Equine Influenza Virus Live Attenuated Vaccines
20190125860 ยท 2019-05-02
Inventors
Cpc classification
C12N2760/16121
CHEMISTRY; METALLURGY
C12N2760/16134
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
International classification
Abstract
The present invention provides compositions and methods related to equine live-attenuated influenza vaccines.
Claims
1. An immunological composition comprising an equine live-attenuated influenza virus, wherein the virus comprises one or more mutations in one or more of: segment 1 and segment 2 of the viral genome.
2. The composition of claim 1 wherein the segment 1 comprises the nucleic acid sequence set forth in SEQ ID NO: 1.
3. The composition of claim 1, wherein the segment 2 comprises the nucleic acid sequence set forth in SEQ ID NO: 3.
4. The composition of claim 1, wherein the virus comprises one or more mutations in segment 1, which encodes mutant PB2.
5. The composition of claim 4, wherein mutant PB2 comprises a N265S point mutation.
6. The composition of claim 4, wherein mutant PB2 comprises the amino acid sequence set forth in SEQ ID NO: 2.
7. The composition of claim 1, wherein the virus comprises one or more mutations in segment 2, which encodes mutant PB1.
8. The composition of claim 7, wherein mutant PB1 comprises one or more of: K391E point mutation, E581G point mutation, and A661T point mutation.
9. The composition of claim 7, wherein mutant PB1 comprises a K391E point mutation, a E581G point mutation, and an A661T point mutation.
10. The composition of claim 7, wherein mutant PB1 comprises the amino acid sequence set forth in SEQ ID NO: 4.
11. The composition of claim 1, wherein the virus comprises one or more mutations in segment 1, which encodes mutant PB2; and one or more mutations in segment 2, which encodes mutant PB1.
12. The composition of claim 11, wherein mutant PB2 comprises a N265S point mutation and wherein mutant PB1 comprises a K391E point mutation, a E581G point mutation, and an A661T point mutation.
13. The composition of claim 1 wherein the virus is derived from H3N8 subtype of equine influenza A virus.
14. The composition of claim 1 wherein the composition is used for the treatment of equine influenza in a subject.
15. The composition of claim 1, wherein the virus is a master donor virus (MDV) expressing mutant EIV H3N8 PB2, mutant EIV H3N8 PB1, and HA and NA of a different EIV strain.
16. A method for inducing an immune response against equine influenza virus in a subject, the method comprising administering to the subject an immunological composition comprising an equine live-attenuated influenza virus, wherein the virus comprises one or more mutations in one or more of segment 1 and segment 2 of the viral genome.
17. The method of claim 16, wherein the segment 1 comprises the nucleic acid sequence set forth in SEQ ID NO: 1.
18. The method of claim 16, wherein the segment 2 comprises the nucleic acid sequence set forth in SEQ ID NO: 3.
19. The method of claim 16, wherein the virus comprises one or more mutations in segment 1, which encodes mutant PB2.
20. The method of claim 19, wherein mutant PB2 comprises a N265S point mutation.
21. The method of claim 19, wherein mutant PB2 comprises the amino acid sequence set forth in SEQ ID NO: 2.
22. The method of claim 16, wherein the virus comprises one or more mutations in segment 2, which encodes mutant PB1.
23. The method of claim 22, wherein mutant PB1 comprises one or more of: K391E point mutation, E581G point mutation, and A661T point mutation.
24. The method of claim 22, wherein mutant PB1 comprises a K391E point mutation, a E581G point mutation, and an A661T point mutation.
25. The method of claim 22, wherein mutant PB1 comprises the amino acid sequence set forth in SEQ ID NO: 4.
26. The method of claim 16, wherein the virus comprises one or more mutations in segment 1, which encodes mutant PB2; and one or more mutations in segment 2, which encodes mutant PB1.
27. The method of claim 26, wherein mutant PB2 comprises a N265S point mutation and wherein mutant PB1 comprises a K391E point mutation, a E581G point mutation, and an A661T point mutation.
28. The method of claim 16, wherein the virus is derived from H3N8 subtype of equine influenza A virus.
29. The method of claim 16, wherein the subject does not have equine influenza, and wherein the method induces immunity against equine influenza.
30. The method of claim 16, wherein the subject is infected equine influenza, and wherein the method induces a therapeutic immune response.
31. The method of claim 16, wherein the immunological composition is administered intranasally, intratracheally, orally, intradermally, intramuscularly, intraperitoneally, intravenously, or subcutaneously.
32. The method of claim 16, wherein the subject is a horse.
33. The method of claim 16, wherein the virus is a master donor virus (MDV) expressing mutant EIV H3N8 PB2, mutant EIV H3N8 PB1, and HA and NA of a different EIV strain.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0019] The following detailed description of preferred embodiments of the invention will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, there are shown in the drawings embodiments which are presently preferred. It should be understood, however, that the invention is not limited to the precise arrangements and instrumentalities of the embodiments shown in the drawings.
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION
[0027] The present invention relates to compositions and methods for the treatment and prevention of equine influenza virus (CIV) and EIV-related pathology. The present invention is based in part upon the discovery that various mutations in segment 1 and segment 2 of the EIV genome, thereby encoding mutant PB2 and PB1 protein, render the virus to be temperature-sensitive. For example, it is described herein that such mutations result in EIV exhibiting reduced viral replication at normal and elevated body temperature as compared to wildtype EIV. However, the temperature-sensitive EIV is able to induce a EIV-specific immune response. Thus, the temperature-sensitive EIV described herein is a live-attenuated influenza vaccine (LAIV), sometimes referred to herein as EIV LAIV. Importantly, the presently described EIV LAIV is more effective in treating EIV compared to the commercially available vaccine.
[0028] Described herein is the development of an effective and safe LAIV for the prevention and control of H3N8 EIV in horses. Reverse genetic approaches along with modifications in the viral PB2 (N265S) and PB1 (K391E, E581G, and A661T) polymerase subunits of influenza A/equine/Ohio/1/2003 H3N8 virus was used to make a cold-adapted, temperature sensitive EIV H3N8 LAIV. Compared to current inactivated vaccines, the presently described cold-adapted, temperature sensitive LAIV approach provides better and long-lasting protection against disease caused by H3N8 EIV, because LAIV induces faster and stronger production of both innate and adaptive humoral and T-cell immune responses in the target tissues of the respiratory tract. Also, in certain instances the LAIV is administered through nasal spray, which avoids the swelling and muscle soreness associated with intramuscular infections of inactivated vaccines. Moreover, in some embodiments, a single immunization with the cold-adapted, temperature sensitive LAIV is sufficient, compared to the multiple doses required with the current inactivated vaccines, to confer full protection against H3N8 EIV in a shorter period of time. Further, the present LAIV technology would provide better cross protection against antigenically different EIV H3N8 strains than that provided by the current inactivated vaccines, diminishing the chance of H3N8 EIV outbreaks.
[0029] Compared to the only available EIV H3N8 LAIV, the present technology also offers a number of advantages. The mutations introduced in the PB2 and PB1 polymerase subunits of influenza A/equine/Ohio/1/2003 H3N8 are different than those generated by cold-adaptation of the current influenza A/equine/Kentucky/1/91 H3N8 LAIV; but able to confer similar cold-adapted, temperature sensitive phenotype to the virus. Moreover, the use of state-of-the-art reverse genetic techniques facilitates, similar to the case of human LAIV, the fast and accurate development of LAIV candidates for the treatment of currently circulating Florida clade 1 and 2 subtypes, or newly introduced H3N8 EIV strains. Thus, the present LAIV approach is more effective than the currently available LAIV to treat H3N8 EIV infections in horses because of strain match. Importantly, and contrary to the current LAIV, the present cold-adapted, temperature sensitive influenza A/equine/Ohio/1/2003 H3N8 virus could be used as a master donor virus (MDV) to produce updated LAIV yearly by the introduction of HA and NA glycoproteins from antigenically different circulating EIV strains, with the final purpose being the prevention and control of currently circulating or potentially new antigenically different H3N8 equine influenza viruses in the horse population.
Definitions
[0030] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described.
[0031] As used herein, each of the following terms has the meaning associated with it in this section.
[0032] The articles a and an are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, an element means one element or more than one element.
[0033] About as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of 20%, 10%, 5%, 1%, or 0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.
[0034] The term antibody, as used herein, refers to an immunoglobulin molecule which specifically binds with an antigen. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. The antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab).sub.2, as well as single chain antibodies and humanized antibodies (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
[0035] The term antigen or Ag as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an antigen as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a gene at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample.
[0036] As used herein, the term autologous is meant to refer to any material derived from the same individual to which it is later to be re-introduced into the individual.
[0037] As used herein, by combination therapy is meant that a first agent is administered in conjunction with another agent. In conjunction with refers to administration of one treatment modality in addition to another treatment modality. As such, in conjunction with refers to administration of one treatment modality before, during, or after delivery of the other treatment modality to the individual. Such combinations are considered to be part of a single treatment regimen or regime.
[0038] As used herein, the term concurrent administration means that the administration of the first therapy and that of a second therapy in a combination therapy overlap with each other.
[0039] A disease is a state of health of an animal wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal's health continues to deteriorate. In contrast, a disorder in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal's state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal's state of health.
[0040] An effective amount as used herein, means an amount which provides a therapeutic or prophylactic benefit.
[0041] The term expression as used herein is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
[0042] Expression vector refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
[0043] Homologous refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
[0044] The term immunoglobulin or Ig, as used herein, is defined as a class of proteins, which function as antibodies. Antibodies expressed by B cells are sometimes referred to as the BCR (B cell receptor) or antigen receptor. The five members included in this class of proteins are IgA, IgG, IgM, IgD, and IgE. IgA is the primary antibody that is present in body secretions, such as saliva, tears, breast milk, gastrointestinal secretions and mucus secretions of the respiratory and genitourinary tracts. IgG is the most common circulating antibody. IgM is the main immunoglobulin produced in the primary immune response in most subjects. It is the most efficient immunoglobulin in agglutination, complement fixation, and other antibody responses, and is important in defense against bacteria and viruses. IgD is the immunoglobulin that has no known antibody function, but may serve as an antigen receptor. IgE is the immunoglobulin that mediates immediate hypersensitivity by causing release of mediators from mast cells and basophils upon exposure to allergen.
[0045] As used herein, the term immune response includes T-cell mediated and/or B-cell mediated immune responses. Exemplary immune responses include T cell responses, e.g., cytokine production and cellular cytotoxicity, and B cell responses, e.g., antibody production. In addition, the term immune response includes immune responses that are indirectly affected by T cell activation, e.g., antibody production (humoral responses) and activation of cytokine responsive cells, e.g., macrophages. Immune cells involved in the immune response include lymphocytes, such as B cells and T cells (CD4+, CD8+, Th1 and Th2 cells); antigen presenting cells (e.g., professional antigen presenting cells such as dendritic cells, macrophages, B lymphocytes, Langerhans cells, and non-professional antigen presenting cells such as keratinocytes, endothelial cells, astrocytes, fibroblasts, oligodendrocytes); natural killer cells; myeloid cells, such as macrophages, eosinophils, mast cells, basophils, and granulocytes.
[0046] Isolated means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not isolated, but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is isolated. An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
[0047] Parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
[0048] The terms patient, subject, individual, and the like are used interchangeably herein, and refer to any animal, or cells thereof whether in vitro or in situ, amenable to the methods described herein.
[0049] The term simultaneous administration, as used herein, means that a first therapy and second therapy in a combination therapy are administered with a time separation of no more than about 15 minutes, such as no more than about any of 10, 5, or 1 minutes. When the first and second therapies are administered simultaneously, the first and second therapies may be contained in the same composition (e.g., a composition comprising both a first and second therapy) or in separate compositions (e.g., a first therapy in one composition and a second therapy is contained in another composition).
[0050] By the term specifically binds, as used herein with respect to an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross-species reactivity does not itself alter the classification of an antibody as specific. In another example, an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of an antibody as specific. In some instances, the terms specific binding or specifically binding, can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope A, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled A and the antibody, will reduce the amount of labeled A bound to the antibody.
[0051] The term normal temperature or normal body temperature as used herein refers to the temperature of a healthy subject. For example, in certain instances the normal body temperature in a human subject is in the range of about 36 C. to about 38 C. In certain instances, in an equine subject, normal body temperature is in the range of about 37.5 C. to about 38.7 C.
[0052] The term elevated temperature or elevated body temperature as used herein refers to a temperature in a subject that is greater than the normal body temperature of a subject of a given organism. In certain instances elevated body temperature may be indicative of a fever, infection, or other illness. In certain instances, elevated body temperature in a human subject is greater than about 37 C. In certain instances, elevated body temperature in an equine subject is greater than about 38.9 C.
[0053] The term therapeutic as used herein means a treatment and/or prophylaxis. A therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
[0054] The term therapeutically effective amount refers to the amount of the subject compound that will elicit the biological or medical response of a tissue, system, or subject that is being sought by the researcher, veterinarian, medical doctor or other clinician. The term therapeutically effective amount includes that amount of a compound that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the signs or symptoms of the disorder or disease being treated. The therapeutically effective amount will vary depending on the compound, the disease and its severity and the age, weight, etc., of the subject to be treated.
[0055] To treat a disease as the term is used herein, means to reduce the frequency or severity of at least one sign or symptom of a disease or disorder experienced by a subject.
[0056] The term transfected or transformed or transduced as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transfected or transformed or transduced cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
[0057] Ranges: throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
DESCRIPTION
[0058] The present invention provides immunological compositions and methods useful for the inhibition, prevention and treatment of equine influenza and equine influenza related diseases and disorders. In one embodiment, the immunological composition comprises a live-attenuated virus (LAV).
[0059] In one embodiment, the present invention provides a temperature-sensitive LAV of an equine influenza virus. For example, it is demonstrated herein that one or more mutations in segment 1 and/or segment 2 of the EIV genome renders the virus to be temperature-sensitive. The temperature-sensitive EIV LAIV of the present invention exhibits reduced viral replication, as compared to wildtype EIV, at both normal body temperature and at elevated or fever temperatures. However, the temperature sensitive EIV LAIV provides antigen-specific immune responses and protection against EIV. In one embodiment, the EIV LAIV provides at least the same antigen-specific immune responses and protection against EIV compared to wildtype EIV. In certain embodiments, the EIV LAIV provides greater antigen-specific immune responses and protection against EIV as compared to inactivated EIV.
[0060] In one embodiment, the composition comprises an EIV LAIV having one or more mutations in segment 1 and/or segment 2 of the viral genome. For example, in one embodiment, the EIV LAIV encodes mutant PB2 and/or mutant PB1. In certain embodiments, mutant PB2 comprises a N265S point mutation. In certain embodiments, mutant PB1 comprises at least one of a K391E point mutation, a E581G point mutation, or A661T point mutation.
[0061] In certain embodiments, the present invention provides a composition comprising a master donor virus (MDV) having one or more mutations in segment 1 and/or segment 2 of the viral genome. In one embodiment, the MDV comprises mutant H3N8 segment 1 and/or segment 2, as described herein. In certain embodiments, the MDV can be used to generate an LAIV which is protective against other pathogens. For example, in certain embodiments, an LAV against another influenza strain can be generated by using the MDV to express one or more viral proteins (e.g., HA or NA) of the other strain.
[0062] In certain embodiments, the present invention provides a method for treating or preventing EIV and EIV-related pathology, comprising administering a composition comprising an EIV LAIV. In certain embodiments, the method comprises intranasal delivery of the EIV LAIV.
[0063] In general, wild-type influenza viruses contain a segmented genome with 8 segments as described in Table 1 below:
TABLE-US-00001 TABLE 1 Segment Gene Product 1 PB2 (Polymerase (basic) protein 2) 2 PB1 (Polymerase (basic) protein 1) 3 PA (Polymerase (acidic) protein) 4 HA (Hemagglutinin) 5 NP (Nucleoprotein) 6 NA (Neuraminidase) 7 M1 (Matrix protein 1) and M2 (Matrix protein 2) 8 NS1 (non-structural protein 1) and NEP/NS2 (non-structural protein 2)
[0064] In certain embodiments, the present invention provides an immunological composition comprising segment 1 and/or segment 2, wherein segment 1 and/or segment 2 comprise one or more mutations. For example, in certain embodiments, the immunological composition comprises an LAIV, comprising one or more mutations in segment 1 and/or segment 2. In one embodiment, the immunological composition comprises an EIV LAIV, comprising one or more mutations in segment 1 and/or segment 2.
[0065] The present invention also provides methods of preventing, inhibiting, and treating EIV and EIV-related diseases and disorders. In one embodiment, the methods of the invention induce immunity against EIV by generating an immune response directed to EIV. In one embodiment, the methods of the invention induce production of EIV-specific antibodies. In one embodiment, the methods of the invention prevent EIV-related pathology. In one embodiment, the methods of the invention comprise administering an immunological composition comprising a LAV, wherein the LAV comprises one or more mutations in segment 1 and/or segment 2, to a subject in need thereof. In one embodiment, the methods comprise administering an immunological composition to a subject in need thereof, thereby inducing immunity to EIV.
Compositions
[0066] The present invention provides immunological compositions that when administered to a subject in need thereof, elicit an immune response directed against equine influenza virus (EIV). In some embodiments, the composition includes polypeptides, nucleotides, vectors, or vaccines. Further, when the compositions are administered to a subject, they elicit an immune response that serves to protect the inoculated subject against equine influenza. As exemplified herein, the composition can be obtained in large quantities for use as a vaccine.
[0067] In one embodiment, the present invention provides compositions that are useful as immunomodulatory agents, for example, in stimulating immune responses and in preventing equine influenza and equine influenza-related pathology.
[0068] Live-attenuated viruses can be used as immunostimulatory agents to induce the production of EIV-specific antibodies and protect against equine influenza and equine influenza-related pathology. Therefore, in one embodiment, the composition of the invention comprises a live-attenuated EIV (EIV LAIV), wherein the EIV LAIV comprises one or more mutations in the viral genome to render the EIV LAIV temperature sensitive. For example, in one embodiment, the EIV LAIV comprises one or more mutations in segment 1 of the viral genome. The one or more mutations in segment 1 of the viral genome encode a mutant PB2 protein. In one embodiment, the EIV LAIV comprises one or more mutations in segment 2 of the viral genome. The one or more mutations in segment 2 of the viral genome encode a mutant PB1 protein. In one embodiment, the EIV LAIV comprises one or more mutations in segment 1 and one or more mutations in segment 2.
[0069] In one embodiment, the EIV LAIV is based upon the genome of Influenza A/equine/Ohio/1/2003 H3N8. Wildtype nucleic acid sequences for each segment of Influenza A/equine/Ohio/1/2003 H3N8 and wildtype amino acid sequences for the encoded proteins are summarized in Table 2 below:
TABLE-US-00002 TABLE 2 Wildtype sequences for Influenza A/equine/Ohio/1/2003 H3N8 Segments Gene Products Segment 1 (SEQ ID NO: 5) PB2 (SEQ ID NO: 6) Segment 2 (SEQ ID NO: 7) PB1 (SEQ ID NO: 8) Segment 3 (SEQ ID NO: 9) PA (SEQ ID NO: 10) Segment 4 (SEQ ID NO: 11) HA (SEQ ID NO: 12) Segment 5 (SEQ ID NO: 13) NP (SEQ ID NO: 14) Segment 6 (SEQ ID NO: 15) NA (SEQ ID NO: 16) Segment 7 (SEQ ID NO: 17) M1 (SEQ ID M2 (SEQ ID NO: 18) NO: 19) Segment 8 (SEQ ID NO: 20) NS1 (SEQ ID NEP/NS2 (SEQ NO: 21) ID NO: 22)
[0070] In one embodiment, the composition comprises one or more mutations in the nucleic acid sequences of segment 1, encoding PB2, and/or segment 2, encoding PB1. Thus, in certain embodiments, the composition encodes mutant PB1 and/or mutant PB2. As described herein, the one or more mutations renders the virus to be temperature-sensitive, exhibited reduced viral replication at normal or elevated temperatures.
[0071] In some embodiments, the invention provides a composition comprising one or more mutations in segment 1. For example, in one embodiment, the composition comprises segment 1 having one or more mutation which results in the production of mutant PB2 having a point mutation at amino acid residue 265. For example, in one embodiment, the mutant PB2 comprises the amino acid sequence of SEQ ID NO: 6, except having a point mutation at amino acid residue 265. For example, in one embodiment, the mutant PB2 comprises a N265S point mutation, where the mutant PB2 comprises a serine at amino acid residue 265.
[0072] In one embodiment, the composition comprises a nucleic acid sequence encoding a mutant PB2 having an amino acid sequence of SEQ ID NO: 2. In one embodiment, the composition comprises a nucleic acid sequence encoding a mutant PB2 that is substantially homologous to SEQ ID NO: 2. For example, in certain embodiments, the composition comprises a nucleic acid sequence that encodes a mutant PB2 that is at least 50% homologous, at least 60% homologous, at least 70% homologous, at least 80% homologous, at least 90% homologous, at least 95% homologous, at least 98% homologous, at least 99% homologous, or at least 99.5% homologous to SEQ ID NO: 2. In one embodiment, the composition comprises a nucleic acid sequence encoding a mutant PB2 that is substantially homologous to SEQ ID NO: 2, where mutant PB2 that is substantially homologous to SEQ ID NO: 2 comprises the N265S point mutation.
[0073] In one embodiment, the composition comprises a mutant segment 1 comprising the nucleotide sequence of SEQ ID NO: 1. In one embodiment, the composition comprises nucleotide sequence that is substantially homologous to SEQ ID NO: 1. For example, in certain embodiments, the composition comprises a nucleotide sequence that is at least 50% homologous, at least 60% homologous, at least 70% homologous, at least 80% homologous, at least 90% homologous, at least 95% homologous, at least 98% homologous, at least 99% homologous, or at least 99.5% homologous to SEQ ID NO: 1. In one embodiment, the composition comprises a nucleotide sequence that is substantially homologous to SEQ ID NO: 1, where the mutant PB2 encoded by the nucleotide sequence that is substantially homologous to SEQ ID NO: 1 comprises the N265S point mutation.
[0074] In some embodiments, the invention provides a composition comprising one or more mutations in segment 2. For example, in one embodiment, the composition comprises segment 2 having one or more mutation which results in the production of mutant PB1 having a point mutation at one or more of: amino acid residue 391, amino acid residue 581, and amino acid residue 661. For example, in one embodiment, the mutant PB2 comprises the amino acid sequence of SEQ ID NO: 8, except having a point mutation at one or more of: amino acid residue 391, amino acid residue 581, and amino acid residue 661. For example, in one embodiment, the mutant PB1 comprises a K391E point mutation, where the mutant PB1 comprises a glutamic acid at amino acid residue 391. In one embodiment, the mutant PB1 comprises a E581G point mutation, where the mutant PB1 comprises a glycine at amino acid residue 581. In one embodiment, the mutant PB1 comprises a A661T point mutation, where the mutant PB1 comprises a threonine at amino acid residue 661.
[0075] In one embodiment, the composition comprises a nucleic acid sequence encoding a mutant PB1 having an amino acid sequence of SEQ ID NO: 4. In one embodiment, the composition comprises a nucleic acid sequence encoding a mutant PB1 that is substantially homologous to SEQ ID NO: 4. For example, in certain embodiments, the composition comprises a nucleic acid sequence that encodes a mutant PB1 that is at least 50% homologous, at least 60% homologous, at least 70% homologous, at least 80% homologous, at least 90% homologous, at least 95% homologous, at least 98% homologous, at least 99% homologous, or at least 99.5% homologous to SEQ ID NO: 4. In one embodiment, the composition comprises a nucleic acid sequence encoding a mutant PB1 that is substantially homologous to SEQ ID NO: 4, where mutant PB1 that is substantially homologous to SEQ ID NO: 4 comprises one or more of the K391E point mutation, E581G point mutation, and A661T point mutation.
[0076] In one embodiment, the composition comprises a mutant segment 2 comprising the nucleotide sequence of SEQ ID NO: 3. In one embodiment, the composition comprises nucleotide sequence that is substantially homologous to SEQ ID NO: 3. For example, in certain embodiments, the composition comprises a nucleotide sequence that is at least 50% homologous, at least 60% homologous, at least 70% homologous, at least 80% homologous, at least 90% homologous, at least 95% homologous, at least 98% homologous, at least 99% homologous, or at least 99.5% homologous to SEQ ID NO: 3. In one embodiment, the composition comprises a nucleotide sequence that is substantially homologous to SEQ ID NO: 3, where the mutant PB1 encoded by the nucleotide sequence that is substantially homologous to SEQ ID NO: 3 comprises one or more of the K391E point mutation, E581G point mutation, and A661T point mutation.
[0077] In certain embodiments, the composition comprises one or more mutations in segment 1 and one or more mutations in segment 2. For example, in certain embodiments, the composition comprises segment 1 having a N265S point mutation, and segment 2 having one or more of K391E point mutation, E581G point mutation, and A661T point mutation.
[0078] In certain embodiments, the composition comprises one or more mutations in the nucleic acid sequences of segment 1 and/or segment 2, while comprising wildtype nucleic acid sequences for the rest of the segmented genome. For example, in one embodiment, the EIV LAIV comprises one or more mutations in segment 1 and comprises wildtype segment 2, segment 3, segment 4, segment 5, segment 6, segment 7, and segment 8. In one embodiment, the EIV LAIV comprises one or more mutation is segment 2 and comprises wildtype segment 1, segment 3, segment 4, segment 5, segment 6, segment 7, and segment 8. In one embodiment, the EIV LAIV comprises one or more mutations in segment 1 and segment 2 and comprises wildtype segment 3, segment 4, segment 5, segment 6, segment 7, and segment 8.
[0079] In certain embodiments, the composition comprises one or more mutations in segment 1 and/or segment 2, in combination with one or more mutations in one or more other segments of the viral genome.
[0080] In certain embodiments, the composition comprises a mutant segment 1, mutant segment 2, or combination thereof, as described herein, in combination with one or more nucleotide sequences encoding another antigen. For example, in certain embodiments, the composition comprises a mutant segment 1, mutant segment 2, or combination thereof, as described herein, in combination with one or more nucleotide sequences encoding one or more antigens of another virus or strain. For example, in certain aspects, the H3N8 EIV LAIV described herein, comprising a mutant segment 1, mutant segment 2, or combination thereof can be used as a master donor virus (MDV). For example, an MDV comprising an H3N8 comprising a mutant segment 1, mutant segment 2, or combination thereof described herein, can be modified to comprise one or more nucleotide sequences encoding one or more of PB2, PB1, PA, NP, HA, NA, M1, M2, NS1, or NEP/NS2 from another influenza strain. As such a composition comprising an H3N8 comprising a mutant segment 1, mutant segment 2, or combination thereof described herein can provide protection against a different strain, when the composition expresses an antigen of the different strain. For example, in one embodiment, a composition comprises the backbone of a H3N8 EIV LAIV comprising a mutant segment 1, mutant segment 2, or combination thereof described herein, further comprising one or more nucleotide sequences encoding one or more of PB2, PB1, PA, NP, HA, NA, M1, M2, NS1, or NEP/NS2 from another influenza strain. In one embodiment, the composition comprises the backbone of a H3N8 EIV LAIV comprising a mutant segment 1, mutant segment 2, or combination thereof described herein, further comprising one or more nucleotide sequences encoding one or more of HA or NA of a different influenza strain. For example, the composition comprising the backbone of a H3N8 EIV LAIV described herein, may be modified to express one or more viral proteins of a newly emergent strain, thereby providing protection against the newly emergent strain.
[0081] In one embodiment, the composition comprises segment 1, segment 2, segment 3, segment 5, segment 7, and segment 8 of H3N8 EIV LAIV, described herein, comprising one or more point mutations in one or more of segment 1 and segment 2, where the composition further comprises segment 4 and segment 6, of a different EIV strain.
[0082] In one embodiment, the composition comprises a mutant segment 1 of H3N8, mutant segment 2 of H3N8, or a combination thereof, further comprising segment 4, segment 6, or a combination thereof of a different EIV strain. In certain aspects, the mutant segment 1, mutant segment 2, or combination thereof of H3N8 provides for the temperature sensitive attenuated phenotype of the EIV LAIV, while the segment 4, segment 6, or combination thereof, of the different EIV strain, encodes HA, NA, or combination thereof of the different EIV strain to elicit a specific immune response to the different EIV strain in the subject.
[0083] In one embodiment, the composition comprises a plurality of EIV LAIV described herein. For example, in one embodiment, the composition comprises a first EIV LAIV, comprising mutant segment 1, mutant segment 2, or combination thereof of H3N8, where the first EIV LAIV comprises segment 4, segment 6, or a combination thereof of H3N8; and the composition further comprises a second EIV LAIV, comprising mutant segment 1, mutant segment 2, or combination thereof of H3N8, where the second EIV LAIV comprises segment 4, segment 6, or a combination thereof of a different EIV strain. In certain embodiments, the composition induces an immune response against both H3N8 and the other EIV strain.
[0084] In certain embodiments, the composition comprises a polynucleotide encoding mutant PB2 and/or mutant PB1. The polynucleotide can be RNA or DNA. In one embodiment, the composition comprises a DNA vaccine.
[0085] The nucleic acid sequences include both the DNA sequence that is transcribed into RNA and the RNA sequence that is translated into a polypeptide. According to other embodiments, the polynucleotides of the invention are inferred from the amino acid sequence of the polypeptides of the invention. As is known in the art several alternative polynucleotides are possible due to redundant codons, while retaining the biological activity of the translated polypeptides.
[0086] Further, the invention encompasses an isolated nucleic acid comprising a nucleotide sequence having substantial homology to a nucleotide sequence of an isolated nucleic acid encoding a polypeptide disclosed herein. Preferably, the nucleotide sequence of an isolated nucleic acid encoding a polypeptide of the invention is substantially homologous, that is, is about 60% homologous, more preferably about 70% homologous, even more preferably about 80% homologous, more preferably about 90% homologous, even more preferably, about 95% homologous, and even more preferably about 99% homologous to a nucleotide sequence of an isolated nucleic acid encoding a polypeptide of the invention.
[0087] It is to be understood explicitly that the scope of the present invention encompasses homologs, analogs, variants, fragments, derivatives and salts, including shorter and longer polypeptides and polynucleotides, as well as polypeptide and polynucleotide analogs with one or more amino acid or nucleic acid substitution, as well as amino acid or nucleic acid derivatives, non-natural amino or nucleic acids and synthetic amino or nucleic acids as are known in the art, with the stipulation that these modifications must preserve the immunologic activity of the original molecule. Specifically any active fragments of the active polypeptides as well as extensions, conjugates and mixtures are included and are disclosed herein according to the principles of the present invention.
[0088] The invention should be construed to include any and all isolated nucleic acids which are homologous to the nucleic acids described and referenced herein, provided these homologous nucleic acids encode polypeptides having the biological activity of the polypeptides disclosed herein.
[0089] The skilled artisan would understand that the nucleic acids of the invention encompass a RNA or a DNA sequence encoding a polypeptide of the invention, and any modified forms thereof, including chemical modifications of the DNA or RNA which render the nucleotide sequence more stable when it is cell free or when it is associated with a cell. Chemical modifications of nucleotides may also be used to enhance the efficiency with which a nucleotide sequence is taken up by a cell or the efficiency with which it is expressed in a cell. Any and all combinations of modifications of the nucleotide sequences are contemplated in the present invention.
[0090] Further, any number of procedures may be used for the generation of mutant, derivative or variant forms of a protein of the invention using recombinant DNA methodology well known in the art such as, for example, that described in Sambrook et al. (2012, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York). Procedures for the introduction of amino acid changes in a polypeptide or polypeptide by altering the DNA sequence encoding the polypeptide are well known in the art and are also described in these, and other, treatises.
[0091] According to yet another embodiment, composition of the invention, comprising the nucleic acid sequences or combination of nucleic acid sequences of the present invention, is capable of generating an EIV-specific immune response. In another embodiment, the composition of the invention, comprising the nucleic acid sequences or combination of nucleic acid sequences of the present invention, is capable of generating EIV-specific antibodies. In certain embodiments, the composition is able to protect against EIV, including H3N8 EIV.
[0092] In one embodiment, the composition of the invention comprises a polypeptide, or a fragment of a polypeptide, a homolog, a variant, a derivative or a salt of a polypeptide having the sequence of any one or more of SEQ ID NO: 2 and SEQ ID NO: 4.
[0093] The invention should also be construed to include any form of a polypeptide having substantial homology to the polypeptides disclosed herein. Preferably, a polypeptide which is substantially homologous is about 50% homologous, more preferably about 70% homologous, even more preferably about 80% homologous, more preferably about 90% homologous, even more preferably, about 95% homologous, and even more preferably about 99% homologous to amino acid sequence of the polypeptides disclosed herein.
[0094] According to yet another embodiment, composition of the invention, comprising the polypeptide or combination of polypeptides of the present invention, is capable of generating an EIV-specific immune response. In another embodiment, the composition of the invention, comprising the polypeptide or combination of polypeptides of the present invention, is capable of generating EIV-specific antibodies. In certain embodiments, the composition is able to protect against EIV, including H3N8 EIV.
[0095] The present invention should also be construed to encompass mutants, derivatives, and variants of the polypeptides of the invention (or of the DNA encoding the same) which mutants, derivatives and variants are polypeptides which are altered in one or more amino acids (or, when referring to the nucleotide sequence encoding the same, are altered in one or more base pairs) such that the resulting polypeptide (or DNA) is not identical to the sequences recited herein, but has the same biological property as the polypeptides disclosed herein.
Live Attenuated Virus (LAV)
[0096] The invention relates in part to the generation, selection and identification of live attenuated viruses (LAV) that generate a EIV-specific immune response, and the use of such viruses in vaccine and pharmaceutical formulations.
[0097] As described herein, in certain embodiments the EIV LAIV comprises one or more mutations in segment 1 and/or one or more mutations in segment 2 that render the virus to be temperature-sensitive. For example, in one embodiment, the temperature-sensitive EIV LAIV exhibits reduced viral replication at normal and elevated temperatures. However, the temperature-sensitive EIV LAIV induces EIV-specific immune responses and antibody production, and is thus able to protect against EIV and EIV-related pathology.
[0098] Any mutant virus or strain which has at least one mutation can be selected and used in accordance with the invention. In one embodiment, naturally occurring mutants or variants, or spontaneous mutants can be selected that include at least one mutation in segment 1 and/or segment 2, as described elsewhere herein. In another embodiment, mutant viruses can be generated by exposing the virus to mutagens, such as ultraviolet irradiation or chemical mutagens, or by multiple passages and/or passage in non-permissive hosts. Screening in a differential growth system can be used to select for those mutants having at least one mutation in segment 1 and/or segment 2, as described elsewhere herein. For viruses with segmented genomes, the attenuated phenotype can be transferred to another strain having a desired antigen by reassortment, (i.e., by coinfection of the attenuated virus and the desired strain, and selection for reassortants displaying both phenotypes).
[0099] In another embodiment, mutations can be engineered into an influenza virus, including, but not limited to H3N8 EIV using reverse genetics approaches. In this way, natural or other mutations which confer the attenuated phenotype can be engineered into vaccine strains. For example, deletions, insertions, or substitutions of the coding region of segment 1, encoding PB2, and/or segment 2, encoding PB1 can be engineered. Deletions, substitutions or insertions in the non-coding region of segment 1 and/or segment 2 are also contemplated. To this end, mutations in the signals responsible for the transcription, replication, polyadenylation and/or packaging of segment 1 and/or segment 2 can be engineered.
[0100] In certain instances, the reverse genetics technique involves the preparation of synthetic recombinant viral RNAs that contain the non-coding regions of the negative strand virus RNA which are essential for the recognition by viral polymerases and for packaging signals necessary to generate a mature virion. The recombinant RNAs are synthesized from a recombinant DNA template and reconstituted in vitro with purified viral polymerase complex to form recombinant ribonucleoproteins (RNPs) which can be used to transfect cells. In some instances, a more efficient transfection is achieved if the viral polymerase proteins are present during transcription of the synthetic RNAs either in vitro or in vivo. The synthetic recombinant RNPs can be rescued into infectious virus particles. The foregoing techniques are described in U.S. Pat. No. 5,166,057 issued Nov. 24, 1992; in U.S. Pat. No. 5,854,037 issued Dec. 29, 1998; in European Patent Publication EP 0702085A1, published Feb. 20, 1996; in U.S. patent application Ser. No. 09/152,845; in International Patent Publications PCT WO97/12032 published Apr. 3, 1997; WO96/34625 published Nov. 7, 1996; in European Patent Publication EP-A780475; WO 99/02657 published Jan. 21, 1999; WO 98/53078 published Nov. 26, 1998; WO 98/02530 published Jan. 22, 1998; WO 99/15672 published Apr. 1, 1999; WO 98/13501 published Apr. 2, 1998; WO 97/06270 published Feb. 20, 1997; and EPO 780 47SA1 published Jun. 25, 1997, each of which is incorporated by reference herein in its entirety.
[0101] Attenuated viruses generated by the reverse genetics approach can be used in the vaccine and pharmaceutical formulations described herein. Reverse genetics techniques can also be used to engineer additional mutations to other viral genes important for vaccine productioni.e., the epitopes of useful vaccine strain variants can be engineered into the attenuated virus. Alternatively, completely foreign epitopes, including antigens derived from other viral or non-viral pathogens can be engineered into the attenuated strain.
[0102] In an alternate embodiment, a combination of reverse genetics techniques and reassortant techniques can be used to engineer attenuated viruses having the desired epitopes. For example, an attenuated virus (generated by natural selection, mutagenesis or by reverse genetics techniques) and a strain carrying the desired vaccine epitope (generated by natural selection, mutagenesis or by reverse genetics techniques) can be co-infected in hosts that permit reassortment of the segmented genomes. Reassortants that display both the attenuated phenotype and the desired epitope can then be selected.
[0103] The attenuated virus of the present invention can itself be used as the active ingredient in vaccine or pharmaceutical formulations. In certain embodiments, the attenuated virus can be used as the vector or backbone of recombinantly produced vaccines. To this end, the reverse genetics technique can be used to engineer mutations or introduce foreign epitopes into the attenuated virus, which would serve as the parental strain. In this way, vaccines can be designed for immunization against strain variants, or in the alternative, against completely different infectious agents or disease antigens.
[0104] For example, in one embodiment, the immunological composition of the invention comprises a live attenuated virus, engineered to express one or more epitopes or antigens of EIV along with epitopes or antigens of another pathogen. For example, the attenuated virus can be engineered to express neutralizing epitopes of other preselected strains. Alternatively, epitopes of other viruses can be built into the attenuated mutant virus. Alternatively, epitopes of non-viral infectious pathogens (e.g., parasites, bacteria, fungi) can be engineered into the virus.
[0105] In one embodiment, the attenuated viruses selected for use in the invention is capable of inducing a robust anti-EIV response in the hosta feature which contributes to the generation of a strong immune response when used as a vaccine, and which has other biological consequences that make the viruses useful as pharmaceutical agents for the prevention and/or treatment of other viral infections, or other diseases.
[0106] The attenuated viruses, which induce a EIV-specific immune response in hosts, may also be used in pharmaceutical formulations for the prophylaxis or treatment of other influenza infections, or influenza-related pathology. In this regard, the tropism of the attenuated virus can be altered to target the virus to a desired target organ, tissue or cells in vivo or ex vivo. Using this approach, the EIV-specific immune response can be induced locally, at the target site, thus avoiding or minimizing the side effects of systemic treatments. To this end, the attenuated virus can be engineered to express a ligand specific for a receptor of the target organ, tissue or cells.
Vaccine
[0107] In certain aspects, the immunological composition is useful as a vaccine, where the immunological composition induces an immune response to the antigen in a cell, tissue or mammal. Preferably, the vaccine induces a protective immune response in the mammal. As used herein, an immunological composition may comprise, by way of examples, a live-attenuated virus (LAV), an antigen (e.g., a polypeptide), a nucleic acid encoding an antigen (e.g., an antigen expression vector), or a cell expressing or presenting an antigen or cellular component. In particular embodiments the immunological composition comprises or encodes all or part of any polypeptide antigen described herein, or an immunologically functional equivalent thereof. In other embodiments, the immunological composition is in a mixture that comprises an additional immunostimulatory agent or nucleic acids encoding such an agent. Immunostimulatory agents include but are not limited to an additional antigen, an immunomodulator, an antigen presenting cell or an adjuvant. In other embodiments, one or more of the additional agent(s) is covalently bonded to the antigen or an immunostimulatory agent, in any combination. In certain embodiments, the antigenic composition is conjugated to or comprises an HLA anchor motif amino acids.
[0108] In the context of the present invention, the term vaccine refers to a substance that induces anti-EIV immunity or suppresses EIV upon inoculation into an animal.
[0109] The invention encompasses vaccine formulations comprising live attenuated virus (LAV), wherein the LAV is a live attenuated equine influenza virus (referred to herein as EIV LAIV). For example, in certain embodiments, the EIV LAIV is temperature-sensitive, exhibiting reduced viral replication at normal and elevated temperatures, as compared to wildtype EIV. In one embodiment, the vaccine comprises a EIV LAIV comprising one or more mutations in segment 1 and/or segment 2, and a suitable excipient. The virus used in the vaccine formulation may be selected from naturally occurring mutants or variants, mutagenized viruses or genetically engineered viruses. Attenuated strains of EIV can also be generated via reassortment techniques, or by using a combination of the reverse genetics approach and reassortment techniques. Naturally occurring variants include viruses isolated from nature as well as spontaneous occurring variants generated during virus propagation. The attenuated virus can itself be used as the active ingredient in the vaccine formulation. Alternatively, the attenuated virus can be used as the vector or backbone of recombinantly produced vaccines. To this end, recombinant techniques such as reverse genetics (or, for segmented viruses, combinations of the reverse genetics and reassortment techniques) may be used to engineer mutations or introduce foreign antigens into the attenuated virus used in the vaccine formulation. In this way, vaccines can be designed for immunization against strain variants, or in the alternative, against completely different infectious agents or disease antigens.
[0110] In one embodiment, the vaccine formulation comprises a plurality of mutant EIV. In one embodiment, the vaccine formulation comprises a bivalent vaccine comprising H3N8 EIV LAIV, described herein, in combination with a second LAIV, where the second LAIV is based upon the H3N8 EIV LAIV backbone but engineered to express HA and NA viral proteins of another strain.
[0111] In one embodiment, the vaccine formulation may comprise one or more of the EIV LAIV, described herein, in combination with other mutant EIV that induce an anti-EIV immune response. In one embodiment, the present invention comprises a method of generating a EIV LAIV, comprising contacting a host cell with a polynucleotide comprising the nucleic acid sequences of segment 1 and/or segment 2, having one or more mutations, described elsewhere herein.
[0112] Propagation of the virus in culture is known to persons in the art. Briefly, the virus is grown in the media compositions in which the host cell is commonly cultured. Suitable host cells for the replication of EIV include, e.g., Vero cells, BHK cells, MDCK cells, 293 cells COS cells, and CEK cells, including 293T cells, COS7 cells. Commonly, co-cultures including two of the above cell lines, e.g., MDCK cells and either 293T or COS cells are employed at a ratio, e.g., of 1:1, to improve replication efficiency. Typically, cells are cultured in a standard commercial culture medium, such as Dulbecco's modified Eagle's medium supplemented with serum (e.g., 10% fetal bovine serum), or in serum free medium, under controlled humidity and CO.sub.2 concentration suitable for maintaining neutral buffered pH (e.g., at pH between 7.0 and 7.2). Optionally, the medium contains antibiotics to prevent bacterial growth, e.g., penicillin, streptomycin, etc., and/or additional nutrients, such as L-glutamine, sodium pyruvate, non-essential amino acids, additional supplements to promote favorable growth characteristics, e.g., trypsin, -mercaptoethanol, and the like.
[0113] Procedures for maintaining mammalian cells in culture have been extensively reported, and are known to those of skill in the art. General protocols are provided, e.g., in Freshney (1983) Culture of Animal Cells: Manual of Basic Technique, Alan R. Liss, New York; Paul (1975) Cell and Tissue Culture, 5.sup.th ed., Livingston, Edinburgh; Adams (1980) Laboratory Techniques in Biochemistry and Molecular Biology-Cell Culture for Biochemists, Work and Burdon (eds.) Elsevier, Amsterdam. Additional details regarding tissue culture procedures of particular interest in the production of influenza virus in vitro include, e.g., Merten et al. (1996) Production of influenza virus in cell cultures for vaccine preparation. In Cohen and Shafferman (eds) Novel Strategies in Design and Production of Vaccines, which is incorporated herein in its entirety. Additionally, variations in such procedures adapted to the present invention are readily determined through routine experimentation.
[0114] Cells for production of a virus can be cultured in serum-containing or serum free medium. In some case, e.g., for the preparation of purified viruses, it is desirable to grow the host cells in serum free conditions. Cells can be cultured in small scale, e.g., less than 25 ml medium, culture tubes or flasks or in large flasks with agitation, in rotator bottles, or on microcarrier beads (e.g., DEAE-Dextran microcarrier beads, such as Dormacell, Pfeifer & Langen; Superbead, Flow Laboratories; styrene copolymer-tri-methylamine beads, such as Hillex, SoloHill, Ann Arbor) in flasks, bottles or reactor cultures. Microcarrier beads are small spheres (in the range of 100-200 microns in diameter) that provide a large surface area for adherent cell growth per volume of cell culture. For example a single liter of medium can include more than 20 million microcarrier beads providing greater than 8000 square centimeters of growth surface. For commercial production of viruses, e.g., for vaccine production, it is often desirable to culture the cells in a bioreactor or fermenter. Bioreactors are available in volumes from under 1 liter to in excess of 100 liters, e.g., Cyto3 Bioreactor (Osmonics, Minnetonka, Minn.); NBS bioreactors (New Brunswick Scientific, Edison, N.J.); laboratory and commercial scale bioreactors from B. Braun Biotech International (B. Braun Biotech, Melsungen, Germany).
[0115] Virtually any heterologous gene sequence may be constructed into the viruses of the invention for use in vaccines. Preferably, epitopes that induce a protective immune response to any of a variety of pathogens, or antigens that bind neutralizing antibodies may be expressed by or as part of the viruses. For example, heterologous gene sequences that can be constructed into the viruses of the invention for use in vaccines include but are not limited to epitopes of human immunodeficiency virus (HIV) such as gp120; hepatitis B virus surface antigen (HBsAg); the glycoproteins of herpes virus (e.g. gD, gE); VP1 of poliovirus; antigenic determinants of non-viral pathogens such as bacteria and parasites, to name but a few. In another embodiment, all or portions of immunoglobulin genes may be expressed. For example, variable regions of anti-idiotypic immunoglobulins that mimic such epitopes may be constructed into the viruses of the invention. In yet another embodiment, tumor associated antigens may be expressed.
[0116] Either a live recombinant viral vaccine or an inactivated recombinant viral vaccine can be formulated. A live vaccine may be preferred because multiplication in the host leads to a prolonged stimulus of similar kind and magnitude to that occurring in natural infections, and therefore, confers substantial, long-lasting immunity. Production of such live recombinant virus vaccine formulations may be accomplished using conventional methods involving propagation of the virus in cell culture or in the allantois of the chick embryo followed by purification.
[0117] Many methods may be used to introduce the vaccine formulations described above, these include but are not limited to introduction intranasally, intratracheally, orally, intradermally, intramuscularly, intraperitoneally, intravenously, and subcutaneously. It may be preferable to introduce the virus vaccine formulation via the natural route of infection of the pathogen for which the vaccine is designed, or via the natural route of infection of the parental attenuated virus.
[0118] A vaccine of the present invention, comprising an EIV LAIV, could be administered once. Alternatively, a vaccine of the present invention, comprising an EIV LAIV, could be administered twice or three or more times with a suitable interval between doses. Alternatively, a vaccine of the present invention, comprising an EIV LAIV, could be administered as often as needed to an animal, preferably a mammal.
Methods
[0119] The invention provides a method for treating or preventing equine influenza infection or an EIV-related disease or disorder. In one embodiment, the method comprises administering an immunological composition comprising a live-attenuated virus (LAV), wherein the LAV is an EIV LAIV. In one embodiment, the method comprises administering an immunological composition comprising an EIV LAIV comprising one or more mutations in segment 1 and/or segment 2, to a subject in need thereof.
[0120] As described herein, in certain embodiments, the EIV LAIV is temperature sensitive, exhibiting decreased viral replication at normal and elevated temperatures, as compared to wildtype EIV. For example, in certain embodiments, the viral replication of EIV LAIV is 2-fold less, 3-fold less, 5-fold less, 10-fold less, 15-fold less, 20-fold less, 50-fold less, 100-fold less, 500-fold less, or 1000-fold less, than wild type EIV at normal or elevated body temperature.
[0121] In certain embodiments, the EIV LAIV induces an enhanced immune response as compared to an inactivated EIV. For example, in certain embodiments, the induced immune response of EIV LAIV is 2-fold more, 3-fold more, 5-fold more, 10-fold more, 15-fold more, 20-fold more, 50-fold more, 100-fold more, 500-fold more, or 1000-fold more, than inactivated EIV. The immune response induced the EIV LAIV can be measured using standard assays. For example, in certain embodiments, the immune response induced by EIV LAIV is measured by detecting the amount of EIV-specific antibodies produced in the subject following administration of EIV LAIV.
[0122] The therapeutic compositions of the invention may be administered prophylactically or therapeutically to subjects suffering from, or at risk of, or susceptible to, developing the disease or condition. Such subjects may be identified using standard clinical methods. In the context of the present invention, prophylactic administration occurs prior to the manifestation of overt clinical symptoms of disease, such that a disease or disorder is prevented or alternatively delayed in its progression. In the context of the field of medicine, the term prevent encompasses any activity which reduces the burden of mortality or morbidity from disease. Prevention can occur at primary, secondary and tertiary prevention levels. While primary prevention avoids the development of a disease, secondary and tertiary levels of prevention encompass activities aimed at preventing the progression of a disease and the emergence of symptoms as well as reducing the negative impact of an already established disease by restoring function and reducing disease-related complications.
[0123] In certain embodiments, the subject is a mammal. For example, the subject may include, but is not limited to, a human, primate, cow, horse, sheep, pig, dog, cat, or rodent. In one embodiment, the subject is a horse. The method may be used to treat or prevent EIV or EIV-related pathology in any breed or species of horse. In certain embodiments, the relative amount of active ingredient in a single dose, or the frequency of doses, will vary depending on the age, sex, weight, or breed of subject (e.g. horse).
[0124] The composition may be combined with an adjuvant. An adjuvant refers to a compound that enhances the immune response when administered together (or successively) with the immunological composition. Examples of suitable adjuvants include cholera toxin, salmonella toxin, alum and such, but are not limited thereto. Furthermore, a vaccine of this invention may be combined appropriately with a pharmaceutically acceptable carrier. Examples of such carriers are sterilized water, physiological saline, phosphate buffer, culture fluid and such. Furthermore, the vaccine may contain as necessary, stabilizers, suspensions, preservatives, surfactants and such. The vaccine is administered systemically or locally. Vaccine administration may be performed by single administration or boosted by multiple administrations.
Administration
[0125] In one embodiment, the methods of the present invention comprise administering an immunological composition of the invention directly to a subject in need thereof. Administration of the composition can comprise, for example, intranasal, intramuscular, intravenous, peritoneal, subcutaneous, intradermal, as well as topical administration.
[0126] Furthermore, the actual dose and schedule can vary depending on whether the compositions are administered in combination with other pharmaceutical compositions, or depending on inter-individual differences in pharmacokinetics, drug disposition, and metabolism. One skilled in the art can easily make any necessary adjustments in accordance with the exigencies of the particular situation.
[0127] The regimen of administration may affect what constitutes an effective amount. The therapeutic formulations may be administered to the subject either prior to or after a diagnosis of infection or disease. Further, several divided dosages, as well as staggered dosages may be administered daily or sequentially, or the dose may be continuously infused, or may be a bolus injection. Further, the dosages of the therapeutic formulations may be proportionally increased or decreased as indicated by the exigencies of the therapeutic or prophylactic situation.
[0128] Administration of the compositions of the present invention to a subject, may be carried out using known procedures, at dosages and for periods of time effective to prevent or treat disease. An effective amount of the therapeutic compound necessary to achieve a therapeutic effect may vary according to factors such as the activity of the particular compound employed; the time of administration; the rate of excretion of the compound; the duration of the treatment; other drugs, compounds or materials used in combination with the compound; the state of the disease or disorder, age, sex, weight, condition, general health and prior medical history of the subject being treated, and like factors well-known in the medical arts. Dosage regimens may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation. A non-limiting example of an effective dose range for a therapeutic compound of the invention is from about 1 and 5,000 mg/kg of body weight/per day. One of ordinary skill in the art would be able to study the relevant factors and make the determination regarding the effective amount of the therapeutic compound without undue experimentation.
[0129] The compound may be administered to a subject as frequently as several times daily, or it may be administered less frequently, such as once a day, once a week, once every two weeks, once a month, or even less frequently, such as once every several months or even once a year or less.
Pharmaceutical Compositions
[0130] The present invention envisions treating or preventing EIV or EIV-related pathology in a mammal by the administration of a therapeutic composition of the invention to a mammal in need thereof. Administration of the composition in accordance with the present invention may be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners. The administration of the compositions of the invention may be essentially continuous over a preselected period of time or may be in a series of spaced doses. Both local and systemic administration is contemplated. The amount administered will vary depending on various factors including, but not limited to, the composition chosen, the particular disease, the weight, the physical condition, and the age of the mammal, and whether prevention or treatment is to be achieved. Such factors can be readily determined by the clinician employing animal models or other test systems which are well known to the art.
[0131] The present invention encompasses pharmaceutical compositions comprising an EIV LAIV to be used as anti-viral agents or as agents against EIV-related diseases and disorders. The pharmaceutical compositions have utility as an anti-viral prophylactic and may be administered to a subject at risk of getting infected or is expected to be exposed to a virus. For example, subjects traveling to parts of the world where EIV is prevalent can be administered a pharmaceutical composition of the invention. In certain embodiments, subjects who are expected to be in contact with other subjects at risk, can be administered a pharmaceutical composition of the invention.
[0132] The EIV LAIV of the invention may be engineered using the methods described herein to express proteins or peptides which would target the viruses to a particular site. In one embodiment, where the site to be targeted expresses a receptor to a growth factor, e.g., VEGF, EGF, or PDGF, the EIV LAIV may be engineered to express the appropriate growth factor or portion(s) thereof. Thus, in accordance with the invention, the EIV LAIV may be engineered to express any target gene product, including peptides, proteins, such as enzymes, hormones, growth factors, antigens or antibodies, which will function to target the virus to a site in need of anti-viral, antibacterial, anti-microbial or anti-cancer activity.
[0133] Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The pharmaceutical compositions of the present invention may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. In addition, in a preferred embodiment it may be desirable to introduce the pharmaceutical compositions of the invention into the lungs by any suitable route. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
[0134] In a specific embodiment, it may be desirable to administer the pharmaceutical compositions of the invention locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
[0135] In certain embodiments, the pharmaceutical composition is a veterinary pharmaceutical composition suitable for administration to a veterinary subject, including but not limited to an equine subject. Exemplary equine subjects include any member of genus equus, including but not limited to horses, zebras, asses, and donkeys.
[0136] In certain embodiments, the veterinary pharmaceutical composition is palatable, meaning an oral veterinary composition that is readily accepted by equines, including horses, without any coaxing or with some coaxing.
[0137] In yet another embodiment, the pharmaceutical composition can be delivered in a controlled release system. In one embodiment, a pump may be used (see Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:201; Buchwald et al., 1980, Surgery 88:507; Saudek et al., 1989, N. Engl. J. Med. 321:574). In another embodiment, polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger & Peppas, 1983, J. Macromol. Sci. Rev. Macromol. Chem. 23:61; see also Levy et al., 1985, Science 228:190; During et al., 1989, Ann. Neurol. 25:351 (1989); Howard et al., 1989, J. Neurosurg. 71:105). In yet another embodiment, a controlled release system can be placed in proximity of the composition's target, i.e., the lung, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138). Other controlled release systems are discussed in the review by Langer (1990, Science 249:1527-1533).
[0138] The pharmaceutical compositions of the present invention comprise a therapeutically effective amount of the attenuated virus, and a pharmaceutically acceptable carrier. In a specific embodiment, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeiae for use in animals. The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the pharmaceutical composition is administered. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water and the like. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. These compositions can be formulated as a suppository. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin. Such compositions will contain a therapeutically effective amount of the Therapeutic, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.
[0139] The amount of the pharmaceutical composition of the invention which will be effective in the treatment or prevention of a particular disease or disorder will depend on the nature of the disease or disorder, and can be determined by standard clinical techniques. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
[0140] In an embodiment, the pharmaceutical compositions useful for practicing the methods of the invention may be administered to deliver a dose of between 1 ng/kg/day and 100 mg/kg/day. In another embodiment, the pharmaceutical compositions useful for practicing the invention may be administered to deliver a dose of between 1 ng/kg/day and 500 mg/kg/day.
[0141] The relative amounts of the active ingredient, the pharmaceutically acceptable carrier, and any additional ingredients in a pharmaceutical composition of the invention will vary, depending upon the identity, size, and condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient.
EXPERIMENTAL EXAMPLES
[0142] The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.
[0143] Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the present invention and practice the claimed methods. The following working examples therefore, specifically point out the preferred embodiments of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.
Example 1: Temperature-Sensitive H3N8 EIV LAIV
[0144] Using state-of-the-art plasmid-based reverse genetic approaches, a cold-adapted, temperature sensitive recombinant H3N8 equine influenza virus (EIV) live-attenuated influenza vaccine (LAIV) was generated. To generate the presently described H3N8 EIV LAIV, amino acid substitutions were introduced in the viral polymerase PB2 (N265S) and PB1 (K391E, E581G, and A661T) subunits of influenza A/equine/Ohio/1/2003 H3N8 (
TABLE-US-00003 TABLE 3 Protective humoral response: Presence of neutralizing antibodies using a conventional Hemagglutination Inhibition (HAI) assay. HAI titers from mice vaccinated with equine influenza viruses Geometric mean (SD) serum Immunization and dose virus.sup.a HAI titer.sup.b PBS 16 (ND) WT 10.sup.3 147 LAIV 10.sup.3 141 Flu Avert 10.sup.3 101 .sup.aVirus was administered intranasally to anesthetized mice (N = 6), and sera were collected at 14 days post-infection. .sup.bEight HAU of WT influenza A/equine/Ohio/1/2003 H3B8 was incubated with 2-fold serial dilutions of the indicated sera.
[0145] In addition to the mouse studies, the safety, immunogenicity and protection efficacy of the presently described H3N8 EIV LAIV has been evaluated in horses. The data from the horse studies demonstrate that the H3N8 EIV LAIV is safe and is able to confer protection against a challenge with wild-type H3N8 EIV. The observed protection includes the lack of clinical symptoms as well as reduced levels of challenge wild-type virus at different days post-infection in vaccinated horses, while control mock-vaccinated horses developed symptoms of EIV infection (e.g. coughing and fever) and high levels of viral replication in the nasal washes at days 2-6 post-challenge. Assays are also conducted to evaluate the protective immune responses, including neutralizing antibodies, from both mock-vaccinated and vaccinated horses.
[0146] Altogether, these results demonstrate the feasibility of developing a new LAIV candidate for the treatment and control of H3N8 EIV by combining state-of-the-art plasmid-based reverse genetic approaches with the introduction of mutations in the viral PB2 (N265S) and PB1 (K391E, E581G, and A661T) polymerase subunits of A/equine/Ohio/1/2003 H3N8 to generate a cold-adapted, temperature sensitive LAIV.
Example 2: Temperature Sensitive Live Attenuated Equine Influenza Virus Based on A/Equine/Ohio/1/2003 H3N8
Mutated Segment 1 or PB2:
[0147] 1. Mutated nucleotide sequence of segment 1 (PB2): In bold are indicated the nucleotide changes resulting in N265S amino acid change in PB2 protein. Underlined a ClaI restriction site introduced in the modified PB2 segment.
TABLE-US-00004 (SEQIDNO:1) agcgaaagcaggtcaaatatattcaatatggagagaataaaagaactgag agatctgatgttacaatcccgcacccgcgagatactaacaaaaactactg tggaccacatggccataatcaagaaatacacatcaggaagacaagagaag aaccctgcacttaggatgaaatggatgatggcaatgaaatacccaatcac ggcagataagaggataatggagatgattcctgagagaaatgaacagggac aaaccctttggagcaaaacgaacgatgctggctcagaccgcgtaatggta tcacctctggcagtgacatggtggaataggaatggaccaacaacaagcac aattcattatccaaaagtctacaaaacttattttgaaaaggttgaaagat tgaaacacggaacctttggccccgttcattttaggaatcaagtcaagata agacgaagagttgatgtaaaccctggtcacgcggacctcagtgccaaaga agcacaagatgtgatcatggaagttgttttcccaaatgaagtgggagcca gaattctaacatcggaatcacaactaacaataaccaaagagaaaaaggaa gaacttcaggactgcaaaattgctcccttgatggtagcatacatgctaga aagagagttggtccgaaaaacaaggttcctcccagtagcaggcggaacaa gcagtgtatacattgaagtgttgcatctgactcagggaacatgctgggag caaatgtacaccccaggaggagaagttagaaacgatgatattgatcaaag tttaattattgcagcacgatcgatagtgagaagagcaacagtatcagcag atccactagcatccctactggaaatgtgccacagtacacagattggtgga ataaggatggtagacatccttaagcagaatccaacagaggaacaagctgt ggatatatgcaaagcagcaatgggattgagaattagctcatcattcagct ttggtggattcaccttcaaaagaacaagtggatcatcagtcaagagagaa gaagaaatgcttacgggcaaccttcaaacattgaaaataagaatgcatga gggctatgaagaattcacaatggtcggaagaagagcaacagctattctca gaaaggcaaccagaagattgattcaattgatagtaagtgggagagatgaa caatcaattgctgaagcaataattgtagccatggtgttttcgcaagaaga ttgcatgataaaagcagttcgaggcgatttgaactttgttaatagagcaa atcagcgtttgaaccccatgcatcaactcttgaggcatttccaaaaagat gcaaaagtgcttttccaaaattggggaattgaacccatcgacaatgtaat ggggatgattggaatattgcctgacatgaccccaagcaccgagatgtcat tgagaggagtgagagtcagcaaaatgggagtggatgagtactccagcact gagagagtggtggtgagcattgaccgttttttaagagttcgggatcaaag gggaaacatactactgtcccctgaagaagtcagtgaaacacaaggaacgg aaaagctgacaataatttattcgtcatcaatgatgtgggagattaatggt cccgaatcagtgttggtcaatacttatcaatggatcatcaggaactggga aattgtaaaaattcagtggtcacaggaccccacaatgttatacaataaga tagaatttgagccattccaatccctggtccctagggccaccagaagccaa tacagcggtttcgtaagaaccctgtttcagcaaatgcgagatgtacttgg aacatttgatactgctcaaataataaaactcctcccttttgccgctgctc ctccggaacagagtaggatgcagttctcttctttgactgttaatgtaaga ggttcgggaatgaggatacttgtaagaggcaattccccagtgttcaacta caataaagccactaaaaggctcacagtcctcggaaaggatgcaggtgcgc ttactgaggacccagatgaaggtacggctggagtagaatctgctgttcta agagggtttctcattttaggtaaagaaaacaagagatatggcccagcact aagcatcaatgaactaagcaaacttgcaaaaggggagaaagccaatgtac taattgggcaaggggacgtagtgttggtaatgaaacggaaacgtgactct agcatacttactgacagccagacagcgaccaaaaggattcggatggccat caattagtgttgaattgtttaaaaacgaccttgtttctact
2. Amino acid sequence of mutant EIV PB2 protein: In bold is indicated the amino acid change N265S.
TABLE-US-00005 (SEQIDNO:2) MERIKELRDLMLQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM MAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN RNGPTTSTIHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDVNPG HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAP LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEV RNDDIDQSLIIAARSIVRRATVSADPLASLLEMCHSTQIGGIRMVDILKQ MPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEMLTGNLQ TLKIRMHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG IEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDR FLRVRDQRGNILLSPEEVSETQGTEKLTIIYSSSMMWEINGPESVLVNTY QWIIRNWEIVKIQWSQDPTMLYNKIEFEPFQSLVPRATRSQYSGFVRTLF QQMRDVLGTFDTAQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVR GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKE NKRYGPALSINELSKLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA TKRIRMAIN
Mutated Segment 2 or PB1:
[0148] 1. Mutated nucleotide sequence of segment 2 (PB1): In bold are indicated the nucleotide changes resulting in K391E, E581G, and A661T amino acid change in PB2 protein. AatI restriction site (denoted by underline) and Hind III restriction site (denoted by underline+italics) were introduced in the modified PB1 segment. Denoted in underline+bold are nucleotide mutated from the original PB1 sequence to remove a BamHI restriction site.
TABLE-US-00006 (SEQIDNO:3) agcgaaagcaggcaaaccatttgaatggatgtcaatccgactctactttt cttaaaggtgccagcgcaaaatgctataagcacaacattcccttatactg gagatcctccctacagtcatggaacagggacaggatacaccatggatact gtcaacagaacacaccaatattcagaaaaagggaaatggacaacaaacac tgagattggagcaccacaacttaatccaatcgatggaccacttcctgaag acaatgaaccaagtgggtacgcccaaacagattgtgtattggaagcaatg gctttccttgaagaatcccatcccggaatctttgaaaattcgtgtcttga aacgatggaggtgattcagcagacaagagtggacaaactaacacaaggcc gacaaacttatgattggaccttgaataggaatcaacctgccgcaacagca cttgctaatacgattgaagtattcagatcaaatggtctgacttccaatga atcggggagattgatggacttcctcaaagatgtcatggagtccatgaaca aggaagaaatggaaataacaacacacttccaacggaagagaagagtaaga gacaacatgacaaagagaatggtaacacagagaaccatagggaagaagaa acaacgattaaacagaaagagctatctaatcagaacattaaccctaaaca caatgaccaaggacgctgagagagggaaattgaaacgacgagcaatcgct accccagggatgcagataagagggtttgtatattttgttgaaacactagc ccgaagaatatgtgaaaagcttgaacaatcaggattgccagttggcggta atgagaaaaaggccaaactggctaatgtcgtcagaaaaatgatgactaat tcccaagacactgaactctccttcaccatcactggggacaataccaaatg gaatgaaaatcagaacccacgcatattcctggcaatgatcacatacataa ctagaaaccagccagaatggttcagaaatgttctaagcattgcaccgatt atgttctcaaataaaatggcaagactggggaaaggatatatgtttgaaag caaaagtatgaaattgagaactcaaataccagcagaaatgctagcaagca ttgacctgaaatatttcaatgattcaacaaaaaagaaaattgaagaaata aggcctcttctggttgacgggactgcttcactgagtcctggcatgatgat gggaatgttcaacatgttgagcactgtgctgggtgtatccatattaaacc tgggccagaggaaatacacaaagaccacatactggtgggatggtctgcaa tcatccgatgactttgctttgatagtgaatgcgcctaatcatgaaggaat acaagctggagtagacagattctatagaacttgcaaactggtcgggatca acatgagcaaaaagaagtcctacataaatagaactggaacattcgaattc acaagctttttctaccggtatggttttgtagccaatttcagcatggaact acccagttttggggtttccggaataaatgaatctgcagacatgagcattg gagtgacagtcatcaaaaacaacatgataaataatgatctcggtcctgcc acggcacaaatggcactccaactcttcattaaggattatcggtacacata ccggtgccatagaggtgatacccagatacaaaccagaagatcttttgagt tgaagaagctttgggggcagactcgatcaaagactggtctactggtatca gatgggggtccaaacctatataacatcagaaacctacacatcccggaagt ctgtttaaaatgggagctaatggatgaagattataaggggaggctatgca atccattgaatcctttcgttagtcacaaagaaattgaatcagtcaacagt gcagtagtaatgtctgcgcatggccctgccaaaagcatggagtatgatgc tgttactacaacacattcttggatacccaagaggaaccggtccatattga acacaagccaaaggggaatactcgaagatgagcagatgtatcagaaatgc tgcaacctgtttgaaaaattcttccccagcagctcatacagaagaccagt cggaatttctagtatggttgaggccatggtgtccagggcccgcattgatg cacgaattgacttcgaatctggacggataaagaaggatgagttcgctgag atcatgaagatctgttccaccattgaagagctcagacggcaaaaatagtg aatttagcttgatcttcatgaaaaaatgccttgtttctact
2. Amino acid sequence of mutant EIV PB1 protein: In bold are indicated the amino acid changes K391E, E581G and A661T.
TABLE-US-00007 (SEQIDNO:4) MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS EKGKWTTNTEIGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHP GIFENSCLETMEVIQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVF RSNGLTSNESGRLMDFLKDVMESMNKEEMEITTHFQRKRRVRDNMTKRMV TQRTIGKKKQRLNRKSYLIRTLTLNTMTKDAERGKLKRRAIATPGMQIRG FVYFVETLARRICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSF TITGDNTKWNENQNPRIFLAMITYITRNQPEWFRNVLSIAPIMFSNKMAR LGKGYMFESKSMKLRTQIPAEMLASIDLKYFNDSTKKKIEEIRPLLVDGT ASLSPGMMMGMFNMLSTVLGVSILNLGQRKYTKTTYWWDGLQSSDDFALI VNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTFEFTSFFYRYG FVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQL FIKDYRYTYRCHRGDTQIQTRRSFELKKLWOQTRSKTGLLVSDGGPNLYN IRNLHIPEVCLKWELMDEDYKGRLCNPLNPFVSHKEIESVNSAVVMSAHG PAKSMEYDAVTTTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFF PSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKDEFAEIMKICSTI EELRRQK
Wildtype Segment 1 or PB2:
[0149] 1. Nucleotide sequence of wildtype EIV H3N8 segment 1 (PB2):
TABLE-US-00008 (SEQIDNO:5) agcgaaagcaggtcaaatatattcaatatggagagaataaaagaactgag agatctgatgttacaatcccgcacccgcgagatactaacaaaaactactg tggaccacatggccataatcaagaaatacacatcaggaagacaagagaag aaccctgcacttaggatgaaatggatgatggcaatgaaatacccaatcac ggcagataagaggataatggagatgattcctgagagaaatgaacagggac aaaccctttggagcaaaacgaacgatgctggctcagaccgcgtaatggta tcacctctggcagtgacatggtggaataggaatggaccaacaacaagcac aattcattatccaaaagtctacaaaacttattttgaaaaggttgaaagat tgaaacacggaacctttggccccgttcattttaggaatcaagtcaagata agacgaagagttgatgtaaaccctggtcacgcggacctcagtgccaaaga agcacaagatgtgatcatggaagttgttttcccaaatgaagtgggagcca gaattctaacatcggaatcacaactaacaataaccaaagagaaaaaggaa gaacttcaggactgcaaaattgctcccttgatggtagcatacatgctaga aagagagttggtccgaaaaacaaggttcctcccagtagcaggcggaacaa gcagtgtatacattgaagtgttgcatctgactcagggaacatgctgggag caaatgtacaccccaggaggagaagttagaaacgatgatattgatcaaag tttaattattgcagcacggaacatagtgagaagagcaacagtatcagcag atccactagcatccctactggaaatgtgccacagtacacagattggtgga ataaggatggtagacatccttaagcagaatccaacagaggaacaagctgt ggatatatgcaaagcagcaatgggattgagaattagctcatcattcagct ttggtggattcaccttcaaaagaacaagtggatcatcagtcaagagagaa gaagaaatgcttacgggcaaccttcaaacattgaaaataagaatgcatga gggctatgaagaattcacaatggtcggaagaagagcaacagctattctca gaaaggcaaccagaagattgattcaattgatagtaagtgggagagatgaa caatcaattgctgaagcaataattgtagccatggtgttttcgcaagaaga ttgcatgataaaagcagttcgaggcgatttgaactttgttaatagagcaa atcagcgtttgaaccccatgcatcaactcttgaggcatttccaaaaagat gcaaaagtgcttttccaaaattggggaattgaacccatcgacaatgtaat ggggatgattggaatattgcctgacatgaccccaagcaccgagatgtcat tgagaggagtgagagtcagcaaaatgggagtggatgagtactccagcact gagagagtggtggtgagcattgaccgttttttaagagttcgggatcaaag gggaaacatactactgtcccctgaagaagtcagtgaaacacaaggaacgg aaaagctgacaataatttattcgtcatcaatgatgtgggagattaatggt cccgaatcagtgttggtcaatacttatcaatggatcatcaggaactggga aattgtaaaaattcagtggtcacaggaccccacaatgttatacaataaga tagaatttgagccattccaatccctggtccctagggccaccagaagccaa tacagcggtttcgtaagaaccctgtttcagcaaatgcgagatgtacttgg aacatttgatactgctcaaataataaaactcctcccttttgccgctgctc ctccggaacagagtaggatgcagttctcttctttgactgttaatgtaaga ggttcgggaatgaggatacttgtaagaggcaattccccagtgttcaacta caataaagccactaaaaggctcacagtcctcggaaaggatgcaggtgcgc ttactgaggacccagatgaaggtacggctggagtagaatctgctgttcta agagggtttctcattttaggtaaagaaaacaagagatatggcccagcact aagcatcaatgaactaagcaaacttgcaaaaggggagaaagccaatgtac taattgggcaaggggacgtagtgttggtaatgaaacggaaacgtgactct agcatacttactgacagccagacagcgaccaaaaggattcggatggccat caattagtgttgaattgtttaaaaacgaccttgtttctact
2. Amino acid sequence of wildtype EIV H3N8 PB2 protein:
TABLE-US-00009 (SEQIDNO:6) MERIKELRDLMLQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM MAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN RNGPTTSTIHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDVNPG HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAP LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEV RNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILKQ MPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEMLTGNLQ TLKIRMHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG IEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDR FLRVRDQRGNILLSPEEVSETQGTEKLTIIYSSSMMWEINGPESVLVNTY QWIIRNWEIVKIQWSQDPTMLYNKIEFEPFQSLVPRATRSQYSGFVRTLF QQMRDVLGTFDTAQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVR GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKE NKRYGPALSINELSKLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA TKRIRMAIN
Wildtype Segment 2 or PB1:
[0150] 1. Nucleotide sequence of wildtype EIV H3N8 segment 2 (PB1):
TABLE-US-00010 (SEQIDNO:7) agcgaaagcaggcaaaccatttgaatggatgtcaatccgactctactttt cttaaaggtgccagcgcaaaatgctataagcacaacattcccttatactg gagatcctccctacagtcatggaacagggacaggatacaccatggatact gtcaacagaacacaccaatattcagaaaaagggaaatggacaacaaacac tgagattggagcaccacaacttaatccaatcgatggaccacttcctgaag acaatgaaccaagtgggtacgcccaaacagattgtgtattggaagcaatg gctttccttgaagaatcccatcccggaatctttgaaaattcgtgtcttga aacgatggaggtgattcagcagacaagagtggacaaactaacacaaggcc gacaaacttatgattggaccttgaataggaatcaacctgccgcaacagca cttgctaatacgattgaagtattcagatcaaatggtctgacttccaatga atcggggagattgatggacttcctcaaagatgtcatggagtccatgaaca aggaagaaatggaaataacaacacacttccaacggaagagaagagtaaga gacaacatgacaaagagaatggtaacacagagaaccatagggaagaagaa acaacgattaaacagaaagagctatctaatcagaacattaaccctaaaca caatgaccaaggacgctgagagagggaaattgaaacgacgagcaatcgct accccagggatgcagataagagggtttgtatattttgttgaaacactagc ccgaagaatatgtgaaaagcttgaacaatcaggattgccagttggcggta atgagaaaaaggccaaactggctaatgtcgtcagaaaaatgatgactaat tcccaagacactgaactctccttcaccatcactggggacaataccaaatg gaatgaaaatcagaacccacgcatattcctggcaatgatcacatacataa ctagaaaccagccagaatggttcagaaatgttctaagcattgcaccgatt atgttctcaaataaaatggcaagactggggaaaggatatatgtttgaaag caaaagtatgaaattgagaactcaaataccagcagaaatgctagcaagca ttgacctgaaatatttcaatgattcaacaaaaaagaaaattgaaaagata cgaccacttctggttgacgggactgcttcactgagtcctggcatgatgat gggaatgttcaacatgttgagcactgtgctgggtgtatccatattaaacc tgggccagaggaaatacacaaagaccacatactggtgggatggtctgcaa tcatccgatgactttgctttgatagtgaatgcgcctaatcatgaaggaat acaagctggagtagacagattctatagaacttgcaaactggtcgggatca acatgagcaaaaagaagtcctacataaatagaactggaacattcgaattc acaagctttttctaccggtatggttttgtagccaatttcagcatggaact acccagttttggggtttccggaataaatgaatctgcagacatgagcattg gagtgacagtcatcaaaaacaacatgataaataatgatctcggtcctgcc acggcacaaatggcactccaactcttcattaaggattatcggtacacata ccggtgccatagaggtgatacccagatacaaaccagaagatcttttgagt tgaagaaactgtgggaacagactcgatcaaagactggtctactggtatca gatgggggtccaaacctatataacatcagaaacctacacatcccggaagt ctgtttaaaatgggagctaatggatgaagattataaggggaggctatgca atccattgaatcctttcgttagtcacaaagaaattgaatcagtcaacagt gcagtagtaatgtctgcgcatggccctgccaaaagcatggagtatgatgc tgttgcaacaacacattcttggatccccaagaggaaccggtccatattga acacaagccaaaggggaatactcgaagatgagcagatgtatcagaaatgc tgcaacctgtttgaaaaattcttccccagcagctcatacagaagaccagt cggaatttctagtatggttgaggccatggtgtccagggcccgcattgatg cacgaattgacttcgaatctggacggataaagaaggatgagttcgctgag atcatgaagatctgttccaccattgaagagctcagacggcaaaaatagtg aatttagcttgatcttcatgaaaaaatgccttgtttctact
2. Amino acid sequence of wildtype EIV H3N8 PB1 protein:
TABLE-US-00011 (SEQIDNO:8) MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS EKGKWTTNTEIGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHP GIFENSCLETMEVIQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVF RSNGLTSNESGRLMDFLKDVMESMNKEEMEITTHFQRKRRVRDNMTKRMV TQRTIGKKKQRLNRKSYLIRTLTLNTMTKDAERGKLKRRAIATPGMQIRG FVYFVETLARRICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSF TITGDNTKWNENQNPRIFLAMITYITRNQPEWFRNVLSIAPIMFSNKMAR LGKGYMFESKSMKLRTQIPAEMLASIDLKYFNDSTKKKIEKIRPLLVDGT ASLSPGMMMGMFNMLSTVLGVSILNLGQRKYTKTTYWWDGLQSSDDFALI VNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTFEFTSFFYRYG FVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQL FIKDYRYTYRCHRGDTQIQTRRSFELKKLWEQTRSKTGLLVSDGGPNLYN IRNLHIPEVCLKWELMDEDYKGRLCNPLNPFVSHKEIESVNSAVVMSAHG PAKSMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFF PSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKDEFAEIMKICSTI EELRRQK
[0151] The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety. While this invention has been disclosed with reference to specific embodiments, it is apparent that other embodiments and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include all such embodiments and equivalent variations.