifically, the luciferase according to the embodiment can provide a high luminescence intensity even in a small amount, and thus a protein having a low level of expression can be excellently detected. In addition, the luminescence intensity obtained by the luciferase is high, and thus an exposure time necessary for detection can be shortened. For these reasons, when this luciferase is used as a reporter for a time-lapse observation, it is possible to shorten the exposure time necessary for the photographing, which enables an observation closer to the real-time observation. In other words, it enables a time-lapse observation having a high temporal resolution.

(56) In addition, orange luminescence having a sufficient luminescence intensity has not been obtained from the conventional luciferases generating the orange luminescence. In the first place, the number of the luciferases generating the orange luminescence is small. For that reason, the conventional multicolor assay of red, orange and green has a low utility.

(57) On the other hand, the luciferase of the embodiment can generate the orange luminescence having the high brightness. Therefore, when the luciferase is used in the multicolor assay of red, orange and green, separation from signals of other luciferases is improved, which enables a measurement having a high quantitativity.

EXAMPLES

Example 1: Cloning of Luciferase Gene Derived from Luciora kuroiwae

(58) 1. Material

(59) Four imagoes of Luciora kuroiwae, from Kumejima Island, Okinawa Prefecture, Japan, were used as a material.

(60) 2. Extraction of Total RNA and Synthesis of cDNA

(61) Luminous organs were taken out from the imagoes of the firefly with scissors. The luminous organ taken out and 1 mL of total RNA extraction reagent, TRIzol Reagent (Invitrogen Inc.) were put in a Lysing Matrix D tube (MP-Biomedicals Inc.) which is a tube containing beads for homogenizing tissues and cells. This tube is equipped to a tissue/cell disrupter, FastPrep 24 (MP-Biomedicals Inc.) or FastPrep FP100A (MP-Biomedicals Inc.), and the luminous organ of the firefly was disrupted in the reagent at conditions of a vibration velocity of 6.5 m/second and a vibration time of 45 seconds. After that, the tube was taken out from the disrupter, and it was put on ice over 30 minutes. After that, the disruption was performed again in the same conditions as above.

(62) Next, separation and purification of the total RNA were performed from the solution obtained by the disruption, according to the manual of the total RNA extraction reagent, TRIzol Reagent. 100 l of the obtained RNA solution was precipitated and concentrated by an ethanol precipitation method. Next, a full length cDNA synthesizing reagent, GeneRacer (Invitrogen Inc.) was used according to the manual to synthesize a full length cDNA from the total RNA obtained by the precipitation and concentration. 20 l of the obtained cDNA solution was used in the following gene experiments as a firefly full length cDNA library.

(63) 3. Identification of 5-Terminal Side of Firefly Luciferase Gene

(64) 3-1. Preparation of Primer Using Rapid Amplification of cDNA End (RACE) Method

(65) Cloning of the luciferase gene of Luciora kuroiwae was performed by a Polymerase chain reaction (PCR) method. A primer used in this PCR was prepared in the following method based on an amino acid sequence of a luciferase gene derived from already-known related species.

(66) In order to confirm an amino acid region well conserved in the firefly luciferase, amino acid sequences of 10 kinds of firefly luciferases, which have been already published, were compared using a sequence information analyzing software, DNASIS Pro (Hitachi Software Engineering Co., Ltd.). The related species used for the comparison are: Lampyris noctiluca (Registration No. CAA61668), Luciola cruciata (Registration No. P13129), Luciola lateralis (Registration No. Q01158), Luciola mingrelica (Registration No. Q26304), Hotaria parvula (Registration No. AAC37253), Photinus pyralis (Registration No. BAF48390), Photuris pennsylvanica (Registration No. Q27757), Pyrocoelia miyako (Registration No. AAC37254), Pyrocoelia rufa (Registration No. AAG45439), and Rhagophthalmus ohbai (Registration No. BAF34360).

(67) As a result, it was revealed that the amino acid sequence of L-I-K-Y-K-G-Y-Q-V (SEQ ID NO: 7), located at around the 440th residue on the C-terminal side of the firefly luciferase, was well conserved. Base sequences were predicted from codons encoding the sequence of 9 amino acids, and 12 types of mixed primers specific to firefly luciferase were designed for use in 5-terminal RACE PCR. The names and sequences of the primers are described below (Y, R and N in the primer sequences represent mixed bases. Specifically, Y represents C or T, R represents A or G, and N represents A, G, C, or T).

(68) flexLuc5-ATA (5-ACY TGR TAN CCY TTA TAT TTA AT-3: SEQ ID NO: 8),

(69) flexLuc5-ATG (5-ACY TGR TAN CCY TTA TAT TTG AT-3: SEQ ID NO: 9),

(70) flexLuc5-ATT (5-ACY TGR TAN CCY TTA TAT TTT AT-3: SEQ ID NO: 10),

(71) flexLuc5-ACA (5-ACY TGR TAN CCY TTA TAC TTA AT-3: SEQ ID NO: 11),

(72) flexLuc5-ACG (5-ACY TGR TAN CCY TTA TAC TTG AT-3: SEQ ID NO: 12),

(73) flexLuc5-ACT (5-ACY TGR TAN CCY TTA TAC TTT AT-3: SEQ ID NO: 13),

(74) flexLuc5-GTA (5-ACY TGR TAN CCY TTG TAT TTA AT-3: SEQ ID NO: 14),

(75) flexLuc5-GTG (5-ACY TGR TAN CCY TTG TAT TTG AT-3: SEQ ID NO: 15),

(76) flexLuc5-GTT (5-ACY TGR TAN CCY TTG TAT TTT AT-3: SEQ ID NO: 16),

(77) flexLuc5-GCA (5-ACY TGR TAN CCY TTG TAC TTA AT-3: SEQ ID NO: 17),

(78) flexLuc5-GCG (5-ACY TGR TAN CCY TTG TAC TTG AT-3: SEQ ID NO: 18), and

(79) flexLuc5-GCT (5-ACY TGR TAN CCY TTG TAC TTT AT-3: SEQ ID NO: 19). The primers were synthesized consigning to Life Technologies Japan Co. Ltd.

(80) 3-2. Cloning of 5-Terminal Side of Firefly Luciferase Gene by 5-RACE PCR

(81) 5-RACE PCR was performed using the firefly full length cDNA library prepared as above, as a template, and using the 12 types of mixed primers prepared as above, and 5-terminal specific primers, GeneRacer 5 Primer (5-CGA CTG GAG CAC GAG GAC ACT GA-3: SEQ ID NO: 20) and GeneRacer 5 Nested Primer (5-GGA CAC TGA CAT GGA CTG AAG GAG TA-3: SEQ ID NO: 21). As the GeneRacer 5 Primer and GeneRacer 5 Nested Primer, those contained in a full length cDNA synthetic reagent GeneRacer kit (Invitrogen Inc.) were used. In order to efficiently amplify the luciferase gene by the 5-RACE PCR, a nested PCR was performed in which a gene was more specifically amplified using a gene which had once been amplified by PCR, as a template, and using an inner primer pair. The PCR was performed using polymerase Ex-Taq (Takara Bio Inc.) according to the manual.

(82) In a first PCR, the luciferase gene was amplified using 12 types of primer pairs consisting of the 12 types of mixed primers prepared as above, and the GeneRacer 5 Primer. 10 l of a PCR reaction solution containing 10Ex Taq Buffer (20 mM Mg2+ plus) having a final concentration of tenfold dilution, dNTP Mixture (each 2.5 mM) having each final concentration of 0.2 mM, TaKaRa Ex Taq (5 U/l) having a final concentration of 0.05 U/l, one of 12 types of primers having a final concentration of 1.0 M, and GeneRacer 3 Primer having a final concentration of 0.3 M was prepared. 0.2 l of the firefly full length cDNA library solution was added to the prepared PCR reaction solution. The concentration of the firefly full length cDNA library solution was not quantified. The PCR reaction was performed by first performing thermal denaturation at 94 C. for 2 minutes, then repeating 30 times a cycle consisting of 94 C. for 30 seconds, 45 C. for 30 seconds, and 72 C. for 90 seconds, and finally performing an elongation reaction at 72 C. for 5 minutes. After the PCR reaction, 1 l of the PCR reaction solution was subjected to electrophoresis using 1% trisacetate buffer (TAE) agarose gel and stained with ethidium bromide, and then bands of the amplified gene were observed under ultraviolet-ray irradiation. Gene amplification was slightly observed in the all of the 12 reaction solutions, and thus the nested PCR reaction was performed using each of the PCR reaction solution as a template as shown below.

(83) In the nested PCR, the luciferase gene was amplified using 4 types of primer pairs consisting of the 4 types of primers selected from the 12 types of primers used in the first PCR, and GeneRacer 3 Nested Primer. 10 l of a PCR reaction solution containing 10Ex Tag Buffer (20 mM Mg2+ plus) having a final concentration of tenfold dilution, dNTP Mixture (each 2.5 mM) having each final concentration of 0.2 mM, TaKaRa Ex Tag (5 U/l) having a final concentration of 0.05 U/l, one of 12 types of primers having a final concentration of 1.0 M, and GeneRacer 3 Primer having a final concentration of 0.3 M was prepared. The first PCR reaction solution was diluted with sterilized water by 10 times, and 1.0 l of the diluted solution was added as a template to the prepared PCR reaction solution. The PCR reaction was performed by first performing thermal denaturation at 94 C. for 2 minutes, then repeating 30 times a cycle consisting of 94 C. for 30 seconds, 45 C. for 30 seconds, and 72 C. for 90 seconds, and finally performing an elongation reaction at 72 C. for 5 minutes. After the PCR reaction, 1 l of the PCR reaction solution was subjected to electrophoresis using 1% TAE agarose gel and stained with ethidium bromide, and then bands of the amplified gene were observed under ultraviolet-ray irradiation. A primer pair which enabled an efficient gene amplification at a size of about 1.4 kbp was confirmed.

(84) 3-3. Determination of Base Sequence of Gene Amplified by 5-RACE

(85) In order to read a base sequence of the gene amplified by the 5-RACE, purification of the PCR product through a gel extraction, subcloning, and direct sequencing were performed. The details are shown below.

(86) PCR (a final volume: 20 l) was performed using the primer pair which enabled the efficient gene amplification at a size of about 1.4 kbp, and desired gene fragments were collected using a gel extraction method. The gel extraction was performed using Wizard SV Gel and PCR Clean-Up System (Promega KK.) according to the manual. The subcloning of the PCR product extracted from the gel was performed using a TA cloning method. The TA cloning was performed using pGEM-T Easy Vector System (Promega KK.) according to the manual. After that, the vector DNA was transformed into E. coli (TOP10 strain or DH5 strain), and an insert positive colony was selected using a blue-white screening method. The selected colony was subjected to a direct colony PCR, whereby it was confirmed that the gene was transferred. In the direct colony PCR, a primer pair consisting of M13-F(-29) Primer (5-CAC GAC GTT GTA AAA CGA C-3: SEQ ID NO: 22) and M13 Reverse (5-GGA TAA CAA TTT CAC AGG-3: SEQ ID NO: 23) was used. 10 l of a PCR reaction solution containing 10Ex Taq Buffer (20 mM Mg2+ plus) having a final concentration of tenfold dilution, dNTP Mixture (each 2.5 mM) having each final concentration of 0.2 mM, TaKaRa Ex Taq (5 U/l) having a final concentration of 0.05 U/l, and the primer pair having each final concentration of 0.2 M was prepared. A small amount of the E. coli colony was added as a template to the prepared PCR reaction solution. The PCR reaction was performed by first performing thermal denaturation at 94 C. for one minute, then repeating 25 times a cycle consisting of 94 C. for 30 seconds, 50 C. for 30 seconds, and 72 C. for 2 minutes, and finally performing an elongation reaction at 72 C. for 2 minutes. After the PCR reaction, 2 l of the PCR reaction solution was subjected to electrophoresis using 1% TAE agarose gel and stained with ethidium bromide, and then bands of the amplified gene were observed under ultraviolet-ray irradiation.

(87) In the PCR reaction solution in which the gene amplification was confirmed, a base sequence of the gene was determined using a direct sequencing method. The extra dNTP and primers contained in the PCR reaction solution were removed using a PCR product purification kit, ExoSAP-IT (GE Healthcare Biosciences K.K.), whereby a template for PCR direct sequencing was prepared. A sequencing reaction solution containing the template was prepared using BigDye Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems), and a sequencing reaction was performed using a thermal cycler. The purification and sequencing of the PCR product were performed according to the manuals. After the sequencing reaction, purification of the reaction product was performed as follows. To the reaction solution was added 100% ethanol in an amount of 2.5 times, and nucleic acids were precipitated using a centrifuge. Next, after the supernatant was removed, the precipitates were washed by adding 70% ethanol thereto, and the nucleic acids were precipitated using the centrifuge. Finally, after a supernatant was removed, the precipitates were dried. To the purified precipitates was added 15 l of Hi-Di Formamide (Applied Biosystems) to lyse them. The resulting solution was subjected to thermal denaturation at 94 C. for 2 minutes, and quickly cooled on ice, whereby a sample for determining a base sequence was obtained. A base sequence of the sample was read using an Applied Biosystems 3130xl genetic analyzer (Applied Biosystems). The analysis method of the base sequence was performed according to the manual. The obtained base sequence was determined as a base sequence of a 5-terminal side untranslated region of Luciora kuroiwae luciferase gene. The sequence is as follow:

(88) TABLE-US-00010 (SEQIDNO:24) GTTCGGTATACTCGCGAGTTCGGGCAAAAAATAACAAGTAGCGCAAGATG GAAAAAGAAGAAAATGTGATATACGGTCCCGAGCCGTTTTACCCCGTCGA AGAGGGATCTGCAGGAACGCAACTGCACAGATTTATGGAGCGATACGCCA AAATGGGGGCTATATGTTTTTCTAACGCCCTCACGGGCCAAGATGTAACG TATGCCGAATATTTTGACCGACCGGTTCGTTTAGCGGAAGCTTTGAGAAG GCACGGCTTAACGCCAGAGAAAAAAATCGGTATTTGCAGCGAAAATTGCT TAGAATTTTTCATTCCGGTGCTTTCGGGAGCGTATATCGCTTCACCCGTC GCTCCAACTAACGAAATTTACACTATACGCGAATTGGTTCACAGTTTTGG AATATCCGAGCCAATGATCGTGTTTAGCTCAAAGAAAGGATTGGATAAAG TCTTGGAAGTACAAAAAACAGTGCACTCTATTAAAACAATAGTCATTATT GATAGCTCAACTACTTATCGAGGATATGACAGCATGGATGCGTTTGTTAA AAAAATACGTACCCGCAAATTTCAATTTATCCGAATTCAAAACTGTAGAA GTCGATAATGAAACTCACACTCTTCTTATAATGAACTCGTCCGGTTCCAC CGG

(89) The gene sequence obtained by the sequencing was analyzed by using a sequence linking function of a sequence information analysis software, DNASIS Pro. The sequence was subjected to a homology search utilizing a blastx search, provided by National Center for Biotechnology Information (NCBI), and it was confirmed that the sequence had a high homology to the base sequence of an already-known firefly luciferase. The base sequence obtained by the experiment and analysis described above was determined as the 5-terminal side of the novel firefly luciferase gene.

(90) 4. 3Race PCR of Firefly Luciferase Gene and Obtaining of Full Length cDNA

(91) 4-1. Design of Primer for Use in 3Race PCR A primer (SEQ ID NO: 27) for use in 3RACE, and a primer (SEQ ID NO: 28) for use in Nested PCR were prepared base on the sequence of the 5-terminal side untranslated region of the firefly luciferase gene, which was obtained in the 5Race PCR experiment. The primers were synthesized consigning to Life Technologies Japan Co. Ltd.

(92) 4-2. 3Race PCR for Obtaining of Full Length cDNA of Firefly Luciferase Gene

(93) 3-RACE PCR was performed using the firefly full length cDNA library prepared as above, as a template, and using primers consisting of a primer No2-Kuroiwa-F1 (GTTCGGTATACTCGCGAGTTCG: SEQ ID NO: 25), which was prepared from the base sequence of the 5-terminal side untranslated region of the object firefly luciferase, GeneRacer 3 Primer (5-GCT GTC AAC GAT ACG CTA CGT AAC G-3: SEQ ID NO: 27), and GeneRacer 3 Nested Primer (5-CGC TAC GTA ACG GCA TGA CAG TG-3: SEQ ID NO: 28). As the GeneRacer 3 Primer and GeneRacer 3 Nested Primer, those contained in a full length cDNA synthetic reagent GeneRacer kit (Invitrogen Inc.) were used. In order to efficiently amplify the luciferase gene by the 3-RACE PCR, a nested PCR was performed in which a gene was more specifically amplified using a gene which had once been amplified by PCR, as a template, and using an inner primer pair. The PCR was performed according using polymerase Ex-Taq (Takara Bio Inc.) to the manual.

(94) In a first PCR, the luciferase gene was amplified using a primer pair consisting of a primer prepared from the base sequence of the 5-terminal side untranslated region, and the GeneRacer 3 Primer. 20 l of a PCR reaction solution containing 10Ex Taq Buffer (20 mM Mg2+ plus) having a final concentration of tenfold dilution, dNTP Mixture (each 2.5 mM) having each final concentration of 0.2 mM, TaKaRa Ex Taq (5 U/l) having a final concentration of 0.05 U/l, and primers having each final concentration of 0.3 M was prepared. 0.4 l of the firefly full length cDNA library solution was added to the prepared PCR reaction solution. The concentration of the firefly full length cDNA library solution was not quantified. The PCR reaction was performed by first performing thermal denaturation at 94 C. for 2 minutes, then repeating 30 times a cycle consisting of 94 C. for 30 seconds, 50 C. for 30 seconds, and 72 C. for 2 minutes, and finally performing an elongation reaction at 72 C. for 5 minutes. After the PCR reaction, 1 l of the PCR reaction solution was subjected to electrophoresis using 1% TAE agarose gel and stained with ethidium bromide, and then bands of the amplified gene were observed under ultraviolet-ray irradiation. Gene amplification was slightly observed, and thus the nested PCR reaction was performed using the PCR reaction solution as a template.

(95) In the Nested PCR, the luciferase gene was amplified using a primer pair consisting of a primer No2-Kuroiwa-F2 for Nested PCR (GTTCGGTATACTCGCGAGTTCGGGCAA: SEQ ID NO: 26), and GeneRacer 3 Nested Primer. 20 l of an nested PCR reaction solution containing 10Ex Taq Buffer (20 mM Mg2+ plus) having a final concentration of tenfold dilution, dNTP Mixture (each 2.5 mM) having each final concentration of 0.2 mM, TaKaRa Ex Taq (5 U/l) having a final concentration of 0.05 U/l, and primers having each final concentration of 0.3 M was prepared. The first PCR reaction solution was diluted with sterilized water by 10 times, and 1.0 l of the diluted solution was added as a template to the prepared nested PCR reaction solution. The PCR reaction was performed by first performing thermal denaturation at 94 C. for 2 minutes, then repeating 30 times a cycle consisting of 94 C. for 30 seconds, 50 C. for 30 seconds, and 72 C. for 2 minutes, and finally performing an elongation reaction at 72 C. for 5 minutes. After the PCR reaction, 1 l of the PCR reaction solution was subjected to electrophoresis using 1% TAE agarose gel and stained with ethidium bromide, and then bands of the amplified gene were observed under ultraviolet-ray irradiation. It was confirmed that the gene was efficiently amplified at a size of about 2 kbp.

(96) 4-3. Determination of Base Sequence of Gene Amplified by 3-Race

(97) In order to read a base sequence of the gene amplified by the 3-RACE, purification of the PCR product through a gel extraction, subcloning, and direct sequencing were performed. The details are shown below.

(98) PCR (a final volume: 20 l) was performed using the primer pair which enabled the efficient gene amplification at a size of about 2 kbp, and desired gene fragments were collected using a gel extraction method. The gel extraction was performed using Wizard SV Gel and PCR Clean-Up System (Promega KK.) according to the manual. The subcloning of the PCR product extracted from the gel was performed using a TA cloning method. The TA cloning was performed using pGEM-T Easy Vector System (Promega KK.) according to the manual. After that, the vector DNA was transformed into E. coli (TOP10 strain or DH5 strain), and an insert positive colony was selected using a blue-white screening method. The selected colony was subjected to a direct colony PCR, whereby it was confirmed that the gene was transferred. In the direct colony PCR, a primer pair consisting of M13-F(-29) Primer (5-CAC GAC GTT GTA AAA CGA C-3: SEQ ID NO: 22) and M13 Reverse (5-GGA TAA CAA TTT CAC AGG-3: SEQ ID NO: 23) was used. 10 l of a PCR reaction solution containing 10Ex Tag Buffer (20 mM Mg2+ plus) having a final concentration of tenfold dilution, dNTP Mixture (each 2.5 mM) having each final concentration of 0.2 mM, TaKaRa Ex Tag (5 U/l) having a final concentration of 0.05 U/l, and the primer pair having each final concentration of 0.2 M was prepared. A small amount of the E. coli colony was added as a template to the prepared PCR reaction solution. The PCR reaction was performed by first performing thermal denaturation at 94 C. for one minute, then repeating 25 times a cycle consisting of 94 C. for 30 seconds, 50 C. for 30 seconds, and 72 C. for 2 minutes, and finally performing an elongation reaction at 72 C. for 2 minutes. After the PCR reaction, 2 l of the PCR reaction solution was subjected to electrophoresis using 1% TAE agarose gel and stained with ethidium bromide, and then bands of the amplified gene were observed under ultraviolet-ray irradiation.

(99) In the PCR reaction solution in which the gene amplification was confirmed, a base sequence of the gene was determined using a direct sequencing method. The extra dNTP and primers contained in the PCR reaction solution were removed using a PCR product purification kit, ExoSAP-IT (GE Healthcare Biosciences K.K.), whereby a template for PCR direct sequencing was prepared. A sequencing reaction solution containing the template was prepared using BigDye Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems), and a sequencing reaction was performed using a thermal cycler. As the primer used in the sequencing, a vector primer or gene-specific primer was used. The purification and sequencing of the PCR product were performed according to the manuals. After the sequencing reaction, purification of the reaction product was performed as follows. To the reaction solution was added 100% ethanol in an amount of 2.5 times, and nucleic acids were precipitated in a centrifuge. Next, after the supernatant was removed, the precipitates were washed by adding 70% ethanol thereto, and the nucleic acids were precipitated in the centrifuge. Finally, after a supernatant was removed, the precipitates were dried. To the purified precipitates was added 15 l of Hi-Di Formamide (Applied Biosystems) to lyse them. The resulting solution was subjected to thermal denaturation at 94 C. for 2 minutes, and quickly cooled on ice, whereby a sample for determining a base sequence was obtained. A base sequence of the sample was read using an Applied Biosystems 3130xl genetic analyzer (Applied Biosystems). The analysis method of the base sequence was performed according to the manual. The base sequence determined by the sequencing is represented by SEQ ID NO: 44. A base sequence from an initiation codon to a termination codon in SEQ ID NO: 44 was determined as a base sequence of the wild type Luciora kuroiwae luciferase gene. The base sequence of the wild type Luciora kuroiwae luciferase gene is as follow:

(100) TABLE-US-00011 (SEQIDNO:2) ATGGAAAAAGAAGAAAATGTGATATACGGTCCCGAGCCGTTTTACCCCGT CGAAGAGGGATCTGCAGGAACGCAACTGCACAGATTTATGGAGCGATACG CCAAAATGGGGGCTATATGTTTTTCTAACGCCCTCACGGGCCAAGATGTA ACGTATGCCGAATATTTTGACCGATCGGTTCGTTTAGCGGAAGCTTTGAG AAGGCACGGCTTAACGCCAGAGAAAAAAATCGGTATTTGCAGCGAAAATT GCTTAGAATTTTTCATTCCGGTGCTTTCGGGAGCGTATATCGCTTCACCC GTCGCTCCAACTAACGAAATTTACACTATACGCGAATTGGTTCACAGTTT TGGAATATCCGAGCCAATGATCGTGTTTAGCTCAAAGAAAGGATTGGATA AAGTCTTGGAAGTACAAAAAACAGTGCACTCTATTAAAACAATAGTCATT ATTGATAGCTCAACTACTTATCGAGGATATGACAGCATGGATGCGTTTGT TAAAAAATACGTACCCGCAAATTTCAATTTATCCGAATTCAAAACTGTAG AAGTCGATAATGAAACTCACACTCTTCTTATAATGAACTCGTCCGGTTCC ACCGGTCTACCGAAAGGTGTGCTAGTCCGTCATTGTGGGGCAGTTACAAG ATTTTCTCATTGCAGGGATCCGATTTTTGGTAATCAAGTTTCACCAGGCA CAGCAATTTTAACGGTCGTTCCGTTCCATCATGGCTTTGGTATGTTCACT ACTTTAGGATACTTTGTTTGTGGATACCGAATCGTAATGTTAACAAAATT TGATGACGAAGTATTGTTGAAAACCCTACAAGATTATAAGTGTACTAGTG TTATCCTAGTACCAACTTTGTTCGCTATCCTTAATAGAAGTGAACTACTG GAGAAATTCGACTTGTCTAATCTGACTGAAATTGCATCTGGTGGTGCCCC ATTAGCAAAAGAAGTTGGGGAAGCCGTTGCCAGAAGATTTAATCTTCCTG GTGTTCGCCAAGGTTACGGTTTAACTGAAACCACATCCGCTTTTATTATC ACCCCAGAAGGGGATGACAAACCAGGGGCTTCTGGAAAAGTTGTGCCTTT AATGAAAGTTAAAGTGATTGATCTTGACACTAAGAAAACGCTTGGTCCTA ACCGTCGTGGAGAAATTTGCGTTAAGGGTCCTATGTTGATGACAGGTTAC GAGAAGAATCCTACAGAAACTAAAGAAATTATCGACGAAGATGGTTGGCT GCACAGTGGAGATATTGGGTATTGGGACGAAGATCATCACTTCTTTATTG TAGATCGTCTCAAATCCTTAATCAAATACAAAGGATATCAAGTACCACCT GCTGAATTGGAATCCGTACTTTTACAACATCCAAATATATTTGATGCCGG TGTTGCCGGAATTCCCGATCCCGAAGCCGGGGAGCTTCCGGGTGCTGTGG TTGTATTAGAGAAAGGAAAACATCTAACTGAACAAGAAGTATTGGATTAC GTTGCCGGACAAGTTTACAACGCAAAACGTTTACGCGGTGGCGTTCGTTT TGTAGACGAGGTACCTAAAGGTCTCACTGGAAAAATTGACGCAAAGGCAA TTAGAGAAATTCTTAAGAAGCCGCAAGCTAAGATGTGA

(101) The full length firefly luciferase gene was obtained by the sequencing. A homology search of each of the base sequence (SEQ ID NO: 2) and its amino acid translated sequence (SEQ ID NO: 1) was performed utilizing blastx and blastp searches, provided by NCBI. In each search, it was confirmed that the sequence had a high homology to the base sequence or amino acid sequence of an already-known firefly luciferase. The base sequence obtained by the experiment and analysis described above was determined as the full length cDNA sequence of the wild type Luciora kuroiwae luciferase gene.

(102) Hereinafter, the protein encoded by the luciferase gene was referred to as a wild type Luciora kuroiwae luciferase.

(103) In order to confirm whether the amino acid sequence (SEQ ID NO: 1) obtained by translating the base sequence of SEQ ID NO: 2 showed the luminescence activity as the luciferase, the following experiment was performed.

(104) According to the base sequence determined as above, the wild type Luciora kuroiwae luciferase gene contains recognition sequences of restriction enzymes EcoRI and BamHI. A genetic modification was performed, in which the recognition sequences were removed while maintaining the amino acid sequence of the luciferase. The modification was performed in order to facilitate the introduction of the luciferase gene into an expression vector, as described below. The introduction of the gene mutation was performed using primers of SEQ ID NOS: 45, 46 and 47 according to a molecular biological genetic modification. The mutation-introduced sequence is a base sequence represented by SEQ ID NO: 3. The base sequence of SEQ ID NO: 3 does not contain recognition sequences of restriction enzymes EcoRI and BamHI. In order to express the base sequence of SEQ ID NO: 3 in E. coli, the base sequence of SEQ ID NO: 3 was introduced to a pRSET-B vector (Invitrogen Com.) using a primer pair (SEQ ID NOS: 29 and 30) for introducing a gene into a vector containing the recognition sequences of the restriction enzymes EcoRI and BamHI. The obtained vector DNA was transformed into E. coli JM109 (DE3) strains, thereby forming colonies. Using the primer pair of SEQ ID NOS: 31 and 32, it was confirmed whether the gene was normally transferred to the colonies. The luminescence was observed by spraying a D-Luciferin containing solution to the colonies to which the gene was normally transferred.

Example 2: Preparation of S283G Mutant Luciora kuroiwae Luciferase

(105) A mutant gene expressing S283G mutant Luciora kuroiwae luciferase was prepared as described below.

(106) The base sequence (SEQ ID NO: 2) of the wild type Luciora kuroiwae luciferase gene prepared in Example 1 was optimized for the expression in a mammalian cell. The optimized base sequence is as follow:

(107) TABLE-US-00012 (SEQIDNO:4) ATGGAAAAAGAGGAAAACGTCATCTACGGCCCCGAGCCCTTCTACCCTGT GGAAGAAGGCAGCGCCGGCACCCAGCTGCACCGGTTCATGGAAAGATACG CCAAGATGGGCGCCATCTGCTTCAGCAATGCCCTGACCGGCCAGGACGTG ACCTACGCCGAGTACTTCGACAGAAGCGTGCGGCTGGCCGAGGCCCTGAG AAGGCATGGACTGACCCCCGAGAAGAAGATCGGCATCTGCAGCGAGAACT GCCTGGAATTTTTCATCCCCGTGCTGAGCGGCGCCTATATCGCCTCTCCT GTGGCCCCCACCAACGAGATCTACACCATCCGCGAGCTGGTGCACAGCTT CGGCATCAGCGAGCCCATGATCGTGTTCAGCAGCAAGAAAGGCCTGGACA AGGTGCTGGAAGTGCAGAAAACCGTGCACAGCATCAAGACCATCGTGATC ATCGACAGCAGCACCACCTACCGGGGCTACGACAGCATGGACGCCTTCGT GAAGAAATACGTGCCCGCCAACTTCAACCTGAGCGAGTTCAAGACCGTGG AAGTGGACAACGAGACACACACCCTGCTGATCATGAACAGCTCCGGCAGC ACCGGCCTGCCTAAAGGCGTGCTCGTCAGACATTGTGGCGCCGTGACCCG GTTCAGCCACTGCAGAGATCCCATCTTCGGAAACCAGGTGTCCCCCGGCA CCGCCATTCTGACCGTGGTGCCTTTCCACCACGGCTTCGGCATGTTCACC ACCCTGGGCTACTTCGTGTGCGGCTACCGGATCGTGATGCTGACCAAGTT CGACGACGAGGTGCTGCTGAAAACCCTGCAGGACTACAAGTGCACCAGCG TGATCCTGGTGCCCACCCTGTTCGCCATCCTGAACAGAAGCGAGCTGCTG GAAAAGTTCGACCTGAGCAACCTGACCGAGATCGCCTCTGGCGGAGCCCC TCTGGCCAAAGAAGTGGGAGAAGCCGTCGCCAGACGGTTCAATCTGCCCG GCGTGCGGCAGGGCTACGGACTGACAGAGACAACCAGCGCCTTCATCATC ACCCCCGAGGGCGACGATAAGCCTGGCGCCTCTGGAAAGGTGGTGCCCCT GATGAAGGTCAAAGTGATCGACCTGGACACCAAGAAAACCCTGGGCCCCA ACAGACGGGGCGAGATCTGTGTGAAGGGCCCCATGCTGATGACCGGCTAC GAGAAGAACCCCACCGAGACAAAAGAGATCATCGACGAGGACGGCTGGCT GCACTCTGGCGACATCGGCTACTGGGACGAGGACCACCACTTCTTCATCG TGGACCGGCTGAAGTCCCTGATCAAGTACAAGGGCTACCAGGTGCCCCCT GCCGAGCTGGAATCTGTGCTGCTGCAGCATCCCAACATCTTCGATGCCGG CGTGGCCGGCATCCCTGATCCTGAAGCTGGCGAACTGCCAGGCGCTGTGG TGGTGCTGGAAAAAGGCAAGCACCTGACAGAGCAGGAAGTGCTGGACTAC GTCGCCGGCCAGGTGTACAACGCCAAGAGACTGAGAGGCGGCGTGCGCTT CGTGGATGAAGTGCCTAAGGGCCTGACCGGCAAGATCGACGCCAAGGCCA TCAGAGAGATCCTGAAGAAACCCCAGGCCAAGATGTGA

(108) The amino acid sequence encoded by the optimized base sequence is represented by SEQ ID NO: 5. The amino acid sequence of SEQ ID NO: 5 is the same as the amino acid sequence of SEQ ID NO: 1.

(109) Further, a mutation (S283G), in which serine at the 283rd position from the N-terminal side of the encoded amino acid sequence was substituted by glycine, was introduced to the optimized luciferase gene. In the introduction of the mutation, KroiwaOkisj(m)S283G primer: (GAC TAC AAG TGC ACC GGC GTG ATC CTG GTG CCC: SEQ ID NO: 33) was used.

(110) Thereby, a gene having the base sequence represented by SEQ ID NO: 39 was obtained. The luciferase encoded by the gene is referred to as mutant 1 or S283G mutant. The amino acid sequence of the mutant 1 is represented by SEQ ID NO: 38. The mutant 1 showed luminescence which has a brightness higher than that of the wild type luciferase and whose color shifted to a long wavelength side.

(111) The introduction of the mutation was performed base on the descriptions of a literature (Asako Sawano and Atsushi Miyawaki, Nucleic Acids Research, 2000, Vol. 28, No. 16).

Example 3: Random Mutation Introduction

(112) Mutation was randomly introduced into the S283G mutant Luciora kuroiwae luciferase, whereby mutant genes expressing the Luciora kuroiwae luciferase having further mutation were prepared.

(113) Mutation was randomly introduced into the domain ranging from about 570 bp to about 1132 bp of the luciferase of the mutant 1 (S283G), using GeneMorph II EZClone Domain Mutagenesis Kit (Agilent Inc.). The mutation introduction was performed using a primer set consisting of JP-Kuroiwa(mam)-570-F primer: (cgtggaagtggacaacgagacacac: SEQ ID NO: 36) and JP-Kuroiwa(mam)-1132-R primer: (TGGTGTCCAGGTCGATCACTTTGAC: SEQ ID NO: 37) according to a manual attached to the kit.

(114) The plasmid into which mutation had been introduced was obtained by the method described above, and it was transformed into E. coli JM109 (DE3) strains (Promega KK.), thereby forming colonies. D-Luciferin having a final concentration of 2 mM was sprayed to the colonies, and then luminescence was photographed using a CCD camera, DP-70 (Olympus Corporation). Colonies showing orange luminescence brighter than other colonies were picked up, the sequence thereof was read using a sequencer after the introduction of mutation, and it was confirmed that the mutation was randomly introduced into the luciferase gene.

(115) One of the mutation-introduced genes obtained by the method described above is referred to as mutant 2. A base sequence of the mutant 2 is represented by SEQ ID NO: 41. An amino acid sequence encoded by the base sequence is represented by SEQ ID NO: 40. As shown in SEQ ID NO: 40, the mutant 2 has a mutation (V256A), in which a valine residue at the 256th position from the N-terminal side of the amino acid sequence was substituted by an alanine residue, in addition of the S283G mutation.

(116) Further mutation was randomly introduced into the mutant 2 again. Specifically, mutation was randomly introduced into the same domain as above of the gene of the mutant 2, using GeneMorph II EZClone Domain Mutagenesis Kit (Agilent Inc.).

(117) Colony formation was performed in the same manner as above, and luminescence was photographed. Colonies emitting light at a brightness higher than that of the mutant 2 were obtained, and the luciferase genes thereof were analyzed. One of the genes is referred to as mutant 3. A base sequence of the mutant 3 is represented by SEQ ID NO: 43. An amino acid sequence encoded by the base sequence was represented by SEQ ID NO: 42. As shown in SEQ ID NO: 42, the mutant 3 has a mutation (R111H), in which a arginine residue at the 111th position from the N-terminal side of the amino acid sequence was substituted by a histidine residue, in addition to the S283G and V256A mutations. The mutation of the residue at the 111th position from the N-terminal side of the amino acid sequence was not intended at the beginning, and thus it is considered that the residue was accidentally substituted in the PCR.

Example 4: Observation of Luminescence and Measurement of Luminescence Intensity and Luminescence Spectrum in HeLa Cell

(118) 1. Preparation of Expression Vector

(119) Luminescence intensity of the wild type luciferase and the mutant luciferase (the mutants 1 to 3) of Luciora kuroiwae obtained in Examples 1 to 3 was measured in a HeLa cell, and the obtained values were compared with that of orange luciferase derived from Rhagophthalmus ohbai (SLO luciferase; Toyobo Co., Ltd.).

(120) A Kozak sequence (gccrccatgg: SEQ ID NO: 6) was added to each gene. All of the 4 types of sequences were codon-optimized for the expression in a mammalian cell. After that, the sequence was inserted between SgfI and PmeI sites in a multi-cloning site of pF9A CMV hRLuc neo Flexi vector (Promega KK.). Each gene was inserted into the vector using primers represented by SEQ ID NO: 34 and SEQ ID NO: 35. The pF9A vector contains a Renilla luciferase gene (hRLuc) in the vector sequence as an internal control, and thus a luminescence intensity obtained by the luminescent gene inserted into the multi-cloning site can be calculated as a ratio to a luminescence intensity obtained by the Renilla luciferase.

(121) According to the same procedures as above, the Kozak sequence was added to the SLO luciferase gene, which was used as a luciferase for comparison, and then it was inserted into the multi-cloning site of the pF9A vector.

(122) 2. Luminescence Observation

(123) Each of the 5 types of expression vectors prepared as above was introduced by a lipofection method into the Hela cells seeded in a 48-well plate. At a stage where the gene was expressed, 2 mM of D-luciferin was added thereto as a substrate, and photographing was performed using DP70 color CCD (manufactured by Olympus Corporation) at an exposure time of one minute (ISO 1600). The culture temperature of the cells was adjusted to about 37 C.

(124) Images acquired by the photographing are shown in FIG. 1. In FIG. 1, the results of the mutant 1, mutant 2, mutant 3, wild type and SLO in the 4 wells are shown in order from the top. In FIG. 1, the observation results acquired in color are shown in monochrome.

(125) As shown in FIG. 1, in the wild type Luciora kuroiwae luciferase and the SLO luciferase, clear luminescence images could not obtained in the photographing conditions described above. On the other hand, clear luminescence images could be obtained in the mutants 1 to 3. From the results acquired in color, the luminescence in the mutant 1 was reddish light, and the luminescence in the mutants 2 and 3 was orange light.

(126) 3. Comparison in Luminescence Intensity

(127) Next, the luminescence intensities were compared. This comparison was performed using Dual-Glo (registered trademark) Luciferase Assay System (manufactured by Promega Corporation, Product No. E2940). Each of the 5 types of expression vectors was introduced by a lipofection method into the Hela cells seeded in a 48-well plate, and the cells were washed with PBS after 22 hours. 200 l of 2 mM D-luciferin/CO2 Independent Medium (Invitrogen) was added to each well of the 48-well plate, and luminescence intensity was measured for 60 minutes at 37 C. using Luminescensor (ATTO) in a condition of a measurement time of 1 second per well. The luminescence intensity at a point of time when 60 minutes passed was determined as the luminescence intensity of each of the 5 types of luciferases. After that, according to the manual, coelenterazine was added, and the luminescence intensity obtained by the Renilla luciferase, which is an internal control, was measured for 15 minutes at 37 C. using the Luminescensor in a condition of measurement time of 1 second per well. The luminescence intensity obtained by each of the Luciora kuroiwae wild type luciferase, the mutants 1 to 3, and the SLO luciferase was divided by the luminescence intensity obtained by the Renilla luciferase, and the calculated value was determined as the luminescence intensity of each luciferase and graphed.

(128) The results are shown in FIG. 2. As shown in FIG. 2, when the Luciora kuroiwae luciferase was expressed in the HeLa cells, the luminescence intensity was 1.2 times higher in the wild type, 17.1 times higher in the mutant 1, 20.6 times higher in the mutant 2, and 29.1 times higher in the mutant 3, than the luminescence intensity obtained by the SLO luciferase. It was found that the orange luminescence obtained in the mutants 2 and 3 had a very high brightness compared to the conventional orange luciferase.

(129) 4. Measurement of Luminescence Spectrum

(130) Next, a luminescence spectrum was measured.

(131) LumiFlSpectroCapture (ATTO) (slit width: 0.5 mm, exposure time: one minute) was used as an apparatus for measurement. HeLa cells expressing each luciferase gene were suspended in a solution containing 2 mM D-luciferin/CO2 Independent Medium (Invitrogen) to cause the luminescence in the cells, and a luminescence spectrum was measured in a condition of 37 C. The HeLa cells were treated with trypsin and floated.

(132) The measured luminescence spectra are shown in FIG. 3. In addition, the maximum luminescent wavelengths of the luciferases are shown in Table 1 below. The maximum luminescent wavelength means a wavelength in the case where the maximum luminescence intensity is obtained in a spectrum obtained by measuring luminescence of luciferin caused by the luciferase.

(133) TABLE-US-00013 TABLE 1 Maximum luminescent Name of luciferase wavelength SLO 594 Wild type of Luciora kuroiwae 585 Mutant 1 of Luciora kuroiwae 606 (S283G) Mutant 2 of Luciora kuroiwae 590 (S283G, V256A) Mutant 3 of Luciora kuroiwae 590 (R111H, S283G, V256A)

(134) From FIG. 3 and Table 1, the wild type Luciora kuroiwae luciferase showed the maximum luminescent wavelength of about 585 nm in the HeLa cells floating in a medium at about 37 C. In the same conditions, the maximum luminescent wavelength was about 606 nm in the mutant 1, about 590 nm in the mutant 2, about 590 nm in the mutant 3, and about 594 nm in the SLO luciferase (Toyobo Co., Ltd.).

(135) In the mutant 1, the maximum luminescent wavelength shifted to the slightly long wavelength side, whereas almost the same maximum luminescent wavelength as that of the SLO luciferase was shown in the mutants 2 and 3.

(136) From FIG. 3, it was found that each spectrum obtained in the mutants 1 to 3 was one sharp peak.

(137) From the above, it was found that the mutants 2 and 3 of Luciora kuroiwae luciferase had a luminescence intensity 20.6 times higher and 29.1 times higher, respectively, than the luminescence intensity obtained by the SLO luciferase, while showing almost the same maximum luminescent wavelength as that of the SLO luciferase.

(138) It can be considered that when the multicolor assay is performed using the mutant 2 or 3, which is an orange luciferase having a higher brightness than ever, as the reporter, it is possible to effectively obtain the signals in the orange region.