METHODS AND COMPOSITIONS FOR TREATING METABOLIC IMBALANCE
20190125899 ยท 2019-05-02
Assignee
Inventors
Cpc classification
A61K48/0058
HUMAN NECESSITIES
C12N2750/14143
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
C12N9/80
CHEMISTRY; METALLURGY
A61K38/50
HUMAN NECESSITIES
A61K35/30
HUMAN NECESSITIES
C12N9/1029
CHEMISTRY; METALLURGY
C12Y203/01017
CHEMISTRY; METALLURGY
A61K48/0075
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
Abstract
In some aspects, the disclosure relates to compositions and methods useful for the diagnosis and treatment of diseases associated with a metabolic imbalance in a subject (e.g.,cancer). In some embodiments, the methods comprise administering to a subject an N-acetylaspartate (NAA)-depleting agent or an N-acetylaspartate (NAA)-increasing agent based upon the subject's metabolic profile.
Claims
1. A method of increasing ATP production in a subject, the method comprising administering to a subject a recombinant adeno-associated virus (rAAV) comprising a transgene encoding ASPA enzyme or NAT8L enzyme, wherein the subject does not have an ASPA deficiency or a neurodegenerative disease.
2. A method for treating a disease associated with a metabolic imbalance in a subject in need thereof, the method comprising administering to the subject an N-acetylaspartate (NAA)-depleting agent, wherein it has been determined that the disease is associated with a metabolic imbalance comprising a shift from beta-oxidation to glycolysis in the subject.
3. A method for treating a disease associated with a metabolic imbalance in a subject in need thereof, the method comprising administering to the subject an N-acetylaspartate (NAA)-depleting agent, wherein it has been determined that the disease is associated with a metabolic imbalance comprising a shift from glycolysis to beta-oxidation in the subject.
4. A method for treating a disease associated with a metabolic imbalance in a subject in need thereof, the method comprising administering to the subject an N-acetylaspartate (NAA)-increasing agent, wherein it has been determined that the disease is associated with a metabolic imbalance comprising a shift from beta-oxidation to glycolysis in the subject.
5. A method for treating a disease associated with a metabolic imbalance in a subject in need thereof, the method comprising administering to the subject an N-acetylaspartate (NAA)-increasing agent, wherein it has been determined that the disease is associated with a metabolic imbalance comprising a shift from glycolysis to beta-oxidation in the subject.
6. The method of any one of claims 2 to 5, wherein the disease is obesity, diabetes mellitus, or cancer.
7. The method of any one of claims 2 to 5, further comprising detecting the metabolic imbalance by evaluating levels of one or more glycolysis and/or beta-oxidation factors.
8. The method of claim 7, wherein the levels of one or more glycolysis and/or beta-oxidation factors are determined using a biological sample obtained from the subject.
9. The method of any one of claims 1 to 8, wherein the NAA-depleting agent is ASPA or the NAA-increasing agent is NAT8L.
10. The method of any one of claims 1 to 9, wherein the NAA-depleting agent is selected from the group consisting of a small molecule, a protein, and a nucleic acid, or the NAA-increasing agent is selected from the group consisting of a small molecule, a protein, and a nucleic acid.
11. The method of claim 10, wherein the NAA-depleting agent is administered using a recombinant adeno-associated virus (rAAV), or the NAA-increasing agent is administered using a rAAV.
12. The method of claim 11, wherein the rAAV comprises: (a) a capsid protein; and, (b) a nucleic acid comprising a promoter operably linked to a transgene, wherein the transgene encodes aspartoacylase (ASPA) or N-acetylaspartate synthetase (NAT8L).
13. The method of claim 12, wherein the capsid protein has a serotype selected from the group consisting of AAV9 or variants thereof.
14. The method of any one of claims 11 to 13, wherein the rAAV is administered via injection.
15. The method of claim 14, wherein the injection is selected from the group consisting of intravenous injection, intravascular injection and intraventricular injection.
16. The method of any one of claims 11 to 15, wherein the administration results in expression of the gene in a target tissue or cell.
17. The method of claim 16, wherein the target tissue or cell is a tumor or a tumor cell.
18. The method of any one of claims 12 to 17, wherein the promoter is a tissue-specific promoter, optionally a tumor-specific promoter.
19. The method of any one of claims 1 to 18, further comprising administering a small molecule metabolic modulator to the subject.
20. The method of any one of claims 1 to 19, further comprising prescribing to the subject a dietary intervention, wherein the dietary intervention promotes glycolysis and/or reduces beta-oxidation in the subject.
21. The method of any one of claims 1 to 19, further comprising prescribing to the subject a dietary intervention, wherein the dietary intervention promotes beta-oxidation and/or reduces glycolysis in the subject.
22. The method of any one of claims 1 to 21, further comprising administering an immune-suppressing agent to the subject.
23. The method of claim 22, wherein the immune-suppressing agent is administered to the subject prior to the administration of the rAAV.
24. A method for treating cancer in a subject in need thereof, the method comprising: a. measuring a metabolic profile of a biological sample obtained from a subject; b. identifying a metabolic imbalance associated with cancer based upon the metabolic profile; and, c. administering to the subject an N-acetylaspartate (NAA)-depleting agent, wherein the metabolic imbalance comprises a shift from beta-oxidation to glycolysis.
25. The method of claim 24, wherein the subject is a human.
26. The method of claim 24 or 25, wherein the cancer is ovarian cancer, breast cancer, lung squamous cell carcinoma, kidney renal cell carcinoma, colorectal cancer, prostate cancer, uterine endometroid cancer, or melanoma.
27. The method of any one of claims 24 to 26, wherein measuring the metabolic profile comprises assaying the biological sample using liquid chromatography (LC), mass spectrometry (MS), or liquid chromatography/mass spectrometry (LC/MS).
28. The method of claim 27, wherein measuring the metabolic profile comprises assaying the biological sample using Ultrahigh Performance Liquid Chromatography-Tandem Mass Spectroscopy (UPLC-MS/MS).
29. The method of any one of claims 24 to 28, wherein the biological sample is a tissue sample.
30. The method of claim 29, wherein the tissue sample comprises a tumor or tumor cells.
31. The method of any one of claims 24 to 30, wherein the metabolic profile comprises a level of a first biomarker selected from the group consisting of glucose, glucose-6-phosphate, 3-phosphoglycerate, pyruvate, lactate, and phosphoenolpyruvate.
32. The method of any one of claims 24 to 31, wherein the metabolic profile comprises a level of a second biomarker selected from the group consisting of carnitine, malonylcarnitine, myristoylcarnitine, palmitoylcarnitine, malonylcarnitine, and beta-hydroxybutyrate.
33. The method of any one of claims 24 to 32, wherein the metabolic profile further comprises a level of one or more additional biomarkers indicating an increase in glycolysis in the subject.
34. The method of any one of claims 24 to 33, wherein the metabolic profile further comprises a level of one or more additional biomarkers indicating an increase in beta-oxidation of the subject.
35. The method of any one of claims 24 to 34, wherein the NAA-depleting agent is ASPA.
36. The method of any one of claims 24 to 37, wherein the NAA-depleting agent is selected from the group consisting of a small molecule, a protein, and a nucleic acid.
37. The method of any one of claims 24 to 38, wherein the NAA-depleting agent is administered using a recombinant adeno-associated virus (rAAV).
38. The method of claim 38, wherein the rAAV comprises: (a) a capsid protein; and, (b) a nucleic acid comprising a promoter operably linked to a transgene, wherein the transgene encodes aspartoacylase (ASPA).
39. The method of claim 38, wherein the capsid protein has a serotype selected from the group consisting of AAV9 or variants thereof.
40. The method of any one of claims 37 to 39, wherein the rAAV is administered via injection.
41. The method of claim 40, wherein the injection is selected from the group consisting of intravenous injection, intravascular injection and intraventricular injection.
42. The method of any one of claims 37 to 41, wherein the administration results in expression of the gene in a target tissue.
43. The method of claim 42, wherein the target tissue is a tumor.
44. The method of any one of claims 38 to 43, wherein the promoter is tissue-specific promoter, optionally a tumor-specific promoter.
45. The method of any one of claims 24 to 44, further comprising administering a small molecule metabolic modulator to the subject.
46. The method of any one of claims 24 to 45, further comprising prescribing to the subject a dietary intervention, wherein the dietary intervention promotes beta-oxidation and/or reduces glycolysis in the subject.
47. The method of any one of claims 24 to 46, further comprising administering an immune-suppressing agent to the subject.
48. The method of claim 47, wherein the immune-suppressing agent is administered to the subject prior to the administration of the rAAV.
49. The method of any one of claims 24 to 48, wherein the metabolic imbalance is not caused by an ASPA-deficiency.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
DETAILED DESCRIPTION
[0055] Aspects of the disclosure relate to methods for treating a disease associated with a metabolic imbalance (e.g., cancer, obesity, diabetes, etc.) in a subject in need thereof. Methods provided herein, in some embodiments, involve modulating N-acetylaspartate (NAA) levels in a subject. NAA has been identified as the second most abundant molecule in the central nervous system (CNS). In some embodiments, NAA synthesis takes place in neurons. In some embodiments, NAA is not synthesized in cells or organs outside the CNS. NAA is metabolized by the enzyme aspartoacylase (ASPA) into acetate and L-aspartate. In some embodiments, ASPA is expressed in the CNS (e.g., in oligodendrocytes). In some embodiments, ASPA is expressed in peripheral organs, such as kidney, small intestines and others. In some embodiments, diseases such as cancer, obesity, diabetes, etc. demonstrate disturbance of cellular metabolism, for example a shift away from beta-oxidation towards glycolysis, or a shift away from glycolysis and towards beta-oxidation. Accordingly, in some embodiments, detection of a metabolic imbalance (e.g., a disturbance of metabolic activity or pathways in a cell or a subject) may be used as a disease marker for a wide range of diseases or disorders, e.g., cancer, obesity, diabetes, and neurodegenerative diseases and disorders, such as Canavan Disease, Alzheimer disease, traumatic brain injury, and psychiatric disorders.
[0056] In some embodiments, methods for treating diseases associated with a metabolic imbalance in a subject in need thereof are provided that involve administering to the subject an N-acetylaspartate (NAA)-depleting agent. As used herein, term NAA-depleting agent refers to an agent (e.g., nucleic acid, peptide, protein, small molecule) that depletes NAA levels directly or indirectly. In some embodiments, it has been determined that the disease is associated with a metabolic imbalance comprising a shift from glycolysis to beta-oxidation in the subject. In some embodiments, it has been determined that the disease is associated with a metabolic imbalance comprising a shift from beta-oxidation to glycolysis in the subject.
[0057] Other aspects of the disclosure relate to methods for treating disease in a subject in need thereof in which the methods involve administering to the subject an N-acetylaspartate (NAA)-increasing agent. As used herein, term NAA-increasing agent refers to an agent (e.g., nucleic acid, peptide, protein, small molecule) that increases NAA levels directly or indirectly. In some embodiments, it has been determined that a certain disease is associated with a metabolic imbalance comprising an NAA deficiency.
[0058] In some embodiments, an agent described by the disclosure (e.g., an NAA-depleting agent or an NAA-increasing agent) is a small molecule. Examples of small molecule NAA-depleting agents include rotenone, myxothiazol, cyanide and oligomycin. In some embodiments, an NAA-depleting agent or an NAA-increasing agent is a nucleic acid. In some embodiments, the nucleic acid is a dsRNA, siRNA, miRNA, artificial miRNA (ami-RNA), antisense oligonucleotide (ASO), aptamer (e.g., RNA aptamer, DNA aptamer, etc.), or closed-ended linear DNA molecule (e.g., CELID as described in International Publication No. WO2012/123430). In some embodiments, an NAA-depleting agent or an NAA-increasing agent is a peptide or protein. Examples of peptides and/or proteins include polypeptides, antibodies, and protein complexes (e.g., gene editing complexes, such as CRISPR/Cas9, TALENs, zinc-finger nucleases (ZFNs), etc.).
[0059] As used herein, metabolic imbalance refers to a dysregulated or abnormal metabolic state in a subject. For example, in some embodiments, CNS cells of a healthy subject display a preference for glycolysis as a major mode of energy (e.g., ATP production); in subjects having certain diseases (e.g., diseases associated with leukodystrophy, e.g., Canavan disease), CNS cells display a preference for fatty acid metabolism. In some embodiments, such a shift away from glycolysis and towards beta-oxidation can be referred to as a metabolic imbalance. In another example, in some embodiments, cells of a subject having a certain disease (e.g., cancer) display a preference for glycolysis that is significantly higher than cells of a subject not having the disease (e.g., cancer). In some embodiments, such an increased preference for glycolysis (and away from beta-oxidation) can be referred to as a metabolic imbalance. In some embodiments, cells of a subject having a certain disease (e.g., diabetes) display a preference for beta-oxidation that is significantly higher than cells of a subject not having the disease (e.g., diabetes). In some embodiments, such an increased preference for beta-oxidation (and away from glycolysis) can be referred to as a metabolic imbalance.
[0060] In some embodiments, methods disclosed herein involve comparing biomarkers (e.g., beta-oxidation, glycolysis) with an appropriate control. An appropriate control refers a level of a particular biomarker (e.g., beta-oxidation, glycolysis) that is indicative of a known metabolic status. Such levels can be determined experimentally or can be pre-existing reference levels. In some embodiments, an appropriate control may be a biomarker level indicative of the presence of a metabolic imbalance. For example, an appropriate control may be level of a factor (e.g., beta-oxidation, glycolysis) in a control subject. In some embodiments, a control subject does not have a metabolic imbalance. However, in some embodiments, a control subject does have a metabolic imbalance.
Treatment of Non-CNS Diseases
[0061] In some aspects, the disclosure relates to methods for treating diseases associated with metabolic imbalance (e.g., non-CNS diseases, such as diabetes, obesity, cancer, etc.). In some embodiments, the disclosure provides a method of treating a disease associated with a metabolic imbalance, the method comprising administering to a subject in need thereof an rAAV comprising an N-acetylaspartate (NAA)-increasing agent. In some embodiments, the disclosure provides a method of treating a disease associated with a metabolic imbalance, the method comprising administering to a subject in need thereof an rAAV comprising an N-acetylaspartate (NAA)-decreasing agent. Thus, in some embodiments, the methods involve administering to a subject a recombinant adeno-associated virus (rAAV) comprising a transgene encoding ASPA enzyme, or NAT8L enzyme.
[0062] Examples of diseases associated with a metabolic imbalance include but are not limited to obesity, diabetes mellitus (e.g., type I diabetes, type II diabetes, gestational diabetes, etc.), and cancer. Examples of cancer associated with metabolic imbalance include but are not limited to ovarian cancer, breast cancer, lung squamous cell carcinoma, kidney renal cell carcinoma, colorectal cancer, prostate cancer, uterine endometroid cancer, and melanoma.
[0063] Further non-limiting examples of cancer include, leukemia, such as acute lymphocytic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic myelocytic leukemia (CML) (e.g., B-cell CML, T-cell CML), and chronic lymphocytic leukemia (CLL) (e.g., B-cell CLL, T-cell CLL)); lymphoma, such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL, such as diffuse large cell lymphoma (DLCL) (e.g., diffuse large B-cell lymphoma (DLBCL, e.g., activated B-cell (ABC) DLBCL (ABC-DLBCL))), follicular lymphoma, chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL), mantle cell lymphoma (MCL), marginal zone B-cell lymphoma (e.g., mucosa-associated lymphoid tissue (MALT) lymphoma, nodal marginal zone B-cell lymphoma, splenic marginal zone B-cell lymphoma), primary mediastinal B-cell lymphoma, Burkitt lymphoma, Waldenstrom's macroglobulinemia (WM, lymphoplasmacytic lymphoma), hairy cell leukemia (HCL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, central nervous system (CNS) lymphoma (e.g., primary CNS lymphoma and secondary CNS lymphoma); and T-cell NHL, such as precursor T-lymphoblastic lymphoma/leukemia, peripheral T-cell lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma (CTCL) (e.g., mycosis fungoides, Sezary syndrome), angioimmunoblastic T-cell lymphoma, extranodal natural killer T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, and anaplastic large cell lymphoma); lymphoma of an immune privileged site (e.g., cerebral lymphoma, ocular lymphoma, lymphoma of the placenta, lymphoma of the fetus, testicular lymphoma); a mixture of one or more leukemia/lymphoma as described above; myelodysplasia; and multiple myeloma (MM). Additional exemplary cancers include, but are not limited to, lung cancer (e.g., bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung); kidney cancer (e.g., nephroblastoma, a.k.a. Wilms' tumor, renal cell carcinoma); acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer; benign monoclonal gammopathy; biliary cancer (e.g., cholangiocarcinoma); bladder cancer; breast cancer (e.g., adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast); brain cancer (e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma, oligodendroglioma), medulloblastoma); bronchus cancer; carcinoid tumor; cervical cancer (e.g., cervical adenocarcinoma); choriocarcinoma; chordoma; craniopharyngioma; colorectal cancer (e.g., colon cancer, rectal cancer, colorectal adenocarcinoma); connective tissue cancer; epithelial carcinoma; ependymoma; endotheliosarcoma (e.g., Kaposi's sarcoma, multiple idiopathic hemorrhagic sarcoma); endometrial cancer (e.g., uterine cancer, uterine sarcoma); esophageal cancer (e.g., adenocarcinoma of the esophagus, Barrett's adenocarcinoma); Ewing's sarcoma; ocular cancer (e.g., intraocular melanoma, retinoblastoma); familiar hypereosinophilia; gall bladder cancer; gastric cancer (e.g., stomach adenocarcinoma); gastrointestinal stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g., head and neck squamous cell carcinoma, oral cancer (e.g., oral squamous cell carcinoma), throat cancer (e.g., laryngeal cancer, pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer)); heavy chain disease (e.g., alpha chain disease, gamma chain disease, mu chain disease; hemangioblastoma; hypopharynx cancer; inflammatory myofibroblastic tumors; immunocytic amyloidosis; liver cancer (e.g., hepatocellular cancer (HCC), malignant hepatoma); leiomyosarcoma (LMS); mastocytosis (e.g., systemic mastocytosis); muscle cancer; myelodysplastic syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD) (e.g., polycythemia vera (PV), essential thrombocytosis (ET), agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF), chronic idiopathic myelofibrosis, chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)); neuroblastoma; neurofibroma (e.g., neurofibromatosis (NF) type 1 or type 2, schwannomatosis); neuroendocrine cancer (e.g., gastroenteropancreatic neuroendoctrine tumor (GEP-NET), carcinoid tumor); osteosarcoma (e.g., bone cancer); ovarian cancer (e.g., cystadenocarcinoma, ovarian embryonal carcinoma, ovarian adenocarcinoma); papillary adenocarcinoma; pancreatic cancer (e.g., pancreatic andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors); penile cancer (e.g., Paget's disease of the penis and scrotum); pinealoma; primitive neuroectodermal tumor (PNT); plasma cell neoplasia; paraneoplastic syndromes; intraepithelial neoplasms; prostate cancer (e.g., prostate adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland cancer; skin cancer (e.g., squamous cell carcinoma (SCC), keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small bowel cancer (e.g., appendix cancer); soft tissue sarcoma (e.g., malignant fibrous histiocytoma (MFH), liposarcoma, malignant peripheral nerve sheath tumor (MPNST), chondrosarcoma, fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small intestine cancer; sweat gland carcinoma; synovioma; testicular cancer (e.g., seminoma, testicular embryonal carcinoma); thyroid cancer (e.g., papillary carcinoma of the thyroid, papillary thyroid carcinoma (PTC), medullary thyroid cancer); urethral cancer; vaginal cancer; and vulvar cancer (e.g., Paget's disease of the vulva).
Recombinant Adeno-Associated Viruses (rAAVs)
[0064] In some aspects, the disclosure provides isolated AAVs that are useful for delivering transgenes that encode NAA-modulating agents (e.g., an NAA-depleting agent, an NAA-increasing agent). As used herein with respect to AAVs, the term isolated refers to an AAV that has been artificially produced or obtained. Isolated AAVs may be produced using recombinant methods. Such AAVs are referred to herein as recombinant AAVs. Recombinant AAVs (rAAVs) preferably have tissue-specific targeting capabilities, such that a nuclease and/or transgene of the rAAV will be delivered specifically to one or more predetermined tissue(s). The AAV capsid is an important element in determining these tissue-specific targeting capabilities. Thus, an rAAV having a capsid appropriate for the tissue being targeted can be selected.
[0065] In some aspects, the disclosure provides an rAAV having a capsid appropriate for targeting central nervous system (CNS) tissue or other tissue (e.g., a peripheral tissue). In some embodiments, the capsid has a serotype selected from the group consisting of AAV1, AAV2, AAV5, AAV6, AV6.2, AAV7, AAV8, AAV9 and AAVrh.10. In some embodiments, an rAAV described herein may comprise variants of AAV1, AAV2, AAV5, AAV6, AV6.2, AAV7, AAV8, AAV9, and AAVrh.10 serotype capsid proteins. In some embodiments, the capsid protein comprises an amino acid sequence that is at least 70%, at least 80%, at least 90%, at least 95% , or at least 99% identical to any one of the recited capsids.
[0066] Appropriate methods may be used for obtaining recombinant AAVs having a desired capsid protein. (See, for example, US 2003/0138772), the contents of which are incorporated herein by reference in their entirety). Typically the methods involve culturing a host cell which contains a nucleic acid sequence encoding an AAV capsid protein; a functional rep gene; a recombinant AAV vector composed of, AAV inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to permit packaging of the recombinant AAV vector into the AAV capsid proteins. In some embodiments, capsid proteins are structural proteins encoded by the cap gene of an AAV. AAVs comprise three capsid proteins, virion proteins 1 to 3 (named VP1, VP2 and VP3), all of which are transcribed from a single cap gene via alternative splicing. In some embodiments, the molecular weights of VP1, VP2 and VP3 are respectively about 87 kDa, about 72 kDa and about 62 kDa. In some embodiments, upon translation, capsid proteins form a spherical 60-mer protein shell around the viral genome. In some embodiments, the functions of the capsid proteins are to protect the viral genome, deliver the genome and interact with the host. In some aspects, capsid proteins deliver the viral genome to a host in a tissue specific manner.
[0067] The components to be cultured in the host cell to package a rAAV vector in an AAV capsid may be provided to the host cell in trans. Alternatively, any one or more of the required components (e.g., recombinant AAV vector, rep sequences, cap sequences, and/or helper functions) may be provided by a stable host cell which has been engineered to contain one or more of the required components using methods known to those of skill in the art. Most suitably, such a stable host cell will contain the required component(s) under the control of an inducible promoter. However, the required component(s) may be under the control of a constitutive promoter. Examples of suitable inducible and constitutive promoters are provided herein, in the discussion of regulatory elements suitable for use with the transgene. In still another alternative, a selected stable host cell may contain selected component(s) under the control of a constitutive promoter and other selected component(s) under the control of one or more inducible promoters. For example, a stable host cell may be generated which is derived from 293 cells (which contain El helper functions under the control of a constitutive promoter), but which contain the rep and/or cap proteins under the control of inducible promoters. Still other stable host cells may be generated by one of skill in the art.
[0068] In some embodiments, the instant disclosure relates to a host cell containing a nucleic acid that comprises a coding sequence encoding a gene associated with a neurodegenerative disease (e.g., a leukodystrophy). In some embodiments, the instant disclosure relates to a composition comprising the host cell described above. In some embodiments, the composition comprising the host cell above further comprises a cryopreservative.
[0069] The recombinant AAV vector, rep sequences, cap sequences, and helper functions required for producing the rAAV of the disclosure may be delivered to the packaging host cell using any appropriate genetic element (vector). The selected genetic element may be delivered by any suitable method, including those described herein. The methods used to construct any embodiment of this disclosure are known to those with skill in nucleic acid manipulation and include genetic engineering, recombinant engineering, and synthetic techniques. See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. Similarly, methods of generating rAAV virions are well known and the selection of a suitable method is not a limitation on the present disclosure. See, e.g., K. Fisher et al, J. Virol., 70:520-532 (1993) and U.S. Pat. No. 5,478,745.
[0070] In some embodiments, recombinant AAVs may be produced using the triple transfection method (described in detail in U.S. Pat. No. 6,001,650). Typically, the recombinant AAVs are produced by transfecting a host cell with an recombinant AAV vector (comprising a transgene) to be packaged into AAV particles, an AAV helper function vector, and an accessory function vector. An AAV helper function vector encodes the AAV helper function sequences (i.e., rep and cap), which function in trans for productive AAV replication and encapsidation. Preferably, the AAV helper function vector supports efficient AAV vector production without generating any detectable wild-type AAV virions (i.e., AAV virions containing functional rep and cap genes). Non-limiting examples of vectors suitable for use with the present disclosure include pHLP19, described in U.S. Pat. No. 6,001,650 and pRep6cap6 vector, described in U.S. Pat. No. 6,156,303, the entirety of both incorporated by reference herein. The accessory function vector encodes nucleotide sequences for non-AAV derived viral and/or cellular functions upon which AAV is dependent for replication (i.e., accessory functions). The accessory functions include those functions required for AAV replication, including, without limitation, those moieties involved in activation of AAV gene transcription, stage specific AAV mRNA splicing, AAV DNA replication, synthesis of cap expression products, and AAV capsid assembly. Viral-based accessory functions can be derived from any of the known helper viruses such as adenovirus, herpesvirus (other than herpes simplex virus type-1), and vaccinia virus.
[0071] In some aspects, the disclosure provides transfected host cells. The term transfection is used to refer to the uptake of foreign DNA by a cell, and a cell has been transfected when exogenous DNA has been introduced inside the cell membrane. A number of transfection techniques are generally known in the art. See, e.g., Graham et al. (1973) Virology, 52:456, Sambrook et al. (1989) Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York, Davis et al. (1986) Basic Methods in Molecular Biology, Elsevier, and Chu et al. (1981) Gene 13:197. Such techniques can be used to introduce one or more exogenous nucleic acids, such as a nucleotide integration vector and other nucleic acid molecules, into suitable host cells.
[0072] A host cell refers to any cell that harbors, or is capable of harboring, a substance of interest. Often a host cell is a mammalian cell. A host cell may be used as a recipient of an AAV helper construct, an AAV minigene plasmid, an accessory function vector, or other transfer DNA associated with the production of recombinant AAVs. The term includes the progeny of the original cell which has been transfected. Thus, a host cell as used herein may refer to a cell which has been transfected with an exogenous DNA sequence. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation.
[0073] As used herein, the term cell line refers to a population of cells capable of continuous or prolonged growth and division in vitro. Often, cell lines are clonal populations derived from a single progenitor cell. It is further known in the art that spontaneous or induced changes can occur in karyotype during storage or transfer of such clonal populations. Therefore, cells derived from the cell line referred to may not be precisely identical to the ancestral cells or cultures, and the cell line referred to includes such variants.
[0074] As used herein, the terms recombinant cell refers to a cell into which an exogenous DNA segment, such as DNA segment that leads to the transcription of a biologically-active polypeptide or production of a biologically active nucleic acid such as an RNA, has been introduced.
[0075] As used herein, the term vector includes any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, artificial chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences between cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors. In some embodiments, useful vectors are contemplated to be those vectors in which the nucleic acid segment to be transcribed is positioned under the transcriptional control of a promoter. A promoter refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a gene. The phrases operatively positioned, under control or under transcriptional control means that the promoter is in the correct location and orientation in relation to the nucleic acid to control RNA polymerase initiation and expression of the gene. The term expression vector or construct means any type of genetic construct containing a nucleic acid in which part or all of the nucleic acid encoding sequence is capable of being transcribed. In some embodiments, expression includes transcription of the nucleic acid, for example, to generate a biologically-active polypeptide product or functional RNA (e.g., shRNA, miRNA) from a transcribed gene.
[0076] The foregoing methods for packaging recombinant vectors in desired AAV capsids to produce the rAAVs of the disclosure are not meant to be limiting and other suitable methods will be apparent to the skilled artisan.
Isolated Nucleic Acids
[0077] A nucleic acid sequence refers to a DNA or RNA sequence. In some embodiments, proteins and nucleic acids of the disclosure are isolated. As used herein, the term isolated means artificially produced. As used herein with respect to nucleic acids, the term isolated means: (i) amplified in vitro by, for example, polymerase chain reaction (PCR); (ii) recombinantly produced by cloning; (iii) purified, as by cleavage and gel separation; or (iv) synthesized by, for example, chemical synthesis. An isolated nucleic acid is one which is readily manipulable by recombinant DNA techniques well known in the art. Thus, a nucleotide sequence contained in a vector in which 5 and 3 restriction sites are known or for which polymerase chain reaction (PCR) primer sequences have been disclosed is considered isolated but a nucleic acid sequence existing in its native state in its natural host is not. An isolated nucleic acid may be substantially purified, but need not be. For example, a nucleic acid that is isolated within a cloning or expression vector is not pure in that it may comprise only a tiny percentage of the material in the cell in which it resides. Such a nucleic acid is isolated, however, as the term is used herein because it is readily manipulable by standard techniques known to those of ordinary skill in the art. As used herein with respect to proteins or peptides, the term isolated refers to a protein or peptide that has been isolated from its natural environment or artificially produced (e.g., by chemical synthesis, by recombinant DNA technology, etc.).
[0078] In some embodiments, conservative amino acid substitutions may be made to provide functionally equivalent variants, or homologs of the capsid proteins. In some aspects the disclosure embraces sequence alterations that result in conservative amino acid substitutions. As used herein, a conservative amino acid substitution refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references that compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, or Current Protocols in Molecular Biology, F. M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made among amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D. Therefore, one can make conservative amino acid substitutions to the amino acid sequence of the proteins and polypeptides disclosed herein.
Recombinant AAV Vectors (rAAV Vectors)
[0079] Recombinant AAV (rAAV) vectors of the disclosure are typically composed of, at a minimum, a transgene and its regulatory sequences, and 5 and 3 AAV inverted terminal repeats (ITRs). It is this recombinant AAV vector which is packaged into a capsid protein and delivered to a selected target cell. In some embodiments, the transgene is a nucleic acid sequence, heterologous to the vector sequences, which encodes a polypeptide, protein, functional RNA molecule (e.g., shRNA, miRNA) or other gene product, of interest. The nucleic acid coding sequence is operatively linked to regulatory components in a manner which permits transgene transcription, translation, and/or expression in a cell of a target tissue.
[0080] In some embodiments, the instant disclosure relates to a recombinant AAV (rAAV) vector comprising a nucleic acid sequence including a promoter operably linked to a transgene, wherein the transgene is a gene associated with a neurodegenerative disease (e.g., leukodystrophy). In some embodiments, a rAAV vector further comprises nucleic acid sequences encoding one or more AAV inverted terminal repeat sequences (ITRs), for example AAV2 ITRs. In some embodiments, a rAAV vector further comprises nucleic acid sequences encoding one or more AAV ITRs selected from the group consisting of AAV2, AAV3, AAV4, AAVS, and AAV6.
[0081] The AAV sequences of the vector typically comprise the cis-acting 5 and 3 inverted terminal repeat sequences (See, e.g., B. J. Carter, in Handbook of Parvoviruses, ed., P. Tijsser, CRC Press, pp. 155 168 (1990)). The ITR sequences are about 145 bp in length. Preferably, substantially the entire sequences encoding the ITRs are used in the molecule, although some degree of minor modification of these sequences is permissible. The ability to modify these ITR sequences is within the skill of the art. (See, e.g., texts such as Sambrook et al, Molecular Cloning. A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory, New York (1989); and K. Fisher et al., J Virol., 70:520 532 (1996)). An example of such a molecule employed in the present disclosure is a cis-acting plasmid containing the transgene, in which the selected transgene sequence and associated regulatory elements are flanked by the 5 and 3 AAV ITR sequences. The AAV ITR sequences may be obtained from any known AAV, including presently identified mammalian AAV types (e.g., AAV2, AAV3, AAV4, AAV5, or AAV6 ITR sequences).
[0082] In some embodiments, the rAAVs of the present disclosure are pseudotyped rAAVs. Pseudotyping is the process of producing viruses or viral vectors in combination with foreign viral envelope proteins. The result is a pseudotyped virus particle. With this method, the foreign viral envelope proteins can be used to alter host tropism or an increased/decreased stability of the virus particles. In some aspects, a pseudotyped rAAV comprises nucleic acids from two or more different AAVs, wherein the nucleic acid from one AAV encodes a capsid protein and the nucleic acid of at least one other AAV encodes other viral proteins and/or the viral genome. In some embodiments, a pseudotyped rAAV refers to an AAV comprising an inverted terminal repeats (ITRs) of one AAV serotype and an capsid protein of a different AAV serotype. For example, a pseudotyped AAV vector containing the ITRs of serotype X encapsidated with the proteins of Y will be designated as AAVX/Y (e.g., AAV2/1 has the ITRs of AAV2 and the capsid of AAV1). In some embodiments, pseudotyped rAAVs may be useful for combining the tissue-specific targeting capabilities of a capsid protein from one AAV serotype with the viral DNA from another AAV serotype, thereby allowing targeted delivery of a transgene to a target tissue.
[0083] In addition to the major elements identified above for the recombinant AAV vector, the vector also includes control elements necessary which are operably linked to the transgene in a manner which permits its transcription, translation and/or expression in a cell transfected with the plasmid vector or infected with the virus produced by the disclosure. As used herein, operably linked sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
[0084] Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation (polyA) signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product. A great number of expression control sequences, including promoters which are native, constitutive, inducible, ubiquitous, and/or tissue-specific, are known in the art and may be utilized.
[0085] As used herein, a nucleic acid sequence (e.g., coding sequence) and regulatory sequences are said to be operably linked when they are covalently linked in such a way as to place the expression or transcription of the nucleic acid sequence under the influence or control of the regulatory sequences. If it is desired that the nucleic acid sequences be translated into a functional protein, two DNA sequences are said to be operably linked if induction of a promoter in the 5 regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein. Thus, a promoter region would be operably linked to a nucleic acid sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide. Similarly two or more coding regions are operably linked when they are linked in such a way that their transcription from a common promoter results in the expression of two or more proteins having been translated in frame. In some embodiments, operably linked coding sequences yield a fusion protein. In some embodiments, operably linked coding sequences yield a functional RNA (e.g., shRNA).
[0086] For nucleic acids encoding proteins, a polyadenylation sequence generally is inserted following the transgene sequences and before the 3 AAV ITR sequence. A rAAV construct useful in the present disclosure may also contain an intron, desirably located between the promoter/enhancer sequence and the transgene. One possible intron sequence is derived from SV-40, and is referred to as the SV-40 T intron sequence. Another vector element that may be used is an internal ribosome entry site (IRES). An IRES sequence is used to produce more than one polypeptide from a single gene transcript. An IRES sequence would be used to produce a protein that contain more than one polypeptide chains. Selection of these and/or other vector elements may be performed, as appropriate, and many such sequences are available [see, e.g., Sambrook et al, and references cited therein at, for example, pages 3.18 3.26 and 16.17 16.27 and Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, New York, 1989]. In some embodiments, a Foot and Mouth Disease Virus 2A sequence is included in polyprotein; this is a small peptide (approximately 18 amino acids in length) that has been shown to mediate the cleavage of polyproteins (Ryan, M D et al., EMBO, 1994; 4: 928-933; Mattion, N M et al., J Virology, November 1996; p. 8124-8127; Furler, S et al., Gene Therapy, 2001; 8: 864-873; and Halpin, C et al., The Plant Journal, 1999; 4: 453-459). The cleavage activity of the 2A sequence has previously been demonstrated in artificial systems including plasmids and gene therapy vectors (AAV and retroviruses) (Ryan, M D et al., EMBO, 1994; 4: 928-933; Mattion, N M et al., J Virology, November 1996; p. 8124-8127; Furler, S et al., Gene Therapy, 2001; 8: 864-873; and Halpin, C et al., The Plant Journal, 1999; 4: 453-459; de Felipe, P et al., Gene Therapy, 1999; 6: 198-208; de Felipe, Petal., Human Gene Therapy, 2000; 11: 1921-1931.; and Klump, H et al., Gene Therapy, 2001; 8: 811-817).
[0087] The precise nature of the regulatory sequences needed for gene expression in host cells may vary between species, tissues or cell types, but shall in general include, as necessary, 5 non-transcribed and 5 non-translated sequences involved with the initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, enhancer elements, and the like. Especially, such 5 non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene. Regulatory sequences may also include enhancer sequences or upstream activator sequences as desired. The vectors of the disclosure may optionally include 5 leader or signal sequences. The choice and design of an appropriate vector is within the ability and discretion of one of ordinary skill in the art.
[0088] Examples of constitutive promoters include, without limitation, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the (3-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFI a promoter [Invitrogen]. In some embodiments, a promoter is an enhanced chicken (3-actin promoter. In some embodiments, a promoter is an astrocyte specific promoter. In some embodiments, a promoter is an oligodendrocyte specific promoter. In some embodiments, a promoter is an CNS-specific promoter.
[0089] Inducible promoters allow regulation of gene expression and can be regulated by exogenously supplied compounds, environmental factors such as temperature, or the presence of a specific physiological state, e.g., acute phase, a particular differentiation state of the cell, or in replicating cells only. Inducible promoters and inducible systems are available from a variety of commercial sources, including, without limitation, Invitrogen, Clontech and Ariad. Many other systems have been described and can be readily selected by one of skill in the art. Examples of inducible promoters regulated by exogenously supplied promoters include the zinc-inducible sheep metallothionine (MT) promoter, the dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV) promoter, the T7 polymerase promoter system (WO 98/10088); the ecdysone insect promoter (No et al, Proc. Natl. Acad. Sci. USA, 93:3346-3351 (1996)), the tetracycline-repressible system (Gossen et al, Proc. Natl. Acad. Sci. USA, 89:5547-5551 (1992)), the tetracycline-inducible system (Gossen et al, Science, 268:1766-1769 (1995), see also Harvey et al, Curr. Opin. Chem. Biol., 2:512-518 (1998)), the RU486-inducible system (Wang et al, Nat. Biotech., 15:239-243 (1997) and Wang et al, Gene Ther., 4:432-441 (1997)) and the rapamycin-inducible system (Magari et al, J. Clin. Invest., 100:2865-2872 (1997)). Still other types of inducible promoters which may be useful in this context are those which are regulated by a specific physiological state, e.g., temperature, acute phase, a particular differentiation state of the cell, or in replicating cells only.
[0090] In another embodiment, the native promoter for the transgene will be used. The native promoter may be preferred when it is desired that expression of the transgene should mimic the native expression. The native promoter may be used when expression of the transgene must be regulated temporally or developmentally, or in a tissue-specific manner, or in response to specific transcriptional stimuli. In a further embodiment, other native expression control elements, such as enhancer elements, polyadenylation sites or Kozak consensus sequences may also be used to mimic the native expression.
[0091] In some embodiments, the regulatory sequences impart tissue-specific gene expression capabilities. In some cases, the tissue-specific regulatory sequences bind tissue-specific transcription factors that induce transcription in a tissue specific manner. Such tissue-specific regulatory sequences (e.g., promoters, enhancers, etc. . . ) are well known in the art. Exemplary tissue-specific regulatory sequences include, but are not limited to the following tissue specific promoters: a liver-specific thyroxin binding globulin (TBG) promoter, an insulin promoter, a glucagon promoter, a somatostatin promoter, a pancreatic polypeptide (PPY) promoter, a synapsin-1 (Syn) promoter, a creatine kinase (MCK) promoter, a mammalian desmin (DES) promoter, a a-myosin heavy chain (a-MHC) promoter, or a cardiac Troponin T (cTnT) promoter. Other exemplary promoters include Beta-actin promoter, hepatitis B virus core promoter, Sandig et al., Gene Ther., 3:1002-9 (1996); alpha-fetoprotein (AFP) promoter, Arbuthnot et al., Hum. Gene Ther., 7:1503-14 (1996)), bone osteocalcin promoter (Stein et al., Mol. Biol. Rep., 24:185-96 (1997)); bone sialoprotein promoter (Chen et al., J. Bone Miner. Res., 11:654-64 (1996)), CD2 promoter (Hansal et al., J. Immunol., 161:1063-8 (1998); immunoglobulin heavy chain promoter; T cell receptor a-chain promoter, neuronal such as neuron-specific enolase (NSE) promoter (Andersen et al., Cell. Mol. Neurobiol., 13:503-15 (1993)), neurofilament light-chain gene promoter (Piccioli et al., Proc. Natl. Acad. Sci. USA, 88:5611-5 (1991)), and the neuron-specific vgf gene promoter (Piccioli et al., Neuron, 15:373-84 (1995)), among others which will be apparent to the skilled artisan. In some embodiments, the promoter is an oligodendrocyte-specific promoter, for example the myelin basic protein (MBP) promoter (Chen et al., J. Neurosci, Res., 55(4); 504-13 (1999)).
[0092] In some embodiments, a tissue-specific promoter is a tumor-specific promoter. Examples of tumor-specific promoters include but are not limited to AFP promoter (hepatocellular carcinoma), CCKAR promoter (pancreatic cancer), CEA promoter (epithelial cancers), c-erbB2 promoter (breast cancer, pancreatic cancer), COX-2 promoter, CXCR4 promoter, E2F-1 promoter, HE4 promoter, LP promoter, MUC1 promoter, PSA promoter (prostate cancer), surviving promoter, TRP1 promoter (melanoma), Tyr promoter (melanoma), etc.
[0093] Aspects of the disclosure relate to the discovery that astrocyte-specific (e.g., astrocyte-restricted) expression of hASPA results has a positive therapeutic effect (e.g., survival, normalized growth, restoration of normal motor function and cognitive function) in mouse models of Canavan Disease. Therefore, in some embodiments, the transgene of an rAAV described by the disclosure is operably-linked to an astrocyte-specific promoter. Examples of astrocyte-specific promoters include but are not limited to glial fibrillary acidic protein (GFAP) (Brenner et al., J. Neurosci, 14(3, Pt 1); 1030-7 (1994)), aldehyde dehydrogenase 1 family, member L1 (ALDH1L1) promoter (Cahoy et al., J. Neurosci. 28, 264-278 (2008)), and glutamate transporter promoter EAAT1 (Colin et al., Glia 57, 667-679 (2009)). In some embodiments, the astrocyte-specific promoter is the glial fibrillary acidic protein (GFAP) promoter.
[0094] In some embodiments, one or more bindings sites for one or more of miRNAs are incorporated in a transgene of a rAAV vector, to inhibit the expression of the transgene in one or more tissues of an subject harboring the transgene. The skilled artisan will appreciate that binding sites may be selected to control the expression of a transgene in a tissue specific manner. For example, binding sites for the liver-specific miR-122 may be incorporated into a transgene to inhibit expression of that transgene in the liver. The target sites in the mRNA may be in the 5 UTR, the 3 UTR or in the coding region. Typically, the target site is in the 3 UTR of the mRNA. Furthermore, the transgene may be designed such that multiple miRNAs regulate the mRNA by recognizing the same or multiple sites. The presence of multiple miRNA binding sites may result in the cooperative action of multiple RISCs and provide highly efficient inhibition of expression. The target site sequence may comprise a total of 5-100, 10-60, or more nucleotides. The target site sequence may comprise at least 5 nucleotides of the sequence of a target gene binding site.
Administration Methods
[0095] Agents described by the disclosure may be delivered to a subject in compositions according to any appropriate methods. In some embodiments, an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.), e.g., suspended in a physiologically compatible carrier (i.e., in a composition), may be administered to a subject, i.e. host animal, such as a human, mouse, rat, cat, dog, sheep, rabbit, horse, cow, goat, pig, guinea pig, hamster, chicken, turkey, or a non-human primate (e.g., Macaque). In some embodiments, a host animal does not include a human.
[0096] The compositions of the disclosure may comprise an agent (a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) alone, or in combination with one or more other agents (e.g., a second rAAV encoding one or more different transgenes). In some embodiments, a composition comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different agents (e.g., multiple rAAVs each encoding one or more different transgenes).
[0097] In some cases, administration of an agent to a subject elicits an immune response in the subject, for example an immune response against an rAAV capsid protein. Without wishing to be bound by any particular theory, suppressing the immune system of a subject prior to administration of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) results, in some embodiments, in increased therapeutic effect of the agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.). Therefore, in some embodiments, a subject is administered one or more (e.g., 2, 3, 4, 5, or more) immune-suppressing agents prior to administration of an rAAV as described by the disclosure. An immune-suppressing agent is any composition (e.g., a protein, nucleic acid, small molecule, etc.) that reduces the immune response of a subject to an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.). An immune-suppressing agent can reduce the innate immune response, adaptive immune response, cellular immune response, humoral immune response, or any combination of the foregoing, in a subject.
[0098] Examples of biological immune-suppressing agents include but are not limited to monoclonal antibodies, such as monoclonal antibodies that block the co-stimulatory pathway (e.g., appropriate antibodies against CTLA4, ICOS, CD80, OX40, or other targets), interfering RNA (e.g., siRNA, dsRNA, shRNA, miRNA, etc.) targeting immunostimulatory molecules (e.g., cytokines), and proteins (e.g., proteasome inhibitors).
[0099] Examples of small molecule immune-suppressing molecules include but are not limited to glucocorticoids (e.g., cortisol, cortisone, prednisone, prednisolone, methylprednisolone, dexamethasone, betamethasone, triamcinolone, beclomethasone, fludrocortisone, deoxy corticosterone (DOCA), and aldosterone), cytostatics (e.g., cyclophosphamide, nitrosoureas, platinum compounds, methotrexate, azathioprine, mercaptopurine, fluorouracil, dactinomycin, etc.), immunophilin-targeting drugs (e.g., cyclosporine, tacrolimus, sirolimus, rapamycin, etc.), interferons (e.g., IFN-), mycophenolate, fingolimod, and myriocin.
[0100] An immune-suppressing agent can be administered to a subject at between about one week and one minute prior to administration of an agent (e.g., rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) as described by the disclosure. In some embodiments, an immune-suppressing agent is administered to a subject between about 5 days, about 1 day, about 12 hours, about 2 hours, about 1 hour, about 30 minutes, about 10 minutes, about 5 minutes, or about 1 minute prior to administration of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.). In some embodiments, a subject is administered an immune-suppressing agent on multiple (e.g. 2,3, 4, 5, 6, 7, 8, 9, 10, or more) occasions prior to administration of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) to the subject.
[0101] In some embodiments, a composition further comprises a pharmaceutically acceptable carrier. Suitable carriers may be readily selected by one of skill in the art in view of the indication for which the agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is directed. For example, one suitable carrier includes saline, which may be formulated with a variety of buffering solutions (e.g., phosphate buffered saline). Other exemplary carriers include sterile saline, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, and water. The selection of the carrier is not a limitation of the present disclosure.
[0102] Optionally, the compositions of the disclosure may contain, in addition to the agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) and carrier(s), other pharmaceutical ingredients, such as preservatives, or chemical stabilizers. Suitable exemplary preservatives include chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, and parachlorophenol. Suitable chemical stabilizers include gelatin and albumin.
[0103] In some embodiments, the agent or agents (e.g. a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) are administered in sufficient amounts to transfect the cells of a desired tissue (e.g., tumor tissue) and to provide sufficient levels of gene transfer and expression without undue adverse effects. Examples of pharmaceutically acceptable routes of administration include, but are not limited to, direct delivery to the selected organ (e.g., intrathecal, intracerebral), oral, inhalation (including intranasal and intratracheal delivery), intraocular, intravenous, intramuscular, subcutaneous, intradermal, intratumoral, and other parental routes of administration. Routes of administration may be combined, if desired.
[0104] In some embodiments, the dose of rAAV virions required to achieve a particular therapeutic effect, e.g., the units of dose in genome copies/per kilogram of body weight (GC/kg), will vary based on several factors including, but not limited to: the route of rAAV virion administration, the level of gene or RNA expression required to achieve a therapeutic effect, the specific disease or disorder being treated, and the stability of the gene or RNA product. One of skill in the art can readily determine a rAAV virion dose range to treat a patient having a particular disease or disorder based on the aforementioned factors, as well as other factors.
[0105] Generally, an effective amount is the amount of an agent sufficient to increase or deplete the expression or activity of NAA or ASPA in a cell. In some embodiments, an effective amount is the amount of an agent sufficient to alleviate a symptom, delay or slow the progression of a disease (e.g., slowing or inhibiting tumor growth) in a subject. In some embodiments, an effective amount of an rAAV is an amount sufficient to target infect an animal, target a desired tissue. In some embodiments, an effective amount of an rAAV is an amount sufficient to produce a stable somatic transgenic animal model. The effective amount will depend primarily on factors such as the species, age, weight, health of the subject, and the tissue to be targeted, and may thus vary among animal and tissue. For example, an effective amount of the rAAV is generally in the range of from about 1 ml to about 100 ml of solution containing from about 10.sup.9 to 10.sup.16 genome copies (gc). In some embodiments, a dosage between about 10.sup.10 and 10.sup.15 genome copies is appropriate. In some cases, a dosage between about 10.sup.11 to 10.sup.13 rAAV genome copies is appropriate. In certain embodiments, 10.sup.11 or 10.sup.12 rAAV genome copies is effective to target CNS tissue. In some embodiments, a dosage of an rAAV is calculated based upon the weight of the subject to which the rAAV is being administered. For example, in some embodiments, a dosage between 1.010.sup.10 gc/kg and 1.010.sup.15 gc/kg is appropriate. In some embodiments, a dosage of 2.010.sup.10 gc/kg, 2.010.sup.11 gc/kg , 2.010.sup.12 gc/kg , 2.010.sup.13 gc/kg , 2.010.sup.14 gc/kg , or 2.010.sup.15 gc/kg is appropriate. In some cases, stable transgenic animals are produced by multiple doses of an rAAV.
[0106] In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than once per calendar day (e.g., a 24-hour period). In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than once per 2, 3, 4, 5, 6, or 7 calendar days. In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than once per calendar week (e.g., 7 calendar days). In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than bi-weekly (e.g., once in a two calendar week period). In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than once per calendar month (e.g., once in 30 calendar days). In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than once per six calendar months. In some embodiments, a dose of an agent (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) is administered to a subject no more than once per calendar year (e.g., 365 days or 366 days in a leap year).
[0107] In some embodiments, rAAV compositions are formulated to reduce aggregation of AAV particles in the composition, particularly where high rAAV concentrations are present (e.g., 10.sup.13 GC/ml or more). Appropriate methods for reducing aggregation of may be used, including, for example, addition of surfactants, pH adjustment, salt concentration adjustment, etc. (See, e.g., Wright FR, et al., Molecular Therapy (2005) 12, 171-178, the contents of which are incorporated herein by reference.)
[0108] Formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens. Typically, these formulations may contain at least about 0.1% of the active compound or more, although the percentage of the active ingredient(s) may, of course, be varied and may conveniently be between about 1 or 2% and about 70% or 80% or more of the weight or volume of the total formulation. Naturally, the amount of active compound in each therapeutically-useful composition may be prepared is such a way that a suitable dosage will be obtained in any given unit dose of the compound. Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such pharmaceutical formulations, and as such, a variety of dosages and treatment regimens may be desirable.
[0109] In some embodiments, agents (e.g., a rAAV encoding an NAA-depleting agent or an NAA-increasing agent, a small molecule, peptide, protein, nucleic acid, etc.) in suitably formulated pharmaceutical compositions disclosed herein are delivered directly to target tissue, e.g., direct to tumor tissue. However, in certain circumstances it may be desirable to separately or in addition deliver the therapeutic agents via another route, e.g., subcutaneously, intraopancreatically, intranasally, parenterally, intravenously, intramuscularly, intrathecally, or orally, intraperitoneally, or by inhalation. In some embodiments, the administration modalities as described in U.S. Pat. Nos. 5,543,158; 5,641,515 and 5,399,363 (each specifically incorporated herein by reference in its entirety) may be used to deliver an agent or agents.
[0110] The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms. In many cases the form is sterile and fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and/or vegetable oils. Proper fluidity may be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
[0111] For administration of an injectable aqueous solution, for example, the solution may be suitably buffered, if necessary, and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration. In this connection, a suitable sterile aqueous medium may be employed. For example, one dosage may be dissolved in 1 ml of isotonic NaC1 solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, Remington's Pharmaceutical Sciences 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the host. The person responsible for administration will, in any event, determine the appropriate dose for the individual host.
[0112] Sterile injectable solutions are prepared by incorporating the active agent in the required amount in the appropriate solvent with various of the other ingredients enumerated herein, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0113] The compositions disclosed herein may also be formulated in a neutral or salt form. harmaceutically-acceptable salts, include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like. Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms such as injectable solutions, drug-release capsules, and the like.
[0114] As used herein, carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Supplementary active ingredients can also be incorporated into the compositions. The phrase pharmaceutically-acceptable refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a host.
[0115] Delivery vehicles such as liposomes, nanocapsules, microparticles, microspheres, lipid particles, vesicles, and the like, may be used for the introduction of the compositions of the present disclosure into suitable host cells. In particular, compositions described by the disclosure may be formulated for delivery either encapsulated in a lipid particle, a liposome, a vesicle, a nanosphere, or a nanoparticle or the like.
[0116] Such formulations may be preferred for the introduction of pharmaceutically acceptable formulations of the nucleic acids or the rAAV constructs disclosed herein. The formation and use of liposomes is generally known to those of skill in the art. Recently, liposomes were developed with improved serum stability and circulation half-times (U.S. Pat. No. 5,741,516). Further, various methods of liposome and liposome like preparations as potential drug carriers have been described (U.S. Pat. Nos. 5,567,434; 5,552,157; 5,565,213; 5,738,868 and 5,795,587).
[0117] Liposomes have been used successfully with a number of cell types that are normally resistant to transfection by other procedures. In addition, liposomes are free of the DNA length constraints that are typical of viral-based delivery systems. Liposomes have been used effectively to introduce genes, drugs, radiotherapeutic agents, viruses, transcription factors and allosteric effectors into a variety of cultured cell lines and animals. In addition, several successful clinical trials examining the effectiveness of liposome-mediated drug delivery have been completed.
[0118] Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs). MLVs generally have diameters of from 25 nm to 4m. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200 to 500.ANG., containing an aqueous solution in the core.
[0119] Alternatively, nanocapsule formulations may be used. Nanocapsules can generally entrap substances in a stable and reproducible way. To avoid side effects due to intracellular polymeric overloading, such ultrafine particles (sized around 0.1 m) should be designed using polymers able to be degraded in vivo. Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use.
EXAMPLES
Example 1
Modulation of Metabolic Balance in Cells
[0120] Metabolic profiling was performed in U87 glioma cells.
[0121] Glycolytic reserves and fatty acid metabolism were quantified. Data indicated that metabolic activity in untreated glioma cells was shifted towards glycolysis, relative to rAAV-ASPA-treated cells (
[0122] Taken together, these data indicate that administering an NAA-depleting agent (e.g., ASPA) to a cell having a metabolic imbalance (or having a disease characterized by a metabolic imbalance, such as cancer), in some embodiments, modulates or shifts metabolic activity to restore balance between glycolysis and beta-oxidation.
Example 2
Pathomechanism of Canavan's Disease
Experimental Design
[0123] Global biochemical profiles were determined in mouse brain tissue collected from postnatal day 25 (P25) mice representing treatment groups shown below in Table 1.
TABLE-US-00001 TABLE 1 Treatment groups Group n Description WT 8 Wild type mouse KO 8 Aspartoacylase gene knockout mouse rAAV Ctrl 8 Aspartoacylase gene knockout mouse, treated with virus with a promoter-less expression construct rAAV Tx 8 Aspartoacylase gene knockout mouse, treated with virus encoding the human ASPA gene
Metabolomics of Healthy and Canavan Disease Mouse Brains
[0124] Results of resting state functional MRI (RS-fMRI) indicate that Canavan disease causes increased oxygen consumption for functional neuro-connectivity (
[0125] The molecular phenotype of brains of mice having Canavan disease was investigated by using a whole brain metabolomics approach. Canavan disease were treated with intravenous (IV) injection of rAAV-ASPA at p1. Healthy and CD mouse brains (both untreated and treated groups) were homogenized and subjected to metabolic analysis. Over 452 metabolites were quantified in each wild-type, untreated, treated and treatment control groups (Table 2). This large data set revealed several crucial and entirely new aspects about Canavan disease pathomechanism, its gene therapy, CNS metabolism and novel function of AspA in general.
TABLE-US-00002 TABLE 2 Metabolomics analysis results Significantly Total Biochem- Total Biochem- Altered Biochemicals icals Biochemicals icals Biochemicals p 0.05 () 0.05 < p < 0.10 () KO 273 68|205 32 7|25 WT rAAV Tx 286 190|96 29 14|15
Statistical Analysis
[0126] Principal component analysis (PCA) transforms a large number of metabolic variables into a smaller number of orthogonal variables (Component 1, Component 2, etc.) in order to analyze variation between groups and to provide a high-level overview of the dataset. In the PCA (
[0127] The hierarchical clustering analysis (HCA) analyzes similarities between groups (
Neurotransmitter Biosynthesis
[0128] Aspartoacylase (ASPA) is responsible for the breakdown of N-acetylaspartate (producing acetate and aspartate). Consistently, N-acetylaspartate (NAA) was increased in KO (compared to WT); treatment with rAAV-expressing ASPA resulted in a decrease in NAA (and increases in aspartate). Curiously, while NAA levels were increased (KO vs WT), the neuropeptide N-acetyl-aspartyl-glutamate (NAAG) was not significantly changed (which could reflect changes in demand or regulation of steady-state pools/pool size). Gamma-aminobutyrate (GABA) was decreased (KO vs WT), which could reflect changes in GABA-mediated signaling (GABA increased in rAAV Tx, compared to rAAV Ctrl).
[0129] Several other neurotransmitters were also detected in the dataset; while acetylcholine and serotonin were not significantly changed in KO (compared to WT), serotonin did show increases in rAAV Tx (compared to Ctrl), which could reflect changes in serotonergic signaling.
Glucose Metabolism
[0130] In the absence of disease, energetics in the brain is thought to focus on glycolytic use, with acetyl CoA input into the TCA cycle to support oxidative metabolism and macromolecule biosynthesis. Increases in glucose, glucose 6-phosphate, and an isobar of sugar diphosphates (fructose 1,6-diphosphate, glucose 1,6-diphosphate, myo-inositol 1,4 or 1,3-diphosphate) could suggest changes in glucose use or increased availability.
[0131] Glucose and related molecules (fructose, mannose and myo-inositol) were elevated, though nucleotide sugars (e.g., UDP-glucose, UDP-galactose) were decreased, which could suggest changing biosynthetic demand (KO vs WT). Three-carbon glycolytic intermediates 3-phosphoglycerate (3-PG) and phosphoenolpyruvate (PEP) were also increased; pools for these biochemicals tend to increase as glycolytic use declines.
[0132] Consistent with decreasing glycolytic use, lactate was decreased (with non-significant decrease in pyruvate). Glycogen metabolites (maltotetraose, maltotriose, and maltose) were also increased, reflecting decreased glycolytic use. Changes in energetics reflect declining energy demand (potentially associated with increased neuronal cell death or senescence) or may reflect metabolic effects of NAA accumulation in the brain.
[0133] In rAAV (Tx vs Ctrl), decreases in glucose and related molecules, with increases in lactate, were suggestive of increasing glycolytic use. Interestingly, DHAP was elevated in rAAV (Tx vs Ctrl), which could reflect changing use for triglyceride biosynthesis (potentially related to a restoration of lipid biosynthesis, TAGs can be used as a precursor for phospholipids). Representative data relating to glucose metabolism is provided in
Lipid Metabolism
[0134] Complex lipids, sphingolipids, diacylglycerols, monoacylglycerols, and plasmalogens were all decreased, with decreases in lysolipids, long-chain (e.g., palmitate, palmitoleate, and stearate) and polyunsaturated fatty acids, and longer acylcarnitines (e.g., myristoylcarnitine, palmitoylcarnitine) suggestive of changing availability or use to support beta-oxidation (KO vs WT). The ketone body 3-hydroxybutyrate (BHBA) was also elevated in KO (compared to WT), with decreases in malonylcarnitine (a surrogate reporter for malonyl CoA) suggestive of a shift toward increased fatty acid beta-oxidation. Increases in BHBA may also reflect changes in liver ketogenesis (or increased brain ketone uptake to supplement energetics).
[0135] Increases in carnitine, deoxycarnitine, and changes in coenzyme A precursors (increases in pantothenate with decreases in 3-dephosphocoenzyme A and coenzyme A) could reflect changing demand or use (KO vs WT). N-acetylaspartate has been suggested as a key carrier of 2-carbon units to oligodendrocytes for lipid biosynthesis; decreases in lipids could reflect increased demand related to decreased biosynthesis.
[0136] Interestingly, in rAAV (Tx vs Ctrl), increases in malonylcarnitine could imply shifts toward increased fatty acid biosynthesis; metabolites related to phospholipid biosynthesis and remodeling (e.g., choline, CDP-choline, phosphoethanolamine) were also elevated. Finally, decreases in sphingolipids (e.g., sphinganine, sphingosine, and sphingomyelins) in KO (compared to WT), with increases in serine and threonine, could reflect changing availability for myelin biosynthesis, which has been suggested as one cause of neuronal cell death in Canavan disease; rAAV (Tx vs Ctrl) showed increases in these biochemicals. Representative data relating to lipid metabolism is provided in
Redox Homeostasis
[0137] Changes in metabolites related to glutathione biosynthesis (e.g., methionine, cystathionine, and cysteine) could suggest alterations in redox homeostasis in KO (compared to WT) (
Gene Therapy in Canavan Disease
[0138] While gene therapy in CD patients using intraparenchymal injections of ASPA expression systems was considered safe, it failed to show clinically significant improvements. Similar results were found using acetate replacement.
[0139] Data described herein demonstrate that either intraventricular (e.g., direct injection) or intravenous injection (e.g., systemic) of recombinant adeno-associated virus (rAAV) expressing ASPA can cure Canavan Disease. CD mice administered rAAV expressing ASPA by either intraventricular injection show similar improvement of motor function (
[0140] A crucial finding is that high ubiquitous ASPA expression enhances motor performance in treated CD mice over wild-type mice. This may be the result of enhanced energy metabolism due to direct intervention in the ASPA-mediated metabolism of NAA.
[0141] The results from this global metabolomic study compare WT or aspartoacylase (ASPA) KO brain samples, or KO mice treated with recombinant AAV (to express ASPA or not, as control), including changes in metabolites related to energetics (carbohydrate and lipid metabolism), neurotransmitter production, inflammation, and redox homeostasis. In the principal component analysis (PCA), samples split into two groups, with WT and rAAV Tx in one, and KO and rAAV Ctrl in the other, suggesting rAAV Tx-mediated rescued metabolomic effects of ASPA deficiency. Consistent with loss of ASPA function, N-acetylaspartate (NAA) accumulated in brain (KO vs WT), while levels decreased following ASPA re-expression (rAAV Tx vs Ctrl). Lipids tended to show decreases across all classes, which could reflect changes in beta-oxidation and/or biosynthesis (KO vs WT); rAAV Tx (compared to rAAV Ctrl) showed increases in a marker of lipid biosynthesis, with increases in a number of lipid classes. Evidence of declining glycolytic use in KO (compared to WT) was reversed in rAAV Tx (compared to rAAV Control). Finally, changes in the dataset pointed to increasing inflammation and oxidative stress in KO (compared to WT), with decreases in rAAV Tx (compared to Ctrl).
Summary of Results
Regarding Gene Therapy:
[0142] Gene Therapy reverses the metabolic changes in Canavan disease brains.
Regarding Canavan Disease Pathomechanism and CNS Energy Metabolism:
[0143] 1. Glucose metabolism in Canavan brains [0144] a. Substrates for glycolysis are abundant in Canavan mouse brains [0145] i. Substrates of glycolysis accumulate (e.g. glucose, glucose-6-phosphate, 3-phosphoglycerate, phosphoenolpyruvate) indicating a decreased rate of glycolysis. [0146] ii. Increased phosphoenolpyruvate inhibits the enzyme triosephosphate isomerase which decreases the efficacy of glycolysis by utilizing only 50% of each glucose molecule for energy production. [0147] iii. Glycogen, the glucose storage system of cells, is being broken down despite the abundancy of glucose in Canavan mouse brains. In a physiologic state, increased glucose leads to glycogen synthesis not break down. [0148] b. Products of glycolysis are unchanged or decreased in Canavan mouse brains [0149] i. Pyruvate is unchanged despite the abundancy of glycolysis substrates, which is paralleled by an decrease in lactate. Both indicates that the glycolytic rate is decreased. [0150] 2. Fatty acid metabolism in Canavan brains [0151] a. Products of fatty acid break down are changed to favor beta-oxidation (use of fatty acids for energy production). [0152] i. Carnitine is increased in Canavan brains. The transport into mitochondria is the rate limiting step in beta-oxidation. This transport is conducted by Carnitine palmitoyltransferase 1 and 2 (CPT1 and CPT2). Fatty acids need to be bound to carnitine in order to be transported into mitochondria. An increase in carnitine usually facilitates the esterification of fatty acids and carnitine supported fatty acid transport into mitochondria. [0153] ii. Several carnitine esters are increased, decreased or unchanged indicating consumption of fatty acids in Canavan brains. [0154] iii. Several fatty acids are decreased as well in Canavan brains, which might be because of fatty acid consumption for energy production, e.g. ATP or other energy equivalents. [0155] iv. Malonylcarnitine, a surrogate marker for malonyl-CoA is decreased which facilitates fatty acid transport into mitochondria for beta-oxidation (Malonyl-CoA inhibits CPT1 and thus reduces fatty acid transport into mitochondria; a reduction in malonyl-CoA removed this inhibitory stimulus). Malonyl-CoA is also a precursor for fatty acid synthesis and thus mediates between fatty acid break down and fatty acid synthesis. The fact that malonylcarnitine is decreased points towards fatty acid break down. [0156] 3. Ketone bodies in Canavan brains [0157] a. The ketone body beta-hydroxybutyrate is increased, which is directly broken down to acetate and feed into the TCA cycle. [0158] b. Beta-hydroxybutyrate also mediates between metabolism and transcription. [0159] 4. Acetate in Canavan brains [0160] a. Acetyl-CoA is not changed in the CD neurometabolome, which argues against the acetate deficiency hypothesis. In addition, it might also explain why acetate supplementation failed to cure Canavan disease in patients. [0161] b. Acetylcarnitine, which has been reported to be crucial in energy production is highly increased and thus facilitates energy production. [0162] 5. Antioxidants [0163] a. Some antioxidants were decreased, some increased, which could support the oxidative stress hypothesis. However, there was a significant reduction in metabolites for the synthesis of antioxidants, suggesting that the decreased in some antioxidants is an issue of supply rather than demand. This argues against the oxidative stress hypothesis as a primary disease causing factor.
[0164] NAA accumulation and/or ASPA deficiency disrupt the CNS energy metabolism by favoring fatty acids over glucose/lactate for energy production, causing self-consumption of fatty acids, critical components of myelin and thus white matter vacuolations and disease pathology.
[0165] NAA metabolic deficiency and/or its causative ASPA deficiency might promote fatty acid over glucose/lactate consumption for energy production.
[0166] NAA metabolism with its associated proteins such as AspA, might be a key player in regulating and communication between metabolic pathways and monitoring metabolic homeostasis of cells and organs, which is demonstrated by the fact that despite the abundancy of glucose, fatty acid metabolism is favored, glycogen is broken down and ketone bodies are formed, which are highly detrimental processes in a physiologic system but not in a state of altered NAA/ASPA metabolism. Also, in addition to be involved in NAA metabolism, AspA may play critical roles in energy metabolism.
[0167] These conclusions are further supported by the fact that rAAV mediated delivery of ASPA corrects these observed changes.
Example 3
Nur7 Mouse Model of Canavan Disease
[0168] A single intravenous (i.v.) injection of recombinant adeno-associated virus (rAAV) expressing human ASPA (hASPA) rescues early lethality and partially restores motor function (1.sup.st generation gene therapy) in a CD knock-out (CD KO) mouse, which resembles the congenital sub-form of CD and displays the severest phenotype of all available CD mouse models, with early death at around post-natal day (p) 28.
[0169] This example describes a 3.sup.rd generation rAAV expressing hASPA (also referred to as FKzhAspA-Opt), which comprises the sequence represented by SEQ ID NO: 1 and cures disease in a CD KO mouse model. Interestingly, the 3.sup.rd generation gene therapy turns CD KO mice into supermice, that outperform wild-type (WT) mice on rotarod motor function test. This rescue is persistent-treated mice assessed at 1.5 years of age still show no signs of disease reoccurrence. CNS pathology and magnet resonance imaging (MRI) at p25 and p365 show complete normalization.
[0170] To further support the efficacy of the 3.sup.rd generation gene therapy, neurometabolome profiling was performed. Data indicate that over 400 characterized metabolites that showed reversal of the Canavan disease related metabolic changes including myelin associated lipids. Transcriptomic profiling was also performed.
[0171] To further evaluate the potency of the 3.sup.rd generation gene therapy, different doses and routes of administration were tested. Of note, 200-fold lower doses intraventricularly (ICV) administered rAAV still rescues lethality, while mice treated ICV with 20-fold reduced dose draw even with WT mice on motor function testing.
[0172] Next, the Nur7 mouse model, which resembles infantile and juvenile sub-form of CD, was tested. This model displays a similar disease pattern as the CD KO mouse with respect to growth curve and neurologic symptoms but eventually re-gains weight and shows survival similar to wild-type mice (
[0173] Motor function was tested for all mice 4 weeks after treatment and subsequent intervals up to one year of age for direct comparison (
[0174] Overall, data demonstrate that rAAV mediated hASPA expression of the 3.sup.rd generation gene therapy vector not only prevents but also rescues the clinical manifestation and pathology of the juvenile and adult model of Canavan disease at an unprecedented level, which might have implications for other CNS disorders that require treatment in later stages of life. In addition, this is confirmed on different levels of cellular complexity by MRI, fMRI, CNS pathology, and neurometabolic profiling.
Example 4
Astrocyte-Restricted hASPA Expression in CD KO Mice (Severe Phenotype)
[0175] Several tissue/cell-specific expression cassettes configured for restricting hASPA expression to either astrocytes, neurons, oligodendrocytes, liver, heart, or muscle were produced. For example, a rAAV-hASPA construct comprising an astrocyte-specific glial fibrillary acidic protein (GFAP) promoter was produced. Tissue-restricted rAAV were administered to Canavan disease knock-out (CD KO) mice. Surprisingly, mice expressing hASPA restricted to peripheral organs showed extended survival and normalization of the growth curve at later time points, suggesting a contribution of peripheral organs to the disease pathomechanism.
[0176] Astrocyte-restricted hASPA expression produced the strongest disease recovery matching the performance of wild-type (WT) mice (
[0177] A lower dose of rAAV-hASPA was administered to mice via localized brain injections. Data indicates localized T2 hyper-intensity signal clearance on MRI was well correlated with reduction of NAA levels by MRS (
[0178] Overall, data indicate that hASPA expression does not have to be restored in oligodendrocytes in order to rescue lethality and Canavan disease phenotype.
TABLE-US-00003 SEQUENCES >SEQIDNO:1-Codon-optimizedhumanaspartoacylase (hASPA)cDNA(fullKozaksequenceunderlined) GCCACCATGACAAGCTGCCACATCGCCGAGGAGCACATCCAGAAAGTCGC CATTTTTGGGGGAACTCACGGTAACGAACTCACAGGGGTCTTCCTGGTGA AGCACTGGCTCGAGAACGGCGCAGAAATCCAGAGAACCGGACTGGAGGTG AAACCCTTCATTACAAATCCTCGGGCCGTCAAGAAATGCACTCGCTACAT CGACTGTGATCTGAACCGGATTTTTGATCTGGAAAATCTCGGCAAGAAAA TGTCCGAGGACCTGCCATACGAAGTGAGGAGAGCTCAGGAGATCAACCAC CTCTTCGGACCCAAGGACAGCGAAGATTCCTATGACATCATTTTTGATCT GCATAACACCACATCAAATATGGGGTGCACCCTGATCCTCGAGGACAGCC GCAACAATTTCCTGATCCAGATGTTTCACTATATTAAGACAAGTCTGGCA CCACTCCCCTGTTACGTGTATCTGATTGAGCATCCCTCTCTCAAGTACGC TACTACCCGAAGTATCGCAAAATATCCTGTGGGGATTGAAGTCGGTCCTC AGCCACAGGGAGTCCTGCGAGCCGATATCCTCGACCAGATGAGGAAGATG ATCAAACATGCTCTGGATTTCATTCACCACTTCAACGAGGGCAAGGAGTT CCCCCCTTGCGCCATCGAGGTGTACAAGATCATTGAAAAAGTCGATTATC CTCGGGACGAGAACGGCGAAATTGCCGCTATCATTCACCCAAATCTGCAG GACCAGGATTGGAAGCCCCTCCATCCTGGGGATCCAATGTTCCTGACACT CGACGGTAAAACTATCCCACTGGGCGGAGACTGTACCGTGTACCCCGTGT TTGTCAATGAGGCAGCCTACTATGAGAAGAAAGAAGCTTTCGCCAAAACA ACAAAACTCACTCTCAATGCTAAATCTATTCGGTGCTGCCTCCACTGA >SEQIDNO:2-Codon-optimizedhumanaspartoacylase (hASPA) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKP FITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLF GPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPL PCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIK HALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQ DWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK LTLNAKSIRCCLH >SEQIDNO:3-Codon-optimizedhumanNAT8LcDNA (fullKozaksequenceunderlined) GCCACCATGCACTGCGGGCCACCTGATATGGTCTGTGAAACTAAGATTGT CGCTGCCGAGGATCACGAGGCTCTGCCTGGAGCTAAAAAAGATGCTCTGC TGGCCGCCGCCGGCGCCATGTGGCCCCCTCTGCCAGCAGCACCAGGACCA GCAGCAGCACCACCCGCCCCTCCACCCGCCCCTGTGGCCCAGCCACACGG CGGCGCCGGCGGCGCCGGCCCTCCAGGCGGCCGGGGCGTGTGCATCCGGG AGTTCAGAGCAGCAGAGCAGGAGGCAGCAAGGAGAATCTTTTATGACGGC ATCATGGAGCGGATCCCCAACACCGCCTTCAGGGGACTGAGGCAGCACCC TAGAGCACAGCTGCTGTACGCACTGCTGGCCGCCCTGTGCTTTGCCGTGA GCAGGTCCCTGCTGCTGACCTGTCTGGTGCCCGCCGCCCTGCTGGGACTG AGGTACTATTACAGCCGGAAAGTGATCAGAGCCTATCTGGAGTGCGCCCT GCACACAGACATGGCCGATATCGAGCAGTATTACATGAAGCCCCCTGGCT CCTGTTTCTGGGTGGCCGTGCTGGACGGAAACGTGGTGGGAATCGTGGCA GCAAGGGCACACGAGGAGGACAATACCGTGGAGCTGCTGCGCATGTCTGT GGATAGCAGGTTCCGCGGCAAGGGAATCGCAAAGGCCCTGGGAAGGAAGG TGCTGGAGTTTGCCGTGGTGCACAATTACTCTGCCGTGGTGCTGGGCACC ACAGCAGTGAAGGTGGCAGCCCACAAGCTGTATGAGTCCCTGGGCTTTAG GCACATGGGCGCCTCTGATCACTACGTGCTGCCTGGCATGACACTGTCCC TGGCCGAGAGACTGTTCTTCCAGGTCCGCTACCATAGATATAGACTGCAG CTGAGGGAGGAGTGA >SEQIDNO:4-Codon-optimizedhumanNAT8L MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAA APPAPPPAPVAQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIM ERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCLVPAALLGLRY YYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAAR AHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTA VKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLR EE