METHOD FOR PRODUCING LACTIC ACID
20190127766 · 2019-05-02
Inventors
- Magnus Ask (Malmö, SE)
- Rakesh Koppram (Gothenburg, SE)
- Diethard MATTANOVICH (Vienna, AT)
- Michael Sauer (Vienna, AT)
Cpc classification
International classification
Abstract
The present invention provides a method for producing lactic acid in a recombinant yeast cell culture using glucose as carbon source comprising a first, seed fermentation stage to produce biomass wherein the yeast is cultivated in a culture medium at a pH of 5 to 7, followed by a second, a production fermentation stage with biomass from the seed fermentation to produce lactic acid, wherein the yeast is cultivated in a culture medium at low p H using a yeast strain that is engineered to have lactate dehydrogenase (LDH) activity and optionally has decreased or knocked-out pyruvate decarboxylase (PDC) activity.
Claims
1. A method for producing lactic acid in a recombinant yeast cell culture using glucose as carbon source comprising: a) cultivating yeast in a seed fermentation stage to produce biomass wherein the yeast is cultivated in a culture medium at a pH of 5 to 7, followed by b) cultivating yeast in a production fermentation stage with biomass from the seed fermentation stage to produce lactic acid, wherein the yeast is cultivated in a culture medium at a pH of <5, and wherein said yeast has lactate dehydrogenase (LDH) activity and optionally decreased pyruvate decarboxylase (PDC) activity.
2. The method according to claim 1, wherein the yeast is a diploid yeast.
3. The method according to claim 1, wherein the yeast is a polyploid or aneuploid yeast.
4. The method according to claim 1, wherein the production fermentation stage is at a pH of <4.5, <4, or <3.5, and wherein the production fermentation stage has a final pH of 3 or less, <2.9, <2.8, <2.7, <2.6, <2.5, <2.4, <2.3, <2.2, or <2.15.
5. The method according to claim 1, wherein the seed fermentation stage is performed under fed-batch conditions and/or the production fermentation stage is performed under batch process conditions, and wherein the seed fermentation stage and the production fermentation stage are in separate fermenters.
6. The method according to claim 1, wherein lactic acid is produced in free form.
7. The method according to claim 1, wherein the yeast has decreased or knocked out expression of one or more of the genes PDC1, PDC5 and/or PDC6.
8. The method according to claim 7, wherein one or more of promotors of PDC1, PDC5 and/or PDC6 genes are substituted or deleted.
9. The method according to claim 8, wherein the genes PDC1, PDC5 and/or PDC6 are conditionally expressed under the control of heterologous promoters.
10. The method according to claim 7, wherein at least one of the genes PDC1, PDC5 and/or PDC6 is deleted.
11. The method according to claim 1, wherein the yeast has decreased or knocked-out expression of one or more genes encoding proteins interacting with glucose sensors controlling glucose-regulated gene expression, and wherein the proteins are STD1 or MTH1 proteins.
12. The method according to claim 11, wherein the MTH1 gene is partially or completely deleted.
13. The method of claim 1, wherein the yeast is modified to overexpress at least one hexose transporter gene.
14. The method of claim 1, wherein the yeast is modified to overexpress at least one hexose transporter genes selected from the group consisting of HXT1, HXT2, HXT3, HXT4, HXT5, HXT6, HXT7, HXT8, HXT9, HXT10, HXT11, HXT12, HXT13, HXT14, HXT15, HXT16, HXT17, GAL2, SNF3 and RGT2.
15. A two step fermentation system for producing lactic acid with glucose as carbon source using a recombinant yeast strain, consisting of: a) a seed fermentation stage to produce biomass, wherein the yeast cells are cultivated in a cell culture medium at a pH of 5 to 7, and b) a production fermentation stage to produce lactic acid, wherein the yeast cells are cultivated in a cell culture medium until a final pH of less than 3.5, <3.4, <3.3, <3.2, <3.1, <3.0, <2.9, <2.8, <2.7, <2.6, <2.5, <2.4, <2.3, <2.2, or <2.15. wherein the yeast encodes a heterologous lactate dehydrogenase (LDH) and has decreased pyruvate decarboxylase (PDC) activity.
16. The system of claim 15, wherein the seed fermentation stage is in a first fermenter, and wherein the production fermentation stage is in a second fermenter and is inoculated with yeast cells from the seed fermentation stage.
17. (canceled)
19. A recombinant polyploid, diploid or aneuploid yeast strain, preferably Saccharomyces cerevisiae, wherein the yeast strain comprises: i) functional deletion of PDC1, PDC5 and PDC6 genes, ii) functional deletion of MTH1 gene, iii) overexpression of HXT1 gene, and iv) at least one heterologous LDH gene.
20. The method according to claim 6, wherein the lactic acid is produced in optically pure isomeric form as either D() or L(+)-lactic acid.
21. The method according to claim 9, wherein the genes PDC1, PDC5 and/or PDC6 are conditionally expressed under the control of glucose repressible promoters selected from the group consisting of HXT2 gene promoters and HXT4 gene promoters.
Description
FIGURES
[0094]
[0095]
DETAILED DESCRIPTION OF THE INVENTION
[0096] The present invention provides a novel method for producing lactic acid using recombinant yeast.
[0097] Lactic acid (2-hydroxypropionic acid) is an organic compound with the formula CH.sub.3CH(OH)CO.sub.2H. With a hydroxyl group adjacent to the carboxyl group, lactic acid is classified as an alpha hydroxy acid (AHA). In the form of its conjugate base called lactate, it plays a role in several biochemical processes.
[0098] In solution, it can ionize a proton from the carboxyl group, producing the lactate ion CH.sub.3CH(OH)CO.sub.2.sup.. Compared to acetic acid, its pK.sub.a is 1 unit less, meaning lactic acid deprotonates ten times more easily than acetic acid does. This higher acidity is the consequence of the intramolecular hydrogen bonding between the -hydroxyl and the carboxylate group.
[0099] Lactic acid is chiral, consisting of two optical isomers. Lactic acid is the simplest hydroxyl acid that is optically active. L(+)-lactic acid can be produced directly without D()-lactic acid through fermentation (e.g., known chemical syntheses produce racemic mixtures of both isomers). Likewise D()-lactic acid can be produced by fermentation without L(+)-lactic acid. One is known as L(+)-lactic acid or (S)-lactic acid and the other, its mirror image, is D()-lactic acid or (R)-lactic acid. A mixture of the two in equal amounts is called DL-lactic acid.
[0100] Lactic acid is hygroscopic. DL-lactic acid is miscible with water and with ethanol above its melting point which is around 17 or 18 C. D-lactic acid and L-lactic acid have a higher melting point.
[0101] The term culture medium refers to a solid or liquid medium comprising sufficient nutrients, including a sugar such as, but not limited to, glucose or sucrose as carbon source, on which the recombinant yeast can grow. In chemostat, fed-batch, or batch cultures the medium is a liquid.
[0102] The terms seed fermentation stage and inoculum development stage as used herein refer to the provision of cultivation conditions wherein recombinant yeast is grown to high densities, which can be used for inoculation of the production fermentation stage. Seed fermentation is thus performed under conditions which are optimal for the growth of the recombinant yeast (biomass growth phase).
[0103] Seed fermentation is performed at a pH of about 5.0 to 7.0, specifically, the pH is about 5.0.
[0104] Optionally, the first stage is glucose or sucrose limited (e.g., less than about 10 g/l, preferably less than 5 g/L, more preferably less than 2 g/L). Glucose or sucrose is used herein as main carbon source for seed fermentation, specifically the glucose content of the seed fermentation medium at inoculation is between 10 and 25 g/l, specifically between 15 and 25 g/l, more specifically at about 20 g/l.
[0105] Low glucose concentration in this context means less than 10 g/L glucose for cultivation, specifically less than 5 g/L, specifically less than 2 g/L. As an alternative, other carbon sources may be applicable, for example but not limited lignocellulose derived sugars, lignocellulose hydrolysates, xylose, arabinose, mannose, galactose or fructose or any mixtures thereof.
[0106] Further, a nitrogen source is provided.
[0107] Seed fermentation can specifically be performed as a fed-batch process or batch process, the fed-batch being preferred.
[0108] Under fed batch conditions, the batch culture proceeds until complete or almost complete consumption of glucose and ethanol before a fresh medium is fed into the culture. The feed-medium preferably contains high concentrations of glucose or sucrose, specifically between 20 g/l and about 500 g/L The yeast is cultivated at a flow rate necessary to maintain the specific growth rate at the critical value which is strain specific and can be determined using prior to chemostat cultivations. If the growth rate exceeds a critical value, the respiratory capacity of the yeast will be exceeded and fermentation of the substrate will occur, even in the presence of oxygen. Maintaining the specific growth rate at the critical value ensures high biomass yield per substrate consumed without forming by-products such as ethanol, lactate, glycerol and acetate.
[0109] High sugar concentration in this context means 10 g/L sugar, specifically 20 g/L sugar or more for cultivation.
[0110] High glucose concentration in this context means 10 g/L glucose, specifically 20 g/L glucose or more for cultivation.
[0111] High sucrose concentration in this context means 10 g/L sucrose, specifically 20 g/L sucrose or more for cultivation.
[0112] Preferably, the seed fermentation stage is aerobic.
[0113] In certain embodiments, the controlled variable for increasing biomass can be selected from the group consisting of respiratory quotient (RQ), specific oxygen uptake rate, specific carbon dioxide evolution rate, pH, biomass level, specific growth rate, oxygen partial pressure (p0.sub.2), rate of heat generation, specific by-product production rate, and combinations thereof.
[0114] Rate of heat generation can be estimated from the rate of heat removal from chiller data such as chiller flow rate, and/or the inlet and outlet temperature from chiller.
[0115] In some embodiments wherein the controlled variable is a by-product concentration, the by-product is selected from the group consisting of isobutyrate, isobutyric acid, dihydroxyisovalerate, ketoisovalerate, isobutyraldehyde, lactate, acetolactate, acetate, formate, glycerol, and combinations thereof.
[0116] Specific carbon dioxide evolution rate (CER, millimoles/g/hr) and specific oxygen uptake rate (OUR, millimoles/g/hr) can be calculated by measuring flow rate, inlet and exhaust gas composition of air (CO.sub.2, O.sub.2 etc.), using, for example, mass spectrometry and/or cell density measurements. Specific carbon dioxide evolution rate is the ratio of carbon dioxide produced (air flow rate multiplied by difference between outlet and inlet carbon dioxide concentration) to cell density per unit time. Specific oxygen uptake rate is the ratio of oxygen consumed (air flow rate multiplied by difference between inlet and outlet oxygen concentration) to cell density. In some embodiments, OUR is measured directly, e.g., using exhaust gas analysis. In some embodiments, CER is measured directly, e.g., using exhaust gas analysis.
[0117] In some embodiments, the OUR set point during a biomass growth phase is about 2 to about 10, about 2 to about 9, about 2 to about 8, about 2 to about 7, about 2 to about 6, about 2 to about 5, about 2 to about 4, or about 2 to about 3, about 3 to about 10, about 3 to about 9, about 3 to about 8, about 3 to about 7, about 3 to about 6, or about 3 to about 5 millimoles per grams of cell per hour (mmol/(g cellsh).
[0118] In some embodiments, the CER set point during a biomass growth phase is about 1 to about 10, about 1 to about 9, about 1 to about 8, about 1 to about 7, about 1 to about 6, about 1 to about 5.5, about 1 to about 4, about 1 to about 3, about 2.5 to about 10, about 2.5 to about 9, about 2.5 to about 8, about 2.5 to about 7, about 2.5 to about 6, about 2.5 to 5, about 2.5 to about 4, about 2.5 to about 3, about 2 to about 10, about 2 to about 9, about 2 to about 8, about 2 to about 7, about 2 to about 6, about 2 to 5, about 2 to about 4, or about 2 to about 3 mmol/(g cellsh).
[0119] Respiratory quotient (RQ) is ratio of CER and OUR. Only the inlet and outlet gas composition from mass spectrometry are required to calculate RQ for a given constant air flow rate. RQ is used as a control variable that couples the oxygen uptake rate with the carbon flux through the bioreactor system. RQ is intrinsically independent of scale. RQ can be measured, for example, using exhaust gas analysis.
[0120] Specific growth rate can be estimated from cell density or OD.sub.600 data or indirectly from OUR data from empirical model.
[0121] In some embodiments, the RQ set point during a biomass growth phase is about 0.5 to about 5, about 1 to about 5, about 2 to about 5, about 3 to about 5, about 2 to about 4, about 2 to about 3, about 3 to about 4, about 0.5 to about 5, about 0.7 to about 5, about 0.9 to about 5, about 1.2 to about 5, about 1.4 to about 5, about 1.6 to about 5, about 1.8 to about 5, about 2.2 to about 5, about 2.4 to about 5, about 2.6 to about 5, about 2.8 to about 5, about 3.2 to about 5, about 3.4 to about 5, about 3.6 to about 5, about 3.8 to about 5, about 4.2 to about 5, about 4.4 to about 5, about 4.6 to about 5, about 4.8 to about 5, about 0.5 to about 4, about 0.7 to about 4, about 0.9 to about 4, about 1.2 to about 4, about 1.4 to about 4, about 1.6 to about 4, about 1.8 to about 4, about 2.2 to about 4, about 2.4 to about 4, about 2.6 to about 4, about 2.8 to about 4, about 3.2 to about 4, about 3.4 to about 4, about 3.6 to about 4, about 3.8 to about 4, about 0.5 to about 1.5, about 0.6 to about 1.5, about 0.65 to about 1.5, about 0.67 to about 1.5, about 0.7 to about 1.5, about 0.75 to about 1.5, about 0.8 to about 1.5, about 0.9 to about 1.5, about 0.5 to about 1.2, about 0.6 to about 1.2, about 0.65 to about 1.2, about 0.67 to about 1.2, about 0.7 to about 1.2, about 0.75 to about 1.2, about 0.8 to about 1.2, about 0.9 to about 1.2, about 0.5 to about 1.05, about 0.6 to about 1.05, about 0.7 to about 1.05, about 0.75 to about 1.05, about 0.8 to about 1.05, about 0.9 to about 1.05, about 0.95 to about 1.5, about 0.95 to about 1.4, about 0.95 to about 1.3, about 0.95 to about 1.2, about 0.95 to about 1.1, or about 0.95 to about 1.05.
[0122] In certain embodiments, the manipulated variable for increasing biomass is selected from the group consisting of feed rate, feed composition, air flow rate, air composition, stirring rate, pressure, and combinations thereof.
[0123] According to the invention, the term about includes a deviation of the numerical value of a maximum of 10%, specifically a maximum of 5%, more specifically a maximum of 1%. As an example, the term about 10 g thus defines a range of 9 to 11 g, specifically 9.5 to 10.5 g, specifically, 9.9 to 1.1 g.
[0124] The term production fermentation stage as used herein refers to the provision of the cultivation conditions wherein lactic acid is produced by the recombinant yeast at a final pH of 3 or less., specifically a final pH of 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.15 or less may be achieved.
[0125] Production fermentation is initiated inoculating yeast cells achieved from seed fermentation into the production reactor. Preferably, the inoculation uses yeast cells with high cell densities, which is >5 g/L, preferably >10 g/L, >20 g/L, >30 g/L, >40 g/L, >50 g/L. Inoculum size may play a significant role in determining the performance of the fermentation.
[0126] The cell density of the yeast cells for inoculation or start of fermentation production shall be at least OD.sub.600 of 3, preferably OD.sub.600 of about 5, preferably OD.sub.600 of about 6, preferably OD.sub.600 of about 7, preferably OD.sub.600 of about 8, preferably OD.sub.600 of about 9, more preferably OD.sub.600 of 10.
[0127] The production medium contains high sugar concentrations, specifically glucose sucrose, fructose, maltose, galactose, hydrolysed starch, lactose concentration to ensure high lactic acid titers. The medium is preferably supplemented with nutrients to support cellular metabolism at high sugar, specifically glucose concentrations.
[0128] The term batch culture refers to a closed culture of microorganisms with growth occurring in a fixed volume of culture medium that is continually being altered by the actions of the growing organisms until it is no longer suitable for growth. In batch culture, all nutrients required for microbial growth are present in the medium before beginning cultivation, except for molecular oxygen in aerobic cultivation.
[0129] Batch culture proceeds until complete or almost complete consumption of glucose.
[0130] The fermentation media used for seed and lactic acid production fermentation can be a base medium comprising essentially glucose or, as an alternative, sucrose, at least one nitrogen source and water.
[0131] The nitrogen source used for the fermentation medium can be, but is not limited to urea, ammonium phosphate, ammonium nitrate, ammonium sulfate.
[0132] Furthermore, other salts can be added, such as monopotassium phosphate, magnesium sulfate, copper sulfate, ferric chloride, manganese, sulfate, sodium molybdate, zinc sulfate, biotin, inositol, and thiamine.
[0133] Specifically, the base medium can be supplemented by minimal medium salts, selected from (NH.sub.4).sub.2SO.sub.4, KH.sub.2PO.sub.4, MgSO.sub.4.7H.sub.2O, vitamin solution and trace elements.
[0134] Useful vitamin solutions can contain for example D-biotin, Ca-D-pantothenate, Nicotonic acid, Myo-inositol, Thiamine hydrochloride, Pyridoxal hydrochloride and p-aminobenzoic acid.
[0135] Useful trace elements can be Na.sub.2EDTA, ZnSO.sub.4.7H.sub.2O, MnCl.sub.2.2H.sub.2O, CoCl.sub.2.6H.sub.2O, CuSO.sub.4.5H.sub.2O, Na.sub.2MoO.sub.4.2H.sub.2O, CaCl.sub.2.2H.sub.2O, FeSO.sub.4.7H.sub.2O, H.sub.3BO.sub.3, KI.
[0136] Other fermentation conditions, such as temperature, cell density, selection of substrate(s), selection of nutrients, and the like are generally selected to provide an economical process. A preferred temperature, particularly during the production phase, is from about 25-45 C., specifically about 30 C.
[0137] The medium may be buffered or a base may be added to maintain or adjust the pH.
[0138] The medium may be buffered or pH may be adjusted by addition of agents during the seed fermentation stage so that the pH is adjusted or maintained in a range of about 3.5 to about 9.0, specifically from about 4.5 to about 7.0, specifically from about 5.0 to about 7.0.
[0139] Any suitable buffer known to the skilled person may be used, specifically it is phosphate buffer.
[0140] Suitable agents of adjusting the preferred pH are basic materials and include, for example, calcium hydroxide, calcium carbonate, sodium hydroxide, potassium hydroxide, potassium carbonate, sodium carbonate, ammonium carbonate, ammonia, ammonium hydroxide, magnesium hydroxide and the like. Buffering agents that have been used in conventional fermentation processes are also suitable here.
[0141] It is preferred to allow the pH of the production fermentation stage to drop from the starting pH that is typically 5.5 or higher, to at or below the pKa of the acid fermentation product, such as in the range from 1.5 to 3.5, specifically in the range of from 1.5 to 3.0, or in the range from 1.5 to 2.5.
[0142] Alternatively, the pH of the production fermentation stage is maintained at or below the pKa of lactic acid throughout the process. Therefore, the pH of the fermentation medium is adjusted to at or below the pKa of lactic acid prior to or at the start of the production fermentation process, and is maintained at that level during the production fermentation. In this specific embodiment, the pH is preferably maintained within the range of 1.5 to 3.5, in the range of from 2.0 to 3.0.
[0143] In a specific embodiment, the final pH of the production fermentation medium is less than 5, specifically 4.5, specifically 4, specifically 3.5, specifically 3, specifically 2.5, specifically 2.15.
[0144] Production fermentation can specifically be performed as a fed-batch process or batch process, batch process being preferred.
[0145] According to a specific embodiment, a pH of less than 5, specifically 4.5, specifically 4, specifically 3.5, specifically 3, specifically 2.5, specifically 2.15 is maintained during the whole production fermentation stage.
[0146] According to a further specific embodiment, a pH of less than or equal to 3 is maintained during the whole production fermentation stage. In an alternative embodiment, the pH shall be maintained at a pH of 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.15 or less.
[0147] Fermenting, fermentation process or fermentation reaction and like terms as used herein, are intended to encompass both the growth phase and lactic acid biosynthesis phase of the process.
[0148] As is described further herein, in some embodiments the bioreactor may comprise a first seed growth reactor and a second fermentation reactor.
[0149] The terms bioreactor or fermenter according to the invention refers to any device or system that supports a biologically active environment and include a fermentation device consisting of one or more vessels and/or towers or piping arrangements. Bioreactors are commonly cylindrical, ranging in size from litres to cubic metres, and are often made of stainless steel, including continuous stirred tank reactor (CSTR), bubble column reactor (BCR), or a trickle bed reactor (TBR), or other vessel or other device suitable for gas-liquid contact. On the basis of mode of operation, a bioreactor may be classified as batch, fed batch or continuous (e.g. a continuous stirred-tank reactor model). An example of a continuous bioreactor is the chemostat.
[0150] As mentioned above, seed and production fermentation may be in separate fermenters. Therefore, the bioreactor may comprise a first, seed growth reactor in which the recombinant yeast is cultured, and a second, production fermentation reactor, to which yeast inoculum from the growth reactor is fed and in which most of the lactic acid is produced.
[0151] Primary or first or seed fermentation bioreactor as used herein may also encompass one or more reactors that are connected in series of parallel with a secondary, production fermentation bioreactor.
[0152] Inoculum density for inoculation of the production fermentation bioreactor preferably is at least OD.sub.600 of 3.
[0153] Secondary production fermentation bioreactor as used herein may encompass any number of further bioreactors that may be connected in series or in parallel with the primary bioreactors. Any one or more of these further bioreactors may also be connected to a further separator.
[0154] Recovery of lactic acid from a low pH fermentation medium can be conducted using methods known by the skilled person. Purification can be performed by known techniques, for example by centrifugation, filtration such as microfiltration, ultrafiltration, nanofiltration, liquid-liquid extraction, crystallization, chromatography etc.
[0155] In some embodiments, the production fermentation results in lactic acid production of more than 500 mM, preferably more than 60 g/L, more than 80 g/L, more than 100 g/L, more than 120 g/L.
[0156] The recombinant yeast strain useful for the method of the invention has lactate dehydrogenase activity due to one or more heterologous LDH genes and further reduced or diminished pyruvate decarboxylase activity.
[0157] In this invention, heterologous or foreign means, with respect to any genetic material, that the genetic material is not native to the host cell.
[0158] The term gene refers to chromosomal DNA, plasmid DNA, cDNA, synthetic DNA, or other DNA that encodes a peptide, polypeptide, protein, or RNA molecule, and regions flanking the coding sequence involved in the regulation of expression.
[0159] The term mutation refers to any change or alteration in a nucleic acid sequence. Several types exist, including point, frame shift, and splicing. Mutation may be performed specifically or randomly.
[0160] The term plasmid refers to a circular, extrachromosomal, optionally self-replicating piece of DNA.
[0161] The term genome encompasses both the chromosome(s) and plasmids within the recombinant yeast cell.
[0162] The term lactate dehydrogenase refers to a protein (e.g., enzyme), which catalyses the conversion of pyruvate to lactate.
[0163] The term L-lactate dehydrogenase refers to an enzyme, which catalyses the conversion of pyruvate to L-lactate, specifically it is classified as EC 1.1.1.27.
[0164] The term D-lactate dehydrogenase refers to an enzyme, which catalyses the conversion of pyruvate to D-lactate, specifically it is classified as EC 1.1.1.28.
[0165] The term LDH gene refers to a gene that upon expression yields a protein that has lactate dehydrogenase activity. A LDH gene as used in the present application can include any gene that, when expressed, results in protein having lactate dehydrogenase activity. Lactate dehydrogenase genes can be stereospecific. That is, a lactate dehydrogenase gene may catalyze a reaction to produce only L-lactate or only D-lactate. Other lactate dehydrogenases catalyze a reaction to produce both L- and D-lactate. A L-lactate dehydrogenase gene catalyzes the conversion of pyruvate to L-lactate.
[0166] Suitable LDH genes include, but are not limited to those obtained from bacterial, fungal, yeast or mammalian sources. Examples of LDH genes are those obtained from L. helveticus, L. casei, B. megaterium, B. stearothermophilus, B. coagulans, L. diolivorans, L. reuteri, Oenococcus oenii, Bos taurus, P. acidilactici, Lactobacillus plantarum, L. johnsonii, L. bulgaricus, L. delbrueckii, L. plantarum and L. pentosus. Preferably, the coded LDH enzyme is fructose bisphosphate independent, such as the L-LDH from L. plantarum.
[0167] Examples of specific L-LDH genes are those obtained from Lactobacillus plantarum, L. helveticus, L. casei, B. megaterium, B. stearotherm, B. taurus, P. acidilactici, and human or bovine sources.
[0168] Examples of specific D-LDH genes are those obtained from L. helveticus, L. johnsonii, L. bulgaricus, L. delbrueckii, L. plantarum and L. pentosus.
[0169] Functional genes that are identical or at least 80%, 85%, 90% or 95% homologous to any of these L-LDH or D-LDH genes are suitable. The native genes obtained from any of these sources may be subjected to mutagenesis if necessary to provide a coding sequence starting with a eukaryotic starting codon (ATG).
[0170] Percent identity of DNA, RNA or other genetic material and of protein amino acid sequences can be computed conveniently using BLAST or SmartBLAST software with default parameters.
[0171] The recombinant yeast cells may contain a single LDH gene or multiple LDH genes, such as from 1 to 10 LDH genes, especially from 1 to 5 LDH genes. When the transformed yeast contains multiple LDH genes, the individual genes may be copies of the same gene, or include copies of two or more different LDH genes. Multiple copies of the exogenous LDH gene may be integrated at a single locus, so they are adjacent each other, or at several loci within the yeast genome.
[0172] The exogenous LDH gene is under the transcriptional control of one or more promoters and one or more terminators, both of which are functional in the modified yeast cell.
[0173] As used according to the invention, the term promoter refers to an untranscribed sequence located upstream (i.e., 5) to the translation start codon of a structural gene (generally within about 1 to 1000 bp, preferably 1-500 bp, especially 1-100 bp) and which controls the start of transcription of the structural gene.
[0174] The term termination sequence refers to an untranscribed sequence located downstream (i.e., 3) to the translation finish codon of a structural gene (generally within about 1 to 1000 bp, more typically 1-500 base pairs and especially 1-100 base pairs) and controls the end of transcription of the structural gene.
[0175] A promoter or terminator is operatively linked to a structural gene if its position in the genome relative to that of the structural gene is such that the promoter or terminator, as the case may be, performs its transcriptional control function.
[0176] Promoter and terminator sequences may be native or exogenous to the recombinant yeast cell of the invention.
Particularly suitable LDH genes include those that encode for an enzyme with an amino acid sequence that has an identities score of at least 60%, especially at least 80%, 85% or 95%, compared with UniProtKBP56512 (LDH1_LACPL), SEQ ID No. 1:
TABLE-US-00001 MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDAL DLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNL NILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTS LDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDV AKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRD ENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQ DSAATLKKVLNDGLAELENK.
[0177] The use of native yeast cell promoters and terminators, together with respective upstream and downstream flanking regions, can permit the targeted integration of the LDH gene into specific loci of the yeast genome, and for simultaneous integration the LDH gene and deletion or disruption of another native gene, such as, for example, a PDC gene.
[0178] When multiple exogenous LDH genes are introduced into the yeast cell, it is possible for the different LDH genes to be under the control of different types of promoters and/or terminators.
[0179] The exogenous LDH gene may be integrated randomly into the yeast genome or inserted at one or more targeted locations. Examples of targeted locations include the locus of one or more genes that are desirably deleted or disrupted, such as that of a PDC or MTH1 gene.
[0180] The terms deletion and disruption, refer to the elimination of the entire coding region of the gene, or modification of the respective promoter and/or terminator region such as by deletion, insertion or mutation so that the gene either does not express the protein or an active version of the protein, or produces an enzyme with significantly reduced activity. The deletion or disruption can be accomplished by genetic engineering methods, forced evolution or mutagenesis, followed by appropriate selection or screening to identify the desired mutants.
[0181] The recombinant yeast of the invention further has additional genetic modifications of the PDC1, PDC5 and/or PDC6 genes, e.g. a deletion or disruption thereof, thereby reducing the yeast's ability to produce ethanol.
[0182] PDC1 and PDC5 are active during glucose fermentation where PDC1 is expressed about six times more strongly than PDC5. Expression of PDC6 is weak and seems to be induced in ethanol medium.
[0183] Specifically the recombinant yeast is a pyruvate decarboxylase negative or inactive or reduced yeast strain that has reduced or no detectable pyruvate decarboxylase activity, and that does not grow or shows impaired growth in an aerobic environment on glucose as a sole carbon source in a synthetic culture medium and may not produce detectable amounts of ethanol (e.g., less than about 1 ppm) during growth in an aerobic environment in a minimal medium.
[0184] Specifically, one, two or all of PDC1, PDC5 and PDC6 genes are functionally knocked out or deleted. Specifically, the recombinant yeast strain lacks both alleles of PDC1, PDC5 and PDC6.
[0185] Alternatively, one, two or all of PDC1, PDC5 and PDC6 genes are conditionally expressed due to control of constitutive conditional/inducible promoters, i.e. promoters which down-regulate or up-regulate gene expression under certain conditions or upon addition of selected supplements. In a specific embodiment, the conditional promoters are glucose repressible. In another specific embodiment, the conditional promoters are pH dependent, preferably active at a pH of >5, but inactive at a pH of <4. In a specific embodiment, the conditional promoters are from HXT genes, specifically from HXT2, HXT4, HXT1 or HXT7.
[0186] Examples of suitable constitutive promoters are promoters from glycolytic enzymes. Examples for such glycolytic promoters are the TPI1 (triose phosphate isomerase 1 promoter, the TDH3 (GAPH, glyceraldehyde-3-phosphate dehydro-genase) promoter, the PGK1 (3-phosphoglycerate kinase) promoter and the PGI1 phosphoglucose isomerase) promoter.
[0187] Saccharomyces cerevisiae has 20 genes that encode proteins similar to glucose (hexose) transporters (HXT1 to HXT17, GAL2, SNF3, and RGT2). These Hxt proteins belong to the major facilitator superfamily (MFS) of transporters. MFS proteins transport their substrates by passive, energy-independent facilitated diffusion, with glucose moving down a concentration gradient. The hexose transporter genes are HXT1, HXT2, HXT3, HXT4, HXT5, HXT6, HXT7, HXT8, HXT9, HXT10, HXT11, HXT12, HXT13, HXT14, HXT15, HXT16, HXT17, GAL2, SNF3 and RGT2, however any other yet unknown gene encoding a hexose transport system useful in yeast is encompassed herein as well.
[0188] According to one embodiment, one or more of the above listed hexose transporter genes are overexpressed using heterologous constitutive or inducible promoters.
[0189] According to a further embodiment, the yeast comprises a functional deletion of the MTH1 or STD1 gene. According to a further embodiment, the yeast comprises overexpression of the MTH1 gene The Std1 protein modulates the expression of glucose-regulated genes and is supposed to interact with the glucose sensors, Snf3 and Rgt2. The homologue of Std1, Mth1, is assumed to interact with Snf3 but not Rgt2. Genetic interactions between STD1, MTH1, SNF3, and RGT2 suggest that the glucose signalling is mediated, at least in part, through interactions of the products of these genes. In media lacking glucose or with low levels of glucose, the hexose transporter genes are subject to repression by a mechanism that requires the Std1 and Mth1 proteins.
[0190] According to a specific embodiment of the invention, the MTH1 gene comprises at least a partial deletion resulting in lack of functionality of the gene expression product.
[0191] Specifically useful for the method described herein is a recombinant diploid yeast strain, preferably Saccharomyces cerevisiae, comprising functional deletion of PDC1, PDC5 and PDC6 genes, functional deletion of MTH1 gene, overexpression of HXT1 gene, and at least one heterologous LDH gene.
[0192] As used herein, the term haploid refers to haploid yeast cells having one copy of each chromosome, i.e. a single set of unpaired chromosomes.
[0193] As used herein, the term diploid refers to diploid yeast cells having two homologous copies of each chromosome. In a diploid state the haploid number is doubled, thus, this condition is also known as 2n.
[0194] Homologous chromosomes or homologous copies of each chromosome means that the chromosomes have the same genes in the same loci where they provide points along each chromosome which enable a pair of chromosomes to align correctly with each other. However, the chromosomes (and genes) are not necessarily identical. The same gene can be coded by two different alleles. An allele is the variant form of a given gene.
[0195] Polyploidy refers to cells containing more than two paired homologous sets of chromosomes, i.e. it refers to a numerical change in a whole set of chromosomes. Polyploidy is the state where cells have multiple sets of chromosomes beyond the basic set, usually 3 or more.
[0196] Aneuploidy is the presence of an abnormal number of chromosomes in a cell, e.g. a state where one or more chromosomes of a normal set are missing or present in more than their usual number of copies. Unlike euploidy, aneuploid karyotypes are not a multiple of the haploid number. Aneuploidy describes also the state in which significant parts of one or more chromosomes are missing or present in more than their usual number of copies.
[0197] The diploid yeast cells as described herein are capable of producing free lactic acid at an amount of 80 g/100 g glucose or more at a very low pH, i.e. even lower than 2.5.
[0198] The present invention encompasses following items:
[0199] 1. A method for producing lactic acid in a recombinant yeast cell culture using a sugar, specifically glucose or sucrose as carbon source comprising
[0200] a) a seed fermentation stage to produce biomass wherein the yeast is cultivated in a culture medium at a pH of 5 to 7, followed by
[0201] b) a production fermentation stage with biomass from the seed fermentation to produce lactic acid, wherein the yeast is cultivated in a culture medium at a pH of <5, and
[0202] wherein said yeast has lactate dehydrogenase (LDH) activity and/or decreased pyruvate decarboxylase (PDC) activity.
[0203] 2. The method according to item 2, wherein the yeast cell is a diploid, polyploid or aneuploid cell, specifically said yeast cell is selected under stress conditions and genetically modified.
[0204] 3. The method according to item 1 or 2, wherein seed fermentation is at high glucose concentration.
[0205] 4. The method according to items 1 to 3, wherein production fermentation is at low glucose concentration.
[0206] 5. The method according to any one of items 1 to 4, wherein lactic acid is purified by common industrial processes.
[0207] 6. The method according to any one of items 1 to 5, wherein lactic acid is purified from the fermentation stage with a purity of at least 90%.
[0208] 7. The method according to any one of items 1 to 6, wherein the production fermentation stage is at a pH of <4.5, specifically <4, specifically <3.5.
[0209] 8. The method according to any one of items 1 to 7, wherein the production fermentation stage has a final pH of 3 or less, specifically a final pH of 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.15 or less.
[0210] 9. The method according to any one of items 1 to 8, wherein the seed fermentation stage is performed under fed-batch conditions.
[0211] 10. The method according to any one of items 1 to 9, wherein the production fermentation stage is performed under batch process conditions.
[0212] 11. The method according to any one of items 1 to 10, wherein the seed fermentation stage and the production fermentation stage are in separate fermenters.
[0213] 12. The method according to any one of items 1 to 11, wherein lactic acid is produced in free form, specifically it is produced in optically pure isomeric form, specifically it is either D() or L(+)-lactic acid.
[0214] 13. The method according to any one of items 1 to 12, wherein the yeast has decreased or knocked out expression of one or more of the genes PDC1, PDC5 and/or PDC6.
[0215] 14. The method according to any one of item 13 wherein one or more of promotors of PDC1, PDC5 and/or PDC6 genes are substituted or deleted.
[0216] 15. The method according to item 14, wherein the genes PDC1, PDC5 and/or PDC6 are conditionally expressed, specifically due to the control of heterologous promoters, specifically glucose repressible promoters, more specifically due to the control of HXT2 or HXT4 gene promoters.
[0217] 16. The method of according to any one of items 13 to 15, wherein the at least one of the genes PDC1, PDC5 and/or PDC6 is deleted.
[0218] 17. The method according to any one of items 1 to 16, wherein the yeast has decreased or knocked-out expression of one or more genes encoding proteins interacting with glucose sensors controlling glucose-regulated gene expression, specifically expression of Std1 or Mth1 proteins.
[0219] 18. The method according to any one of items 1 to 17, wherein the MTH1 gene is partially or completely deleted.
[0220] 19. The method of any one of items 1 to 18, wherein the yeast is modified to overexpress at least one hexose transporter gene.
[0221] 20. The method of any one of items 1 to 19, wherein the yeast is modified to overexpress at least one of hexose transporter genes selected from the group of HXT1, HXT2, HXT3, HXT4, HXT5, HXT6, HXT7, HXT8, HXT9, HXT10, HXT11, HXT12, HXT13, HXT14, HXT15, HXT16, HXT17, GAL2, SNF3 and RGT2.
[0222] 21. The method according to any one of items 1 to 20, wherein the initial concentration of glucose in the production stage is at least 10% (w/w), specifically 20% (w/w) or more, more specifically 25% or more.
[0223] 22. Recombinant yeast comprising one or more heterologous lactate dehydrogenase (LDH) genes and having decreased pyruvate decarboxylase (PDC).
[0224] 23. The recombinant yeast according to item 22, which has decreased or knocked out expression of one or more of the genes encoding PDC1, PDC5 and/or PDC6.
[0225] 24. The recombinant yeast according to item 23, wherein one or more of promotors of PDC1, PDC5 and/or PDC6 genes are substituted or deleted.
[0226] 25. The recombinant yeast according to item 23 or 24, wherein the genes encoding PDC1, PDC5 and/or PDC6 are conditionally expressed, specifically due to the control of heterologous promoters, specifically glucose repressible promoters, more specifically due to the control of HXT2 or HXT4 gene promoters.
[0227] 26. The recombinant yeast according to item 23 to 25, wherein the at least one of the genes encoding PDC1, PDC5 and/or PDC6 is deleted.
[0228] 27. The recombinant yeast according to any one of items 23 to 26, having decreased or knocked-out expression of one or more genes encoding proteins interacting with glucose sensors controlling glucose-regulated gene expression, specifically expression of Std1 or Mth1 proteins.
[0229] 28. The recombinant yeast according to any one of items 23 to 27, wherein the MTH1 gene is partially or completely deleted.
[0230] 29. The recombinant yeast according to any one of items 23 to 28, which is modified to overexpress at least one hexose transporter gene.
[0231] 30. The recombinant yeast according to any one of items 23 to 29, which is modified to overexpress at least one of hexose transporter genes selected from the group of HXT1, HXT2, HXT3, HXT4, HXT5, HXT6, HXT7, HXT8, HXT9, HXT10, HXT11, HXT12, HXT13, HXT14, HXT15, HXT16, HXT17, GAL2, SNF3 and RGT2.
[0232] 31. Recombinant yeast strain, specifically diploid, polyploid or aneuploid yeast cells, comprising
[0233] i) functional deletion of PDC1, PDC5 and PDC6 genes,
[0234] ii) functional deletion of MTH1 gene,
[0235] iii) overexpression of HXT1 gene, and
[0236] iv) heterologous expression of LDH gene
[0237] 32. The recombinant yeast strain of any one of items 23 to 31, which is of the species Saccharomyces cerevisiae.
[0238] 33. Two step fermentation system for producing lactic acid with glucose as carbon source using a recombinant yeast strain, consisting of
[0239] a) a seed fermentation stage to produce biomass, wherein the yeast cells are cultivated in a culture medium at a pH of 5 to 7, followed by
[0240] b) a production fermentation stage to produce lactic acid, wherein the yeast cells are cultivated in a cell culture medium until a final pH of 3.5. or less, specifically a pH of 3.4, 3.3, 3.2, 3.1, 3.0, 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.15 or less is reached.
[0241] wherein the yeast encodes a heterologous lactate dehydrogenase (LDH) and has decreased pyruvate decarboxylase (PDC) activity.
[0242] 34. Two stage fermentation system for producing lactic acid with glucose as carbon source using a recombinant yeast strain, consisting of
[0243] a) a seed fermentation stage in a first fermenter to produce biomass, wherein the yeast cells are cultivated in a cell culture medium at a pH of 5 to 7, followed by
[0244] b) a production fermentation in a second fermenter stage inoculated from the seed fermentation to produce lactic acid, wherein the yeast cells are cultivated in a cell culture medium at a pH of less than 3.5, specifically a pH of 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.15 or less,
[0245] wherein the yeast is modified to have lactate dehydrogenase (LDH) activity and/or decreased pyruvate decarboxylase (PDC) activity.
[0246] 35. Combination of two or more fermenter systems for producing lactic acid with glucose as carbon source using a recombinant yeast strain, consisting of
[0247] a) a seed fermenter to produce biomass, wherein the yeast cells are cultivated in a cell culture medium at a pH of 5 to 7, followed by
[0248] b) a production fermenter inoculated from the seed fermentation to produce lactic acid, wherein the yeast cells are cultivated in a cell culture medium at a pH of less than 3.5, specifically a pH of 3.4, 3.3, 3.2, 3.1, 3.0, 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.15 or less,
[0249] wherein the yeast is encodes a heterologous lactate dehydrogenase (LDH) gene and has a decreased pyruvate decarboxylase (PDC) and.
EXAMPLES
[0250] The examples described herein are illustrative of the present invention and are not intended to be limitations thereon. Different embodiments of the present invention have been described according to the present invention. Many modifications and variations may be made to the techniques described and illustrated herein without departing from the spirit and scope of the invention. Accordingly, it should be understood that the examples are illustrative only and are not limiting upon the scope of the invention.
[0251] If not indicated otherwise, the yeast cells used in the examples are diploid yeast cells.
Example 1: Characterization of S. cerevisiae (CBS7962) Strain for Fermentation Performance at Different Glucose and Lactic Acid Concentrations and pH
[0252] The S. cerevisiae CBS7962 strain was cultivated in bioreactors and in shake flasks in two stages. An inoculum development stage with a medium containing 1.8 g/l of YNB, 5 g/l of (NH.sub.4).sub.2SO.sub.4 and 20 g/l of glucose was used. Cells from glycerol vials stored at 80 C. were used to inoculate a 50 ml of preinoculum medium at an optical density at 600 nm (OD600) of 0.05. After 24 h of growth, the cells were harvested and used as inoculum in cultivation stage in shake flasks and in bioreactors (Eppendorf DASGIP DASbox 4, Germany) with a working volume of 50 ml and 700 ml, respectively. The medium composition and fermentation parameters in the cultivation stage are listed in Table 1 and Table 2. All cultivations were performed at 30 C.; shake flasks were incubated in an orbital shaker set at 180 rpm; pH in shake flasks were maintained at 3.0 by adding potassium hydrogen phthalate buffer to a concentration of 100 mM; pH in bioreactor cultivations were maintained by automatic addition of 2M NaOH. The bioreactor cultivations were programmed to maintain the dissolved oxygen concentration of 20% and above by controlling the aeration and stirrer speed. Samples were withdrawn from the shake flask and bioreactor cultivations at regular intervals to measure growth by following the optical density at 600 nm and to measure the supernatant for metabolites including glucose, ethanol, glycerol and lactic acid using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as an eluant with a flow rate of 0.6 ml/min. Results clearly show that the fermentation rates and yields for ethanol production, at high concentrations of glucose and in the presence of lactic acid in the medium, can be significantly improved by increasing the concentrations of YNB and ammonium sulfate and by increasing the initial inoculum size (Table1 and Table2).
TABLE-US-00002 TABLE 1 Bioreactor cultivations of S. cerevisiae CBS7962 Initial Ethanol Max. Ethanol Lactic acid YNB, (NH.sub.4).sub.2SO.sub.4, Glucose, inoculum, yield, productivity, in medium, g/l g/l g/l pH OD600 nm g/g g/l/h g/l 1.8 5 20 5 0.1 0.40 0.55 1.8 5 20 3 0.1 0.40 0.45 1.8 5 125 5 0.1 0.36 0.92 1.8 5 250 5 0.1 0.32 0.47 1.8 5 + 5* 125 5 0.1 0.37 1.48 3.6 10 125 5 0.1 0.41 2.60 3.6 10 250 5 0.1 0.40 3.78 3.6 10 250 3 0.1 0.40 2.83 3.6 10 250 3 0.1 0.37 0.40 15 3.6 10 250 5 0.1 0.40 3.03 15
TABLE-US-00003 TABLE 2 Shake flask cultivations of S. cerevisiae CBS7962 Ethanol Initial Ethanol productivity Lactic acid YNB + (NH.sub.4).sub.2SO.sub.4, Glucose, inoculum, yield, at 30 h, in medium, g/l g/l pH OD600 nm g/g g/l/h g/l 3.6 + 10 125 3 0.5 0.38 0.53 15 3.6 + 10 125 3 1.0 0.38 0.97 15 3.6 + 10 125 3 2.0 0.38 1.35 15
Example 2: Construction of S. cerevisiae Strain Lacking Pyruvate Decarboxylase (PDC1, PDC5 and PDC6) Genes Using Split-Maker Deletion Method
[0253] Knockout of both the alleles of PDC1, PDC5 and PDC6 was facilitated by the split-maker deletion method with kanamycin and hygromycin as selectable markers. The primer sequences for deletion and verification primers are listed in the table 3. Two constructs were designed for deletion of one of the alleles. Each construct contained a flank of the target gene followed by a LoxP site and roughly one half of one of the selectable markers. The flank region and LoxP sites were included in the primer that was used to amplify parts of selectable markers of kanamycin and hygromycin from pPM2aK21 and pPM2a_hphR, respectively. Two PCR constructs containing flank regions of the target gene, LoxP site and parts of one of the selectable markers were transformed into CBS7962 strain. The transformation was carried out according to the LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The transformants were plated on selective YP ethanol-glycerol medium (10 g/l of yeast extract, 20 g/l of peptone, 10 g/l of ethanol and 10 g/l of glycerol) and incubated for 3-4 days at 30 C. Single colonies were then subjected to colony PCR using verification primers for the target gene. Colony PCR was performed as follows: a yeast colony was gently touched using a pipette tip and transferred to a PCR tube containing 1.2M of sorbitol, 100 mM of sodium hydrogen phosphate and 1500 U/ml of lyticase enzyme and incubated at 37 C. for 15 min; a PCR was performed using verification primers of the target gene and the lysed cell suspension as a template. A yeast colony that was verified to have lost one allele of a pdc gene was used for transformation to knockout the other allele of the target gene using two PCR constructs containing flank regions of the target gene, LoxP site and parts of other selectable marker. Those transformants that appear on YP ethanol-glycerol medium containing G418 and hygromycin plate were verified using colony PCR for deletion of both the alleles of target gene. The resulting strain with one of the three pdc genes deleted was transformed with a CRE plasmid to remove both the selectable markers. The strains expressing CRE plasmid was later grown on non-selective YP ethanol-glycerol plate to obtain colonies without CRE plasmid. The yeast strain with one of the pdc genes deleted was then used to knockout other pdc genes using the same procedure described above.
TABLE-US-00004 TABLE3 PrimersequencesofPDCsdeletionand verificationprimers Componentname Sequence,5 to3 PDC1deletion CAAAATGCATAACCTATGCATTTAAAAGAT primer,upstream TATGTATGCTCTTCTGACTTTTCG (SEQIDNo.2) PDC1deletion TAAGTGACAGTGCAGTAATAATATGAACCA primer,downstream ATTTATTTTTCGTTACATAAAAATGC (SEQIDNo.3) PDC5deletion CATTATTTTAATTTTTTTTCTATTACTGTC primer,upstream GCTAACACCTGTATGGTTG (SEQIDNo.4) PDC5deletion GCATATTAATAGTATACAACAAAAACAAAG primer,downstream GAAAAAAAGAAATGAAATC (SEQIDNo.5) PDC6deletion CTATGTACTTGGCAATAGATGAGCATTTCA primer,upstream ATGAAGGAAACGCCTGAGTCAGTTATG (SEQIDNo.6) PDC6deletion GGGCGGCGTCCCCTGTTTTTCTGCTTTGGC primer,downstream TCATCTCTTTGGCTCCGACGGACGAAAG (SEQIDNo.7) PDC1verification AAGGCTCTTTCACTCTCCTTGC primer_fw (SEQIDNo.8) PDC1verification TTAGCGGCGTCAGCAATAGTGG innerprimer_bw (SEQIDNo.9) PDC1verification CCACTATTGCTGACGCCGCTAA innerprimer_fw (SEQIDNo.10) PDC5verification TCGCTAACACCTGTATGGTTGC primer_fw (SEQIDNo.11) PDC5verification CTTGACATCATGTCTAGAAGC innerprimer_bw (SEQIDNo.12) PDC5verification TTCTAGACATGATGTCAAGGC innerprimer_fw (SEQIDNo.13) PDC5verification ACTAAGTGACAAAGAACTACGC innerprimer_bw (SEQIDNo.14) PDC6verification TACAGTCGGTAATTTCTTTCTGG primer_fw (SEQIDNo.15) PDC6verification GGATCAAATCAGCCGACTCAACG innerprimer_bw (SEQIDNo.16) PDC6verification CGTTGAGTCGGCTGATTTGATCC innerprimer_fw (SEQIDNo.17) PDC6verification TAAAGCTGTAAGCTAGACCACC innerprimer_bw (SEQIDNo.18)
Example 3: Construction of S. cerevisiae Strain with Inactive Pyruvate Decarboxylase (PDC1, PDC5 and PDC6) Genes: Knock-Out of Pdc Genes Using CRISPR-Cas9 System
[0254] CRISPR-cas9 system, a RNA guided endonuclease activity to induce double stranded DNA breaks (dsb) at the target site and repairing the dsb with double stranded (ds) DNA homology oligos containing stop codons is used to inactivate pdc genes. Transformations are carried out according to LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The endonuclease enzyme, cas9, is constructed in a centromeric plasmid under TEF1 promoter and CYC1 terminator using golden gate assembly (Engler et al., 2008). The guide RNAs (gRNA) for PDC1, PDC5 and PDC6 genes are identified using ChopChop (https://chopchop.rc.fas.harvard.edu/). The 20 bp gRNA is constructed to contain a sequence of hammer head (HH) ribozyme and a sequence of hepatitis delta virus (HDV) ribozyme on 5 and 3 ends, respectively (Table 4). The ribozyme-gRNA-ribozyme (RGR) construct is obtained using PCR with overlapping primers (Table 4). PCR for constructing RGR is performed using four common overlapping primers including 1gRNA_all_rev, 2gRNA_all_rev, 3gRNA_all_rev and 4gRNA_all_fw and two forward primers specific for gRNAs of pdc genes (Table 4). Using golden gate assembly, the RGR construct is assembled in a 2 plasmid with TPI1 promoter and CYC1 terminator. The dsDNA oligos used for assisting the repair of dsb is PCR constructed to contain a stop codon which is flanked by about 90 bp homology region on both the ends. Knock-out of pdcs, one gene at a time, is carried out in two steps. In the first step, a yeast strain expressing cas9 is obtained by transforming the centromeric plasmid, containing cas9, into CBS7962 strain. The cas9 expressing strain is transformed with PDC1 RGR plasmid and its respective dsDNA oligos. The transformants are plated on selective YPD medium (10 g/l of yeast extract, 20 g/l of peptone and 20 g/l of glucose) and incubated for 3-4 days at 30 C. Single colonies are verified for PDC1 knock-out using PCR. To this end the presence of the PDC gene is verified by amplification with suitable primers. The PDC1 knock-out strain containing the centromeric cas9 plasmid is used to knock-out two other PDC genes using the same procedure described above. For the last PDC knock-out transformants are plated on selective YP ethanol-glycerol medium (10 g/l of yeast extract, 20 g/l of peptone, 10 g/l of ethanol and 10 g/l of glycerol) to enable growth of these knock-out strains.
TABLE-US-00005 TABLE4 gRNAsequence,primersequenceandgRNAconstructsequence forPDCsinactivationusingCRISPR-Cas9 Componentname Sequence,5 to3 gRNA,PDC1 GATACGAGCGTAACCATCAG(SEQIDNo.19) gRNA,PDC5 TGAAGTCAAAGGTATGAGAT(SEQIDNo.20) gRNA,PDC6 GTAACCATCGGCGGCATAGG(SEQIDNo.21) PrimerforgRNAconstruct, CATGCGTATCCTGATGAGTCCGTGAGGACGAAA 1_PDC1_A_fw CGAGTAAGCTCGTCGATA(SEQIDNo.22) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCGATACGAGCGTAACCA 2_PDC1_A_fw TCAGgttttagagctagaaatagcaag(SEQIDNo.23) PrimerforgRNAconstruct, CATGACTTCACTGATGAGTCCGTGAGGACGAAA 1_PDC5_A_fw CGAGTAAGCTCGTCTGAA(SEQIDNo.24) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCTGAAGTCAAAGGTATGA 2_PDC5_A_fw GATgttttagagctagaaatagcaag(SEQIDNo.25) PrimerforgRNAconstruct, CATGGGTTACCTGATGAGTCCGTGAGGACGAAA 1_PDC6_A_fw CGAGTAAGCTCGTCGTAA(SEQIDNo.26) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCGTAACCATCGGCGGCA 2_PDC6_A_fw TAGGgttttagagctagaaatagcaag(SEQIDNo.27) Overlappingprimer, Gttttagagctagaaatagcaagttaaaataaggctagtccgt 4gRNA_all_fw tatcaacttgaaaaagt(SEQIDNo.28) Overlappingprimer, CGCCATGCCGAAGCATGTTGCCCAGCCGGCGC 1gRNA_all_rev CAGCGAGGAGGCTGGGACCATGCCGGCC(SEQ IDNo.29) Overlappingprimer, AGGCTGGGACCATGCCGGCCaaaagcaccgactcggt 3gRNA_all_rev gccactttttcaagttgataacg(SEQIDNo.30) Overlappingprimer, AAGCAGTCCAAAGCTGTCCCATTCGCCATGCCG 2gRNA_all_rev AAGCATGTTGCCCAGCCG(SEQIDNo.31) gRNAconstruct:HH CATGCGTATCCTGATGAGTCCGTGAGGACGAAA ribozyme-pdc1gRNA-HDV CGAGTAAGCTCGTCGATACGAGCGTAACCATCA ribozymewithgoldengate Ggttttagagctagaaatagcaagttaaaataaggctagtccg fusionsites ttatcaacttgaaaaagtggcaccgagtcggtgcttttGGCCG GCATGGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAA CATGCTTCGGCATGGCGAATGGGACAGCTTTGG ACTGCTT(SEQIDNo.32) gRNAconstruct:HH CATGACTTCACTGATGAGTCCGTGAGGACGAAA ribozyme-pdc5gRNA-HDV CGAGTAAGCTCGTCTGAAGTCAAAGGTATGAGAT ribozymewithgoldengate gttttagagctagaaatagcaagttaaaataaggctagtccgt fusionsites tatcaacttgaaaaagtggcaccgagtcggtgcttttGGCCGG CATGGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAACAT GCTTCGGCATGGCGAATGGGACAGCTTTGGACT GCTT(SEQIDNo.33) gRNAconstruct:HH CATGGGTTACCTGATGAGTCCGTGAGGACGAAA ribozyme-pdc6gRNA-HDV CGAGTAAGCTCGTCGTAACCATCGGCGGCATAG ribozymewithgoldengate Ggttttagagctagaaatagcaagttaaaataaggctagtccg fusionsites ttatcaacttgaaaaagtggcaccgagtcggtgcttttGGCCG GCATGGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAA CATGCTTCGGCATGGCGAATGGGACAGCTTTGG ACTGCTT(SEQIDNo.34) dsDNAoligowithstop AACTTGTCCTTGTTGGACAAGATCTACGAAGTTG codons,forPDC1 AAGGTATGAGATGGGCTGGTAACGCCAACGAAT inactivation TGAACGCTGCTTACGCtGCTGattgaATGGTTACGC TCGATCAAGGGTATGTCTTGTATCATCACCACCT TCGGTGTCGGTGAATTGTCTGCTTTGAACGGTAT TGCCGGTTC(SEQIDNo.35) dsDNAoligowithstop TGTCTGCCAACATTTCTGAAACCACTGCCATGAT codons,forPDC5 CACTGATATTGCTAACGCTCCAGCTGAAATTGAC inactivation AGATGTATCAGAAaCACCTactagACACTACCCAA GACCAGTCTACTTGGGTTTGCCAGCTAACTTGGT TGACTTGAACGTCCCAGCCAAGTTATTGGAAACT CCAATTGAC(SEQIDNo.36) dsDNAoligowithstop CAGGCGACTTCAACTTGTCCCTATTGGACAAGAT codons,forPDC6 TTACGAGGTAGATGGATTGAGATGGGCTGGTAA inactivation TGCAAATGAGCTGAACGaCGCCTattgaATGCCGC CGATGGTACGCACGCATCAAGGGTTTATCTGTG CTGGTAACTACTTTTGGCGTAGGTGAATTATCCG CCTTGAATGGT(SEQIDNo.37)
Example 4: Construction of S. cerevisiae (CBS7962) Strain Auxotrophs for Uracil, Tryptophan and Histidine: Inactivation of URA3, TRP1 and HIS3 Genes Using CRISPR-Cas9 System
[0255] CRISPR-cas9 system, a RNA guided endonuclease activity to induce double stranded DNA breaks (dsb) at the target site and repairing the dsb with double stranded (ds) DNA homology oligos containing stop codons were used to inactivate URA3, TRP1 and HIS3 genes. Transformations were carried out according to LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The endonuclease enzyme, cas9, was constructed in a centromeric plasmid under TEF1 promoter and CYC1 terminator using golden gate assembly (Engler et al., 2008). The guide RNAs (gRNA) for URA3, TRP1 and HIS3 genes were identified using ChopChop (https://chopchop.rc.fas.harvard.edu/). The 20 bp gRNA was constructed to contain a sequence of hammer head (HH) ribozyme and a sequence of hepatitis delta virus (HDV) ribozyme on 5 and 3 ends, respectively (Table 5). The ribozyme-gRNA-ribozyme (RGR) construct was obtained using PCR with overlapping primers. PCR for constructing RGR is performed using four common overlapping primers including 1gRNA_all_rev, 2gRNA_all_rev, 3gRNA_all_rev and 4gRNA_all_fw and two forward primers specific for gRNAs of URA3, TRP1 and HIS3 genes (Table 5). Using golden gate assembly, the RGR construct was assembled in a 2 plasmid with TPI1 promoter and CYC1 terminator. The dsDNA oligos used for assisting the repair of dsb was PCR constructed to contain two stop codons which was flanked by approximately 40-50 bp homology region on both the ends (Table 5). Knock-out of URA3, TRP1 and HIS3 genes, one gene at a time, was carried out in two steps. In the first step, a yeast strain expressing cas9 was obtained by transforming the centromeric plasmid, containing cas9, into CBS7962 strain. The cas9 expressing strain was transformed with URA3 RGR plasmid and its respective dsDNA oligo. The transformants were plated on selective YPD medium (10 g/l of yeast extract, 20 g/l of peptone and 20 g/l of glucose) and incubated for 3-4 days at 30 C. Single colonies were then replica plated on YNB-uracil-FOA medium (1.8 g/l of YNB, 5 g/l of (NH4)2SO4, 20 g/l of glucose, 1 g/l of 5FOA and 500 g/ml of uracil) and YNB dropout medium (1.8 g/l of YNB, 5 g/l of (NH4)2SO4 and 20 g/l of glucose). The URA3 knock-out strain with cas9 expressing plasmid was subjected to stepwise knock-out of TRP1 and HIS3 genes using the same procedure described above.
TABLE-US-00006 TABLE5 SequencesofgRNA,primers,dsDNAoligosandRGRforura3, trp1,andhis3inactivationusingCRISPR-Cas9 Componentname Sequence,5 to3 gRNA,URA3 TAACTCCAGTAATTCCTTGG(SEQIDNo.38) gRNA,TRP1 GGTCCATTGGTGAAAGTTTG(SEQIDNo.39) gRNA,HI53 ATTGCGATCTCTTTAAAGGG(SEQIDNo.40) PrimerforgRNAconstruct, CATGGAGTTACTGATGAGTCCGTGAGGACGAAACGA 1_URA3_A_fw GTAAGCTCGTCTAAC(SEQIDNo.41) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCTAACTCCAGTAATTCCTTGG 2_URA3_A_fw gttttagagctagaaatagcaag(SEQIDNo.42) PrimerforgRNAconstruct, CATGTGGACCCTGATGAGTCCGTGAGGACGAAACG 1_TRP1_A_fw AGTAAGCTCGTCGGTC(SEQIDNo.43) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCGGTCCATTGGTGAAAGTTT 2_TRP1_A_fw Ggttttagagctagaaatagcaag(SEQIDNo.44) Primer_forgRNAconstruct, CATGCGCAATCTGATGAGTCCGTGAGGACGAAACGA 1_HIS3_A_fw GTAAGCTCGTCATTG(SEQIDNo.45) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCATTGCGATCTCTTTAAAGG 2_HIS3_A_fw Ggttttagagctagaaatagcaag(SEQIDNo.46) Overlappingprimer, Gttttagagctagaaatagcaagttaaaataaggctagtc 4gRNA_all_fw cgttatcaacttgaaaaagt(SEQIDNo.47) Overlappingprimer, CGCCATGCCGAAGCATGTTGCCCAGCCGGCGCCAG 1gRNA_all_rev CGAGGAGGCTGGGACCATGCCGGCC(SEQIDNo.48) Overlappingprimer, AGGCTGGGACCATGCCGGCCaaaagcaccgactcggtgcca 3gRNA_all_rev ctttttcaagttgataacg(SEQIDNo.49) Overlappingprimer, AAGCAGTCCAAAGCTGTCCCATTCGCCATGCCGAAG 2gRNA_all_rev CATGTTGCCCAGCCG(SEQIDNo.50) gRNAconstruct:HH CATGGAGTTACTGATGAGTCCGTGAGGACGAAACGA ribozyme-URA3gRNA- GTAAGCTCGTCTAACTCCAGTAATTCCTTGGgttttagag HDVribozymewithgolden ctagaaatagcaagttaaaataaggctagtccgttatcaa gatefusionsites cttgaaaaagtggcaccgagtcggtgcttttGGCCGGCAT GGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAACATGCT TCGGCATGGCGAATGGGACAGCTTTGGACTGCTT (SEQIDNo.51) gRNAconstruct:HH CATGTGGACCCTGATGAGTCCGTGAGGACGAAACG ribozyme-TRP1gRNA- AGTAAGCTCGTCGGTCCATTGGTGAAAGTTTGgttttag HDVribozymewithgolden agctagaaatagcaagttaaaataaggctagtccgttatc gatefusionsites aacttgaaaaagtggcaccgagtcggtgcttttGGCCGGC ATGGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAACATG CTTCGGCATGGCGAATGGGACAGCTTTGGACTGCTT (SEQIDNo.52) gRNAconstruct:HH CATGCGCAATCTGATGAGTCCGTGAGGACGAAACGA ribozyme-HIS3gRNA-HDV GTAAGCTCGTCATTGCGATCTCTTTAAAGGGgttttagag ribozymewithgolden ctagaaatagcaagttaaaataaggctagtccgttatcaa gatefusionsites cttgaaaaagtggcaccgagtcggtgcttttGGCCGGCAT GGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAACATGCT TCGGCATGGCGAATGGGACAGCTTTGGACTGCTT (SEQIDNo.53) dsDNAoligowithstop CTGTTATTAATTTCACAGGTAGTTCTGGTCCATTGGT codons,forTRP1 GAAAGTatagTTGCGcCTTGCAGAGCACAGAGGCCGC inactivation AGAATGTGCTCTAGAT(SEQIDNo.54) dsDNAoligowithstop AAGCGTATTACAAATGAAACCAAGATTCAGATTGCGA codons,forHI53 TCTCTTaActAGGtTGGTCCCCTAGCGATAGAGCACTC inactivation GATCTTCCCAGAAAA(SEQIDNo.55) dsDNAoligowithstop TCATGCACGAAAAGCAAACAAACTTGTGTGCTTCATT codons,forURA3 GGATGTTCGTACCTAACTAAGTAATTAGTTGAAGCAT inactivation TAGGTCCCAAAATTTGTTTACTAAAAACACATGTGGA (SEQIDNo.56) ENGLER, C., KANDZIA, R. & MARILLONNET, S. 2008. A One Pot, One Step, Precision Cloning Method with High Throughput Capability. Plos One, 3.
Example 5: Construction of S. cerevisiae (CBS7962 and pdc) Strains Expressing a Heterologous LDH Activity from Lactobacillus plantarum
[0256] The S. cerevisiae strain lacking both the alleles of PDC1, PDC5 and PDC6, was transformed with a 2 plasmid containing LDH gene. As a control, the wild type strain of S. cerevisiae CBS7962 also was transformed with 2 plasmid containing LDH gene. The region of 2 contains two 599 bp inverted repeats separated by a large and small unique region; 2 enables rolling circle replication producing multiple copies of plasmid each cell cycle. The said plasmid was constructed by golden gate assembly procedure (Engler et al., 2008). The LDH gene was previously PCR amplified using the genome of Lactobacillus plantarum ATCC8014 (Branduardi et al., 2006) as a template and primers containing appropriate fusion sites for backbone1 vector. The PCR construct of LDH and a backbone1 linker was BbsI cut to obtain a backbone1 plasmid containing LDH coding sequence. Similarly, backbone1 plasmids containing TPI1 promoter and CYC1 terminator, respectively, were constructed using PCR constructs of respective elements amplified using S. cerevisiae genome as a template. The backbone1 plasmids of LDH, TPI1 promoter and CYC1 terminator, along with a backbone2 linker were BpiI cut to obtain a backbone2 plasmid with a LDH expression cassette. The resulted plasmid along with a backbone3 linker, containing 2 and an ORI of S. cerevisiae, were BbsI cut to obtain a yeast expression plasmid that was then used for transforming the above mentioned yeast strains. Transformation of both the strains were carried out according to the LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The transformants of pdc strain was plated on selective YP ethanol-glycerol medium (10 g/l of yeast extract, 20 g/l of peptone, 10 g/l of ethanol and 10 g/l of glycerol). Whereas, the transformants of CBS7962 strain was plated on selective YPD medium (10 g/l of yeast extract, 20 g/l of peptone and 20 g/l of glucose). Single colonies were obtained from both the transformants after 3-4 days of incubation at 30 C.
[0257] BRANDUARDI, P., SAUER, M., DE GIOIA, L., ZAMPELLA, G., VALLI, M., MATTANOVICH, D. & PORRO, D. 2006. Lactate production yield from engineered yeasts is dependent from the host background, the lactate dehydrogenase source and the lactate export. Microbial Cell Factories, 5.
[0258] ENGLER, C., KANDZIA, R. & MARILLONNET, S. 2008. A One Pot, One Step, Precision Cloning Method with High Throughput Capability. Plos One, 3.
Example 6: Construction of S. cerevisiae CBS7962 Strain with Pyruvate Decarboxylase Genes Under the Control of Conditional Expression System Using CRISPR-Cas9 System
[0259] The pyruvate decarboxylase genes, PDC1, PDC5 and PDC6 are constitutively expressed in bakers yeast. This example provides a description of disabling constitutive expression of pdc genes and enabling conditional expression of pdcs genes under the control of promoters of either HXT2 gene or HXT4 gene. The genes, HXT2 and HXT4 are expressed at low levels of glucose (0.1%) and repressed at high levels of glucose (Ozcan and Johnston, 1995). Using CRISPR-Cas9 system, the promoters of pdc genes are replaced by the promoter of HXT2 or HXT4 gene. CRISP R-cas9 system, a RNA guided endonuclease activity to induce double stranded DNA breaks (dsb) at the target site and repairing the dsb with double stranded (ds) DNA homology oligos, containing promoter sequence of HXT2 or HXT4, is used to enable conditional expression system of pdc genes. Transformations are carried out according to LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The endonuclease enzyme, cas9, is constructed in a centromeric plasmid under TEF1 promoter and CYC1 terminator using golden gate assembly (Engler et al., 2008). The gRNAs to target the promoters of PDC1, PDC5 and PDC6 are identified using chopchop (https://chopchop.rc.fas.harvard.edu/). The 20 bp gRNAs are constructed to contain a sequence of hammer head (HH) ribozyme and a sequence of hepatitis delta virus (HDV) ribozyme on 5 and 3 ends, respectively. PCR for constructing ribozyme-gRNA-ribozyme (RGR) is performed using four common overlapping primers (Table6) including 1 gRNA_all_rev, 2gRNA_all_rev, 3gRNA_all_rev and 4gRNA_all_fw and two forward primers specific for gRNAs of promoters of pdc genes. Using golden gate assembly, the RGR constructs are assembled in a 2 plasmid with TPI1 promoter and CYC1 terminator. The dsDNA oligos are designed to contain the promoter sequence of HXT2 or HXT4 gene and to both the ends of promoter sequence designed to contain a 40 bp sequence homologous to the regions adjacent to the native promoter of pdc genes. Replacing the constitutive promoters of pdc genes, one promoter at a time, is carried out in two steps. In the first step, a yeast strain expressing cas9 is obtained by transforming the centromeric plasmid, containing cas9, into the yeast strain. The cas9 expressing strain is then transformed with a RGR, containing the gRNA targeting the PDC1 promoter, and dsDNA oligo containing HXT2 or HXT4 promoter sequence. The transformants of CBS792 strain are plated on selective YPDE medium (10 g/l of yeast extract, 20 g/l of peptone, 1 g/l of glucose and 10 g/l of ethanol) and incubated for 3-4 days at 30 C. Single colonies are then subjected to colony PCR using verification primers for the target region. Colony PCR is performed as follows: a yeast colony is gently touched using a pipette tip and transferred to a PCR tube containing 1.2M of sorbitol, 100 mM of sodium hydrogen phosphate and 1500 U/ml of lyticase enzyme and incubated at 37 C. for 15 min; a PCR is performed using verification primers for the target region and the lysed cell suspension as a template. A yeast colony verified to contain HXT2 or HXT4 promoter in the place of PDC1 promoter, is then plated on non-selective medium to get rid of the plasmid containing gRNA of PDC1 promoter. This yeast strain still containing the cas9 expression plasmid is then used to replace the promoters of PDC5 and PDC6, one at a time, with the same procedure described above.
TABLE-US-00007 TABLE6 Componentname Sequence,5 to3 Overlapping Gttttagagctagaaatagcaagttaaaata primer, aggctagtccgttatcaacttgaaaaagt 4gRNA_all_fw (SEQIDNo.57) Overlapping CGCCATGCCGAAGCATGTTGCCCAGCCGGCGCCAGC primer, GAGGAGGCTGGGACCATGCCGGCC 1gRNA_all_rev (SEQIDNo.58) Overlapping AGGCTGGGACCATGCCGGCCaaaagcaccgactcgg primer, tgccactttttcaagttgataacg 3gRNA_all_rev (SEQIDNo.59) Overlapping AAGCAGTCCAAAGCTGTCCCATTCGCCATGCCGAAG primer, CATGTTGCCCAGCCG(SEQIDNo.60) 2gRNA_all_rev ENGLER, C., KANDZIA, R. & MARILLONNET, S. 2008. A One Pot, One Step, Precision Cloning Method with High Throughput Capability. Plos One, 3. OZCAN, S. & JOHNSTON, M. 1995. Three different regulatory mechanisms enable yeast hexose transporter (HXT) genes to be induced by different levels of glucose. Mol Cell Biol, 15, 1564-72.
Example 7: Construction of S. cerevisiae (CBS7962 and pdc) Strain for Deletion of 225 bp Internal Region in MTH1 Gene Using CRISPR-Cas9 System
[0260] CRISPR-cas9 system, a RNA guided endonuclease activity to induce double stranded DNA breaks (dsb) at the target site and repairing the dsb with double stranded (ds) DNA homology oligos is used to delete a region of 225 bp (169 to 393 bp) (Table 8) in MTH1 gene. Two guide RNAs (gRNA) are used to induce two dsb and a dsDNA oligo, of 500 bp flanking regions of internal deletion sequence, is used to repair the dsb. Transformations are carried out according to LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The endonuclease enzyme, cas9, is constructed in a centromeric plasmid under TEF1 promoter and CYC1 terminator using golden gate assembly (Engler et al., 2008). Two gRNAs (MTH1_A and MTH1_B) (Table 8) which lie within the region of MTH1 to be deleted are identified using chopchop (https://chopchop.rc.fas.harvard.edu/). Similarly two gRNAs (MTH1_C and MTH1_D) outside this region are identified. The 20 bp gRNAs are constructed to contain a sequence of hammer head (HH) ribozyme and a sequence of hepatitis delta virus (HDV) ribozyme on 5 and 3 ends, respectively (Table 8). The ribozyme-gRNA-ribozyme (RGR) construct is obtained using PCR with overlapping primers (Table 8). PCR for constructing RGR is performed using four common overlapping primers including 1gRNA_all_rev, 2gRNA_all_rev, 3gRNA_all_rev and 4gRNA_all_fw and two forward primers specific for MTH1_A and MTH1_B gRNAs (Table 8). Using golden gate assembly, both the RGR constructs are assembled in a 2 plasmid with TPI1 promoter and CYC1 terminator. The dsDNA oligo, used for assisting the deletion of 225 bp by homologous recombination, is PCR constructed to contain 500 bp homology regions (Table 8) that lie on both sides of internal deletion region. The dsDNA oligo is amplified in a fusion PCR using the genomic DNA of CBS7962 strain with an overlapping primer set (Table 8). Partial in-frame deletion of MTH1 gene is carried out in two steps. In the first step, a yeast strain expressing cas9 is obtained by transforming the centromeric plasmid, containing cas9, into the yeast strains. The cas9 expressing strain is transformed with RGRs of MTH1_A and MTH1_B (or MTH1_C and MTH1_D, respectively) plasmid and the respective dsDNA oligo. The transformants of CBS792 and pdc strain are plated on selective YPD medium (10 g/l of yeast extract, 20 g/l of peptone and 20 g/l of glucose) and incubated for 3-4 days at 30 C. Single colonies were then subjected to colony PCR using verification primers (Table 8) for the target gene. Colony PCR was performed as follows: a yeast colony was gently touched using a pipette tip and transferred to a PCR tube containing 1.2M of sorbitol, 100 mM of sodium hydrogen phosphate and 1500 U/ml of lyticase enzyme and incubated at 37 C. for 15 min; a PCR was performed using verification primers of the target gene and the lysed cell suspension as a template.
TABLE-US-00008 TABLE7 SequencesofgRNA,primers,dsDNAoligosandRGRforMTH1 internalin-framedeletionusingCRISPR-Cas9 Componentname Sequence,5 to3 225bp(169to393bp)of AGTAGCTCTCAATCCACGACTTCTTCGAGAAGAG internaldeletion AGAACTTTGTGAATGCTCCTCCGGAGTACACTGA sequenceofMTH1 TAGAGCTAGAGATGAGATTAAAAAAAGATTATTG GCCTCCTCACCTAGCAGAAGGTCACATCATTCAA GCAGTATGCATTCAGCGAGCAGGAGATCAAGCG TGGCTGAAAGTGGGAGTTTACTTTCGGATAATGC CTCGTCTTATCAATCAAGTATA(SEQIDNo.61) gRNA,MTH1_a CTCTCTTCTCGAAGAAGTCG(SEQIDNo.62) gRNA,MTH1_b AGATCAAGCGTGGCTGAAAG(SEQIDNo.63) PrimerforgRNAconstruct, CATGAGAGAGCTGATGAGTCCGTGAGGACGAAA 1_MTH1_A_fw CGAGTAAGCTCGTCCTCT(SEQIDNo.64) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCCTCTCTTCTCGAAGAAGTCG 2_MTH1_A_fw gttttagagctagaaatagcaag(SEQIDNo.65) PrimerforgRNAconstruct, CATGTGATCTCTGATGAGTCCGTGAGGACGAAA 1_MTH1_B_fw CGAGTAAGCTCGTCAGAT(SEQIDNo.66) PrimerforgRNAconstruct, AAACGAGTAAGCTCGTCAGATCAAGCGTGGCTGAAAG 2_MTH1_B_fw gttttagagctagaaatagcaag(SEQIDNo.67) Overlappingprimer, Gttttagagctagaaatagcaagttaaaataaggcta 4gRNA_all_fw gtccgttatcaacttgaaaaagt(SEQIDNo.68) Overlappingprimer, CGCCATGCCGAAGCATGTTGCCCAGCCGGCGC 1gRNA_all_rev CAGCGAGGAGGCTGGGACCATGCCGGCC(SEQ IDNo.69) Overlappingprimer, AGGCTGGGACCATGCCGGCCaaaagcaccgactcggt 3gRNA_all_rev gccactttttcaagttgataacg(SEQIDNo.70) Overlappingprimer, AAGCAGTCCAAAGCTGTCCCATTCGCCATGCCG 2gRNA_all_rev AAGCATGTTGCCCAGCCG(SEQIDNo.71) gRNAconstruct:HHribozyme- CATGAGAGAGCTGATGAGTCCGTGAGGACGAAA mthi_a-gRNA-HDVribozyme CGAGTAAGCTCGTCCTCTCTTCTCGAAGAAGTCG withgoldengatefusion gttttagagctagaaatagcaagttaaaataagg sites ctagtccgttatcaacttgaaaaagtggcaccga gtcggtgcttttGGCCGGCATGGTCCCAGCCTCC TCGCTGGCGCCGGCTGGGCAACATGCTTCGGCA TGGCGAATGGGACAGCTTTGGACTGCTT (SEQIDNo.72) gRNAconstruct:HHribozyme- CATGTGATCTCTGATGAGTCCGTGAGGACGAAA mthi_b-gRNA-HDVribozyme CGAGTAAGCTCGTCAGATCAAGCGTGGCTGAAA withgoldengatefusion Ggttttagagctagaaatagcaagttaaaataa sites ggctagtccgttatcaacttgaaaaagtggcac cgagtcggtgcttttGGCCGGCATGGTCCCAGC CTCCTCGCTGGCGCCGGCTGGGCAACATGCTTC GGCATGGCGAATGGGACAGCTTTGGACTGCTT (SEQIDNo.73) FirsthalfofdsDNAoligo: GGAATATCTGCCATTCTACCCCTTATTCAAGTGC 500bpupstreamofinternal CTTTTTTTTTTTTTTTCATCCCACATTTTATTGCTG deletionregionofMTH1 CCTCAATCTCCATTAAGAAAAAAAATTTATATAAC CAAATGACATTTTTCCTTTCTTCTCAAACTTTGTA ATGCGCCTGTAACTGCTTCTTTTTTTATTAAAAAA CAGCATGGAGTTTTTTAATAACTTAAGGAAACATA CAAAAAGATTTGTTCATTTCACTCCAAGTATTTTT TAAAGTATATTGAAAGTTCTCAATAGCGAAACCA CAAGCAGCAATACAAAGAGAATTTTATTCGAACG CATAGAGTACACACACTCAAAGGAATGTTTGTTT CACCACCACCAGCAACTTCGAAAAACCAAGTTTT ACAACGACGTCCATTAGAATCGACTAACAGTAAT CATGGGTTTGCAAGCTCCCTACAGGCCATTCCG GAAAACACGATGAGTGGCAGTGATAATGCTTCTT TTCAAAGTTTGCCACTATCAAT(SEQIDNo.74) SecondhalfofdsDNAoligo: GTTTTCTGCCCCCTCTACTGTGCACACGCAACTA 500bpdownstreamof ACTAATGACTCTTCGTTCTCCGAATTTCCTAACCA internaldeletion CAAGTTAATCACGAGAGTGAGCCTGGATGAAGC regionofMTH1 ATTACCCAAAACGTTTTATGACATGTATTCGCCA GATATTCTATTAGCAGACCCATCCAACATTCTCT GTAACGGGCGTCCCAAGTTTACCAAGAGAGAGT TATTGGATTGGGATTTAAACGATATAAGATCGTTA TTGATAGTCGAGAAGTTAAGGCCCGAATGGGGT AATCAACTACCGGAAGTAATAACGGTGGGTGATA ATATGCCCCAGTTTAGGTTACAATTATTACCACTA TATTCTAGCGATGAGACCATAATCGCAACGTTAG TCCATTCGGATCTGTACATGGAGGCTAACTTAGA TTATGAATTCAAACTAACCAGCGCCAAATATACA GTAGCGACCGCTAGAAAAAGACATGAGCATATAA CTGGTAGAAATGAAGCCGTCAT(SEQIDNo.75) Amplificationprimer_fw GGAATATCTGCCATTCTACC(SEQIDNo.76) Amplificationoverlapping GAGGGGGCAGAAAACATTGATAGTGGCAAAC primer_rev (SEQIDNo.77) Amplificationoverlapping GTTTGCCACTATCAATGTTTTCTGCCCCCTC primer_rev (SEQIDNo.78) Amplificationprimer_rev ATGACGGCTTCATTTCTACC(SEQIDNo.79) Verificationprimer_fw TACGAGTCCATTTCTCCAGT(SEQIDNo.80) Verificationprimer_rev ATTGTGCCTCTACTGCTATA(SEQIDNo.81)
Example 8: Construction of S. cerevisiae (CBS7962 and pdc) Strains to Overexpress an Endogenous MTH1 Gene
[0261] The S. cerevisiae strain lacking both the alleles of PDC1, PDC5 and PDC6, was transformed with a 2 plasmid containing MTH1 gene. As a control, the wild type strain of S. cerevisiae CBS7962 also was transformed with 2 plasmid containing MTH1 gene. The region of 2 contains two 599 bp inverted repeats separated by a large and small unique region; 2 enables rolling circle replication producing multiple copies of plasmid each cell cycle. The said plasmid was constructed by golden gate assembly procedure (Engler et al., 2008). The MTH1 gene was previously PCR amplified using the genome of CBS7962 strain as a template and amplification primers (Table 9) containing appropriate fusion sites for backbone1 vector. The PCR construct of MTH1 and a backbone1 linker was BbsI cut to obtain a backbone1 plasmid containing MTH1 coding sequence. Similarly, backbone1 plasmids containing TPI1 promoter and CYC1 terminator, respectively, were constructed using PCR constructs of respective elements amplified using CBS7962 genome as a template. The backbone1 plasmids of MTH1, TPI1 promoter and CYC1 terminator, along with a backbone2 linker were BpiI cut to obtain a backbone2 plasmid with a MTH1 expression cassette. The resulted plasmid along with a backbone3 linker, containing 2 and an ORI of S. cerevisiae, were BbsI cut to obtain a yeast expression plasmid that was then used for transforming the above mentioned yeast strains. Transformation of both strains was carried out according to the LiAc/PEG/ss-DNA protocol (http://home.cc.umanitoba.ca/gietz/method.html). The transformants of CBS7962 and pdc strain were plated on selective YPD medium (10 g/l of yeast extract, 20 g/l of peptone and 20 g/l of glucose). Single colonies were obtained from both the transformants after 3-4 days of incubation at 30 C.
TABLE-US-00009 TABLE8 MTH1amplificationprimers Componentname Sequence,5 to3 MTH1_amplification AGAAGACGCTAGCGATGAAACCATAATCGC primer_fw (SEQIDNo.82) MTH1_amplificaiton GGTTACAATTATTACCACTATATTCTAGCG primer_rev CGTCTTCT(SEQIDNo.83) ENGLER, C., KANDZIA, R. & MARILLONNET, S. 2008. A One Pot, One Step, Precision Cloning Method with High Throughput Capability. Plos One, 3.
Example 9: Lactic Acid Production Using S. cerevisiae (CBS7962-LDH and pdc-LDH) Strains
[0262] The S. cerevisiae CBS7962 strain expressing a heterologous LDH gene from L. plantarum was cultivated in shake flasks in two stages. An inoculum development stage wherein YPD with 20 g/l of glucose was used as a preinoculum medium and a production stage wherein YPD with 250 g/l of glucose was used as a fermentation medium. Batch culture was performed at 30 C. in 100 ml shake flasks. Cells from glycerol vials stored at 80 C were used to inoculate a 20 ml of preinoculum medium at an optical density 600 nm (OD600) of 0.05. After 24 h of growth, the cells were harvested and used to inoculate a 50 ml of fermentation medium at an OD600 of 0.1.
[0263] The pdc strain expressing a heterologous LDH gene was cultivated in shake flasks in two different liquid media. A preinoculum medium containing 1.8 g/l of yeast nitrogen base (YNB) without amino acids and without (NH4)2SO4, 1 g/l of urea, 20 g/l of ethanol and 0.5 g/l of glucose and a fermentation medium containing 4.5 g/l of CaCO3, 1.8 g/l of YNB without amino acids and without (NH4)2SO4, 1 g/l of urea, 1 g/l of ethanol and 40 g/l of glucose, pH 5. Batch culture was performed at 30 C. in 100 ml shake flasks. Cells from glycerol vials stored at 80 C. were used to inoculate a 50 ml of preinoculum medium at an optical density 600 nm (OD600) of 0.1. After 36 h of growth, the cells were harvested and used to inoculate a 50 ml of fermentation medium at an OD600 of 4.5.
[0264] The cultures were incubated at 30 C at 180 rpm and samples were collected at frequent intervals to monitor growth by OD600 measurement. The supernatant was analyzed using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as an eluant with a flow rate of 0.6 ml/min, for metabolites including, glucose, ethanol and lactic acid.
[0265] After 40 h of incubation, the strain, CBS7962 expressing LDH, consumed 250 g/l of glucose and produced 9.4 g/l of lactic acid with a yield of 0.04 g of lactic acid per g of glucose consumed. Remarkably, a significant increase in lactic acid yield was observed when pdc strain expressing LDH was used for lactic acid production. Although pdc strain expressing LDH did not completely consume 40 g/l of glucose after 96 h of incubation, the strain produced 21.3 g/l of lactic acid with a yield of 0.71 g of lactic acid per g of glucose consumed.
Example 10: Two-Step Process for Lactic Acid Production Under Controlled Conditions
[0266] The production process of lactic acid is followed in a two-step process: first step is the cultivation of yeast cells to high cell densities in a fed-batch process and the second step is a batch process for lactic acid production with high initial inoculum. As shown previously (Example 1) in shake flasks experiments at low pH of 3.0, the fermentation rate and ethanol yield was significantly improved with high initial inoculum in a medium containing lactic acid and high glucose concentration. This suggested that inoculum size plays a significant role in determining the performance of a fermentation.
[0267] The first step starts with a batch culture in a medium containing 1.8 g/l of YNB, 5 g/l of (NH4)2SO4 and 20 g/l of glucose. The dissolved oxygen concentration is maintained at 20% by controlling the stirrer speed and aeration rate. The temperature and pH are maintained at optimal values at 30 C. and 5.0, respectively. The batch culture proceeds until complete consumption of glucose and ethanol before a fresh medium is fed into the reactor. The feed-medium contains high concentrations of glucose, 5.4 g/l of YNB and 10 g/l of (NH4)2SO4. Upon exhaustion of ethanol in the batch culture, the feed-medium is fed in to the reactor with a flow rate necessary to maintain the specific growth rate at the critical value which is strain specific and can be determined using prior chemostat cultivations. Maintaining the specific growth rate at the critical value ensures high biomass yield per substrate consumed without forming byproducts such as ethanol and acetate.
[0268] The cells are harvested after the fed-batch cultivation and inoculated to high cell densities into the production reactor. The production medium contains high glucose concentration to ensure high lactic acid titers. The medium is supplemented with necessary nutrients to support cellular metabolism at high glucose concentrations. The pH is a crucial factor in determining the fermentation performance and therefore, maintaining the pH at 5.0 by addition of a salt base or addition of CaCO3 into the medium from the beginning can be a preferred option based on the overall economic analysis of the process.
Example 11: Alternative Two-Step Process for Lactic Acid Production
[0269] The production process of lactic acid is followed in a two-step process: first step is the cultivation of yeast cells to high cell densities in a fed-batch process and the second step is a batch process for lactic acid production with high initial inoculum.
[0270] First Step of Lactic Acid Production:
[0271] The medium for the first culture step is prepared according the following tables, glucose is added to a concentration of 25 g/L:
[0272] Minimal Medium Salts
TABLE-US-00010 (NH.sub.4).sub.2SO.sub.4 5.0 g/L KH.sub.2PO.sub.4 3.0 g/L MgSO.sub.47H.sub.2O 0.5 g/L 1000 vitamin solution 1 mL/L 100 trace elements 10 mL/L
[0273] The ingredients are dissolved in H.sub.2O, the vitamin solution and the trace elements are added, the pH is adjusted to 5.0 with hydrochloric acid. The medium is sterile filtered.
[0274] 1000 Vitamin Solution for Minimal Glucose Medium
TABLE-US-00011 D-biotin 0.05 g/L Ca-D-pantothenate 1.00 g/L Nicotonic acid 1.00 g/L Myo-inositol 25.00 g/L Thiamine hydrochloride 1.00 g/L Pyridoxal hydrochloride 1.00 g/L p-aminobenzoic acid 0.20 g/L
[0275] Biotin is dissolved in 0.1 M NaOH and diluted in H.sub.2O, then the pH is adjusted to 6.5 with 1 M hydrochloric acid. All other components are added and the solution is sterile filtered.
[0276] 100 Trace Elements for Minimal Glucose Medium
TABLE-US-00012 Na.sub.2EDTA 1.50 g/L ZnSO.sub.47H.sub.2O 0.45 g/L MnCl.sub.22H.sub.2O 0.10 g/L CoCl.sub.26H.sub.2O 0.03 g/L CuSO.sub.45H.sub.2O 0.03 g/L Na.sub.2MoO.sub.42H.sub.2O 0.04 g/L CaCl.sub.22H.sub.2O 0.45 g/L FeSO.sub.47H.sub.2O 0.30 g/L H.sub.3BO.sub.3 0.10 g/L KI 0.01 g/L
[0277] EDTA and zinc sulfate are dissolved in H.sub.2O and the pH is adjusted with sodium hydroxide to 6.0. All other components are added and the pH is adjusted with hydrochloric acid to 4.0. The solution is sterile filtered.
[0278] A batch culture is inoculated in a stirred tank reactor to an optical density of 1 from an overnight pre-culture on YPD medium with washed yeast cells. The dissolved oxygen concentration is maintained at 20% by controlling the stirrer speed and aeration rate. The temperature and pH are maintained at 30 C. and 5.0, respectively. The batch culture proceeds until complete consumption of glucose. When glucose is finished the feed is started. The feed-medium contains 500 g/L of glucose and 2 the medium composition as described above. The feed rate is exponential and corresponds to 80% of the maximal growth rate of the yeast strain. The temperature and pH are maintained at 30 C. and 5.0, respectively. The feed continues to a biomass concentration of 100 g/L.
[0279] The second step of the process is initiated by harvest of the cells and inoculation into the production reactor to a concentration of 50 g/L dry cell weight. The production medium contains 150 g/L glucose. The dissolved oxygen concentration is maintained at 20% by controlling the stirrer speed and aeration rate. The temperature is maintained at 30 C. The pH remains uncontrolled and decreases below 3 upon production of lactic acid. The batch culture proceeds until complete consumption of glucose.
[0280] An alternative for the second step of the process is the addition of medium to the first reactor to obtain a glucose concentration of 150 g/L and a biomass concentration of 50 g/L. The dissolved oxygen concentration is maintained at 20% by controlling the stirrer speed and aeration rate. The temperature is maintained at 30 C. The pH remains uncontrolled and decreases below 3 upon production of lactic acid. The batch culture proceeds until complete consumption of glucose.
Example 12: Adaptive Laboratory Evolution (ALE) of pdc S. cerevisiae (CBS7962) Strain Expressing a Heterologous LDH Gene
[0281] The pdc S. cerevisiae strain expressing a heterologous LDH gene from L. plantarum (Example 5) was subjected to adaptive laboratory evolution (ALE). The ALE was conducted in 100 mL shake flasks, containing 10 mL medium, by regularly passaging the overnight culture into a fresh liquid fermentation medium until the culture reached 100 generations.
[0282] A preinoculum medium and two different fermentation media, depending on the concentration of carbon source, were used: A preinoculum medium containing 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4, 4.54 g/L of urea and 10 g/L of ethanol was used. The fermentation media containing 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4, 4.54 g/L of urea, 5 g/L of ethanol and 100 g/L of glucose or 150 g/L of glucose were used, respectively. Four independent evolution experiments for each fermentation medium (100 and 150 g/L glucose) were performed (in total eight).
[0283] The non-evolved cells from glycerol vials, stored at 80 C., were used to inoculate 25 mL of preinoculum medium at an optical density 600 nm (OD.sup.600) of 0.25. After 24 h of growth, the cells were harvested, washed and used for ALE to inoculate 10 mL of fermentation medium at an OD.sup.600 of 0.5. The ALE experiment was conducted until cultures reached 100 generations which corresponds to approximately 40 transfers. The cultures were incubated at 28 C. at 180 rpm. Growth was monitored daily by OD.sup.600 measurement. Supernatants were periodically analysed for metabolites using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as a mobile phase with a flow rate of 0.6 mL/min, RID detector, including glucose, ethanol, acetic acid, glycerol and lactic acid.
[0284] After 100 generations the evolved strains exhibited an improved growth rate and productivity when compared with non-evolved strain (Table 1). The specific growth rate and the lactic acid concentration in the first 24 h of the non-evolved strain were 0.054 h.sup.1 and 2.82 g/L, respectively. After 40 transfers, which correspond to 100 generations, the specific growth rate and the lactic acid concentration in the first 24 h (with starting glucose concentration of 100 g/L) were 0.08 h.sup.1 and 5.8 g/L respectively. Improved specific growth rate of the culture after 40 transfers in the fermentation media with 150 g/L of glucose was also detected: =0.108 h.sup.1 and the lactic acid production was improved from 2.5 g/L to 4.2 g/L. Furthermore, the ethanol concentration during the evolution experiment and after 24 h of incubation, dropped from 2.9 g/L for non-evolved strain to 2.3 g/L for evolved strain after approximately 100 generations.
TABLE-US-00013 Number of Lactate Ethanol Time generations (h.sup.1) (g/L) (g/L) (h) (ALE) Non-evolved 0.054 2.82 2.9 24 2 evolved in 100 g/L 0.08 5.8 2.3 24 90 glucose evolved in 150 g/L 0.1 4.2 2.2 24 100 glucose
Example 13: Characterization of pdc S. cerevisiae (CBS7962) in a Bioreactor with Partially Controlled pH Value
[0285] The pdc S. cerevisiae CBS7962 strain expressing a heterologous LDH gene from L. plantarum was cultivated in a bioreactor in two stages: a first stage for biomass accumulation, wherein 10 g/L of ethanol, 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4 and with 4.54 g/L of urea was used as medium and a production stage wherein 100 g/L of glucose, 5 g/L of ethanol, 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4 and 4.54 g/L of urea was used as a fermentation medium. The first stage was performed in shake flasks and the production stage was performed in a bioreactor (DASGIP system). The shake flask culture was grown at 28 C. in 2000 ml Erlenmeyer flasks, containing 225 mL medium. The cells from the ALE experiments were taken after 50 generations and used to inoculate the first stage at an optical density 600 nm (OD.sup.600) of 2.5. After 30 h of growth, the cells were harvested, washed with water and used to inoculate 330 ml of fermentation medium at an OD600 of 5 in a 1.5 L bioreactor. The dissolved oxygen concentration was maintained at 30% by controlling stirrer speed and aeration rate. The temperature was maintained at optimal value at 28 C. The pH value was maintained for 18 h at the value of 5 and then was not controlled anymore.
[0286] Samples were taken in regular intervals to monitor the growth by OD.sup.600 and the supernatant was analysed for metabolites using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as a mobile phase with a flow rate of 0.6 mL/mi, RID detection, including glucose, ethanol, glycerol, acetic acid and lactic acid. In the first 64 h after stopping the pH control, the pH value decreased from 5 to 3 and then very slightly dropped to a final value of 2.89. The lactic acid production was 30.7 g/L which corresponds to a yield of 0.66 g of lactic acid per g of glucose consumed. Ethanol was consumed in first 40 h after starting batch.
TABLE-US-00014 Number of Glucose genera- Time consumed Lactate Ethanol tions Yield pH (h) (g/L) (g/L) (g/L) (ALE) (g/g) value OD.sup.600 15 11.0 6.22 2.3 50 0.57 5 12.9 64 46.8 30.7 50 0.66 2.99 25.3
Example 14: Characterization of pdc S. cerevisiae (CBS7962) in a is Bioreactor without pH Control
[0287] The pdc S. cerevisiae CBS7962 strain expressing a heterologous LDH gene from L. plantarum was cultivated in a bioreactor in two stages: a first stage for biomass accumulation, wherein 10 g/L of ethanol, 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4 and with 4.54 g/L of urea was used as medium and a production stage wherein 100 g/L of glucose, 5 g/L of ethanol, 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4 and 4.54 g/L of urea was used as a fermentation medium. The first stage was performed in shake flasks and the production stage was performed in a bioreactor (DASGIP system). The shake flask culture was grown at 28 C. in 2000 ml Erlenmeyer flasks, containing 225 mL medium. The cells from the ALE experiments were taken after 75 generations and used to inoculate the first stage at an optical density 600 nm (OD.sup.600) of 2.5. After 30 h of growth, the cells were harvested, washed with water and used to inoculate 330 ml of fermentation medium at an OD600 of 5 in a 1.5 L bioreactor. The dissolved oxygen concentration was maintained at 30% by controlling stirrer speed and aeration rate. The temperature was maintained at optimal value at 28 C. The pH value was not controlled at all from the beginning of the fermentation.
[0288] Samples were taken in regular intervals to monitor the growth by OD.sup.600 and the supernatant was analysed for metabolites using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as a mobile phase with a flow rate of 0.6 mL/mi, RID detection, including glucose, ethanol, glycerol, acetic acid and lactic acid.
[0289] Within the first 15 h of cultivation the pH rapidly dropped from initially 5 to 2.45, and then slightly decreased to remarkable 2.15 after 64 h. During that period, 27.6 g/L of glucose was consumed and 24.5 g/L of lactic acid was produced (which further correspond to a yield of 0.89 g of lactic acid per g of glucose consumed). Ethanol was completely consumed within 47 h.
TABLE-US-00015 Number of Glucose genera- Time consumed Lactate Ethanol tions Yield pH (h) (g/L) (g/L) (g/L) (ALE) (g/g) value OD.sup.600 15 7.87 6.74 2.71 75 0.86 2.45 8.6 64 27.6 24.5 75 0.89 2.16 12
Example 15: Comparison of Evolved and Non-Evolved pdc S. cerevisiae Strains (CBS7962) Expressing a Heterologous LDH Gene in Shake Flasks
[0290] The pdc S. cerevisiae strain expressing a heterologous LDH gene from L. plantarum was cultivated in shake flasks in two different liquid media. A preinoculum medium containing 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4, 4.54 g/L of urea, 10 g/L of ethanol, and a fermentation medium containing 3.4 g/L of YNB without amino acids and without (NH4).sub.2SO.sub.4, 4.54 g/L of urea, 5 g/L of ethanol, 100 g/L of glucose and 4.5 g/L of CaCO.sub.3 were used. The batch culture was performed at 28 C. in 500 ml shake flasks, containing 50 mL medium, and with a starting pH value of 6. The non-evolved cells from glycerol vials, stored at 80 C., were used to inoculate 25 ml of preinoculum medium at an optical density 600 nm (OD600) of 1. The cells from the ALE experiment, obtained after 33 transfers and after approximately 75 generations, were used to inoculate 25 ml of preinoculum medium at an optical density 600 nm (OD.sup.600) of 2. After 40 h of growth, the cells were harvested, washed and used to inoculate a 50 ml of fermentation medium at an OD.sup.600 of 3.
[0291] The cultures were incubated at 28 C. at 180 rpm and samples were collected at frequent intervals (every 24 h) to monitor growth by OD.sup.600 measurement. The supernatant was analysed for metabolites including, glucose, ethanol, acetic acid, glycerol and lactic acid, using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as a mobile phase with a flow rate of 0.6 ml/min and RID detection.
[0292] After 48 h of incubation, the non-evolved pdc strain expressing LDH consumed 14.6 g/L of glucose, while the evolved pdc strain consumed 32.8 g/L, proving the higher glucose uptake rate of the evolved strain. After 90 h of incubation, the non-evolved strain consumed 23.3 g/L. The evolved strain consumed 59.5 g/L of glucose after 90 h. Ethanol was still present in the culture of the non-evolved strain after 90 h (1.22 g/L), while it was completely consumed by the evolved strain (non detectable by HPLC). The non-evolved strain produced 29.6 g/L of lactic acid and reached a pH value of 3, while the evolved strain finally accumulated 51 g/L of lactic acid at a pH of 2.86. The yield is 86% based on g/g glucose.
TABLE-US-00016 Glucose Number of Time consumed Lactate Ethanol generations Yield pH strains (h) (g/L) (g/L) (g/L) (ALE) (g/g) value OD.sup.600 evolved 48 32.8 29.3 0.31 75 0.89 3.1 18.5 evolved 96 59.4 51.0 75 0.86 2.86 18
Example 16: Characterization of Evolved pdc S. cerevisiae Strain (CBS7962) Expressing a Heterologous LDH Gene in Shake Flasks with Different Concentrations of Glucose
[0293] The pdc S. cerevisiae strain expressing a heterologous LDH gene from L. plantarum was cultivated in shake flasks. A preinoculum medium and three different fermentation media, with varying concentrations of glucose were used. A preinoculum medium containing 3.4 g/L of yeast nitrogen base (YNB) without amino acids and without (NH4).sub.2SO.sub.4, 4.54 g/L of urea, 10 g/L of ethanol, and a fermentation media containing 3.4 g/L of YNB without amino acids and without (NH4).sub.2SO.sub.4, 4.54 g/L of urea, 5 g/L of ethanol, 4.5 g/L of CaCO.sub.3 and 60 g/L of glucose or 70 g/L of glucose or 80 g/L of glucose were used. Batch culture was performed at 28 C. in 500 ml shake flasks, containing 50 mL medium, and with starting pH value 6. The cells from adaptive laboratory evolution (ALE), obtained after 33 transfers (approximately 75 generations) were used to inoculate 25 ml of preinoculum medium at an optical density 600 nm (OD.sup.600) of 2. After 40 h of growth, the cells were harvested, washed and used to inoculate 50 ml of fermentation medium at an OD.sup.600 of 3.
[0294] The cultures were incubated at 28 C. at 180 rpm and samples were collected at frequent intervals (every 24 h) to monitor growth by OD.sup.600 measurement. The supernatant was analysed for metabolites including, glucose, ethanol, acetic acid, glycerol and lactic acid, using an Aminex HPX-87H column set in a HPLC (Shimadzu scientific instruments) at 60 C., and 5 mM H.sub.2SO.sub.4 as a mobile phase with a flow rate of 0.6 ml/min, and RID detection.
[0295] The glucose concentration in all fermentation media decreased during the incubation. After 96 h of incubation, the evolved pdc strain, expressing LDH and growing on 80 g/L of glucose, converted 55.3 g/L of glucose to 49.4 g/L of lactic acid. This conversion corresponds to the yield of 0.89 g of lactic acid per g of glucose consumed. Due to exhausted glucose after 72 h of incubation in the fermentation media with 60 g/L of glucose, the production of lactic acid reached maximum and remained unchanged thereafter. From the other side, the ethanol concentration in all three fermentation media and after 48 h of incubation was not detected. The growth characteristic (OD.sup.600 value) and the pH profile during the cultivation were similar for all cultures cultivated in different fermentation media.
TABLE-US-00017 Glucose Glucose Number of Time concentration consumed Lactate Ethanol generations Yield pH (h) (g/L) (g/L) (g/L) (g/L) (ALE) (g/g) value OD.sup.600 48 60 32.4 28.1 0.9 75 0.87 3.17 10.4 96 60 53.1 41.7 75 0.79 2.98 12.5 48 70 29.8 26.8 0.9 75 0.9 3.17 10.4 96 70 57.4 49.2 75 0.86 2.85 11.5 48 80 28.0 27.2 0.8 75 0.97 3.18 10.2 96 80 55.3 49.4 75 0.89 2.84 10.8