Transfection vector for pathogenic amoebae and uses thereof

10273487 ยท 2019-04-30

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed herein are expression vectors suitable for transfection in amoebas. The vectors may include a promoter from a protein-encoding gene from an amoeba, a selection marker, and a polynucleotide sequence encoding a polypeptide of interest, operably linked to the promoter. The promoter may be from the ACT1 gene from Naegleria fowleri.

Claims

1. An expression vector comprising: a promoter comprising the polynucleotide sequence of SEQ ID NO: 4; a selection marker comprising the hygromycin resistance gene; and a nucleic acid encoding a polypeptide of interest, operably linked to the promoter, wherein the vector comprises the polynucleotide sequence of SEQ ID NO: 7.

2. The vector of claim 1, wherein the vector does not include a cytomegalovirus (CMV) promoter.

3. The vector of claim 1, wherein the vector further comprises a polynucleotide encoding a fluorescent protein.

4. The vector of claim 3, wherein the polynucleotide encoding a fluorescent protein is operably linked to the promoter and to the polynucleotide encoding the polypeptide of interest.

5. An amoeba transformed with the vector of claim 1.

6. The amoeba of claim 5, wherein the amoeba has reduced virulence compared to the corresponding amoeba lacking the vector.

7. The amoeba of claim 6, wherein the corresponding amoeba is an untransformed amoeba or an amoeba transformed with a different vector.

8. A vaccine comprising the amoeba of claim 5.

9. A method of expressing a foreign protein in an amoeba, the method comprising: transforming an amoeba with the vector of claim 1, wherein the polypeptide of interest comprises the foreign protein; isolating the transformed amoeba; culturing the transformed amoeba; and expressing the foreign protein in the amoeba.

10. A method of manipulating an amoeba, the method comprising transforming the amoeba with the vector of claim 1.

11. The method of claim 9, wherein the transforming is performed by electroporation.

12. The method of claim 9, wherein the amoeba is cultured in the presence of hygromycin, puromycin, nourseothricin, bleomycin, or a combination thereof.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 are graphs of cell viability versus drug concentration for various selection markers.

(2) FIG. 2A is a schematic diagram of the pNfEGFP-Hyg vector and the multiple cloning site (MCS). FIG. 2B is a schematic diagram of the NfACT1 promoter and poly(a) site of the pNfEGFP-Hyg vector.

(3) FIG. 3 is a graph of EGFP expression in pNfEGFP-Hyg transfectants at 4 weeks and 12 weeks.

(4) FIG. 4 are images of Naegleria fowleri transfected with pNfEGFP-Hyg vector.

(5) FIG. 5 is a schematic diagram of the pEGFP-N3 vector and the multiple cloning site (MCS).

DETAILED DESCRIPTION

(6) Described herein are expression vectors with selection markers and promoters that may be used to successfully transfect amoebas. Preliminary studies revealed that the amoeba Naegleria fowleri has natural resistance to the common selection marker neomycin, rendering neomycin ineffective as a selection marker for amoebas. Conventional mammalian transfection vectors include mammalian-specific promoters, such as the CMV promoter, that are not suitable for amoebic transfection. As detailed herein, selection markers and promoters suitable for use in the amoeba N. fowleri were discovered. The suitable selection markers and promoters may be used in expression vectors for transfecting amoeba such as N. fowleri and expressing proteins of interest. Multiple selectable markers may facilitate multiple rounds of transfection with different genes in reverse genetics approaches or for selection of double-knockouts in forward genetics screens. The expression vectors detailed herein provide an important tool for molecular and cellular analysis of amoebic virulence factors, as well as for reverse genetics approaches to examine potential drug targets within these pathogenic amoebae. The ability to introduce and express genes in amebae may facilitate both genetic analysis and modification of the virulence of this organism, which remains a serious threat to world health, and facilitate basic research towards the control of this parasite.

1. Definitions

(7) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.

(8) The terms comprise(s), include(s), having, has, can, contain(s), and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms a, and and the include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments comprising, consisting of and consisting essentially of, the embodiments or elements presented herein, whether explicitly set forth or not.

(9) For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.

(10) The term about as used herein as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain aspects, the term about refers to a range of values that fall within 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).

(11) The term administration or administering, as used herein, refers to providing, contacting, and/or delivery of a compound, vector, or agent, etc., by any appropriate route to achieve the desired effect. These compounds or agents may be administered to a subject in numerous ways including, but not limited to, orally, ocularly, nasally, intravenously, topically, as aerosols, suppository, etc. and may be used in combination.

(12) Amino acid as used herein refers to naturally occurring and non-natural synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code. Amino acids can be referred to herein by either their commonly known three-letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Amino acids include the side chain and polypeptide backbone portions.

(13) The term antagonist or inhibitor refers to a substance that blocks (e.g., reduces or prevents) a biological activity. An inhibitor may inhibit an activity directly or indirectly.

(14) As used herein, the term agonist refers to a substance that triggers (e.g., initiates or promotes), partially or fully enhances, stimulates, or activates one or more biological activities. An agonist may mimic the action of a naturally occurring substance. Whereas an agonist causes an action, an antagonist blocks the action of the agonist.

(15) Antimicrobial or antibiotic refers to a substance or method that is able to kill or inhibit the growth of microorganisms. To kill or inhibit the growth of includes limiting the presence of at least one microorganism. To kill or inhibit the growth of also includes inactivation or prevention of the replication of or reducing the number of a microorganism. Antibiotics include, for example, penicillin such as penicillin G, penicillin V, penicillin G benzathine, ampicillin, anoxacillin, nafcillin, carbenicilllin, dicloxacillin, bacampicillin, piperacillin, ticaricillin, mezlocillin and the like; cephalosporins such as cefazolin, cefadroxil, cephalexin, cefaclor, cefoxitin, cefonicid, ceftizoxime, cefprozil, ceftazidine, cefixime, cefpodoxime proxitel and the like; aminoglycosides such as amikacin, gentamicin, tobramycin, netilmicin, hygromycin, streptomycin, nourseothricin and the like; macrolides such as erythromycin and the like; monobactams such as aztreonam and the like; rifamycin and derivatives such as rifampin, rifamide, rifaximin and the like; chloramphenicol, clindamycin, lincomycin, imipenem, vancomycin; tetracyclines such as chloretetracycline, tetracycline, minocycline, doxycycline and the like; fusidic acid, novobiocin and the like; fosfomycin, fusidate sodium, neomycin, bacitracin, polymyxin, capreomycin, colistimethate, colistin, sulfamethoxazole, trimethoprim, puromycin, bleomycin, and gramicidin, and combinations thereof.

(16) The terms control, reference level, and reference are used herein interchangeably. The reference level may be a predetermined value or range, which is employed as a benchmark against which to assess the measured result. Control group as used herein refers to a group of control subjects. The predetermined level may be a cutoff value from a control group. The predetermined level may be an average from a control group. Cutoff values (or predetermined cutoff values) may be determined by Adaptive Index Model (AIM) methodology. Cutoff values (or predetermined cutoff values) may be determined by a receiver operating curve (ROC) analysis from biological samples of the patient group. ROC analysis, as generally known in the biological arts, is a determination of the ability of a test to discriminate one condition from another, e.g., to determine the performance of each marker in identifying a patient having CRC. A description of ROC analysis is provided in P. J. Heagerty et al. (Biometrics 2000, 56, 337-44), the disclosure of which is hereby incorporated by reference in its entirety. Alternatively, cutoff values may be determined by a quartile analysis of biological samples of a patient group. For example, a cutoff value may be determined by selecting a value that corresponds to any value in the 25th-75th percentile range, preferably a value that corresponds to the 25th percentile, the 50th percentile or the 75th percentile, and more preferably the 75th percentile. Such statistical analyses may be performed using any method known in the art and can be implemented through any number of commercially available software packages (e.g., from Analyse-it Software Ltd., Leeds, UK; StataCorp LP, College Station, Tex.; SAS Institute Inc., Cary, N.C.). The healthy or normal levels or ranges for a target or for a protein activity may be defined in accordance with standard practice. A control may be a subject, or a sample therefrom, whose disease state is known. The subject, or sample therefrom, may be healthy, diseased, diseased prior to treatment, diseased during treatment, diseased after treatment, or healthy after treatment, or a combination thereof. The term normal subject as used herein means a healthy subject, i.e. a subject having no clinical signs or symptoms of disease. The normal subject is clinically evaluated for otherwise undetected signs or symptoms of disease, which evaluation may include routine physical examination and/or laboratory testing. In some embodiments, the control is a healthy control. In some embodiments, the control comprises neurodegenerative disease.

(17) As used herein, the term cloning refers to the process of ligating a polynucleotide into a vector and transferring it into an appropriate host cell for duplication during propagation of the host.

(18) The term effective amount, as used herein, refers to a dosage of the compounds or compositions effective for eliciting a desired effect. This term as used herein may also refer to an amount effective at bringing about a desired in vivo effect in a subject, such as in an animal, preferably, a human, such as treatment of a disease.

(19) The term host cell is a cell that is susceptible to transformation, transfection, transduction, conjugation, and the like with a polynucleotide construct or expression vector. Host cells can be derived from plants, bacteria, yeast, fungi, insects, animals, protozoans, etc. In some embodiments, the host cell includes amoebas such as N. fowleri.

(20) Microorganism refers to a unicellular or multi-cellular microscopic or macroscopic life form. Microorganisms include, for example, amoebas, bacteria, protobacteria, phytoplankton, fungi, viruses, algae, molds, oomycetes, parasites, nematodes, and protozoans, or any combination thereof. Microorganisms may also be referred to as microbes.

(21) Polynucleotide as used herein can be single stranded or double stranded, or can contain portions of both double stranded and single stranded sequence. The polynucleotide can be nucleic acid, natural or synthetic, DNA, genomic DNA, cDNA, RNA, or a hybrid, where the polynucleotide can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, and isoguanine. Polynucleotides can be obtained by chemical synthesis methods or by recombinant methods.

(22) Polynucleotides are said to have 5 ends and 3 ends because mononucleotides are reacted to make oligonucleotides in a manner such that the 5 phosphate of one mononucleotide pentose ring is attached to the 3 oxygen of its neighbor in one direction via a phosphodiester linkage. Therefore, an end of an oligonucleotide is referred to as the 5 end if its 5 phosphate is not linked to the 3 oxygen of a mononucleotide pentose ring and as the 3 end if its 3 oxygen is not linked to a 5 phosphate of a subsequent mononucleotide pentose ring. As used herein, a polynucleotide sequence, even if internal to a larger oligonucleotide, also may be said to have 5 and 3 ends. In either a linear or circular polynucleotide, discrete elements are referred to as being upstream or 5 of the downstream or 3 elements. This terminology reflects the fact that transcription proceeds in a 5 to 3 fashion along the polynucleotide strand. The promoter and enhancer elements which direct transcription of a linked gene are generally located 5 or upstream of the coding region. However, enhancer elements can exert their effect even when located 3 of the promoter element and the coding region. Transcription termination and polyadenylation signals are located 3 or downstream of the coding region.

(23) As used herein, the term gene means the polynucleotide sequence comprising the coding region of a gene, e.g., a structural gene, and the including sequences located adjacent to the coding region on both the 5 and 3 ends for a distance of about 1 kb on either end such that the gene corresponds to the length of the full-length mRNA. The sequences which are located 5 or upstream of the coding region and which are present on the mRNA are referred to as 5 non-translated sequences. The sequences which are located 3 or downstream of the coding region and which are present on the mRNA are referred to as 3 non-translated sequences. The term gene encompasses both cDNA and genomic forms of a gene. A genomic form or clone of a gene contains the coding region interrupted with non-coding sequences termed introns or intervening regions or intervening sequences. Introns are segments of a gene which are transcribed into nuclear RNA, for example, heterogeneous nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers. Introns are removed or spliced out from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript. The mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide. In addition to containing introns, genomic forms of a gene may also include sequences located on both the 5 and 3 end of the sequences which are present on the RNA transcript. These sequences are referred to as flanking sequences or regions (these flanking sequences are located 5 or 3 to the non-translated sequences present on the mRNA transcript). The 5 flanking region may contain regulatory sequences such as promoters and enhancers which control or influence the transcription of the gene. The 3 flanking region may contain sequences which direct the termination of transcription, post-transcriptional cleavage and polyadenylation.

(24) As used herein, an oligonucleotide or polynucleotide having a nucleotide sequence encoding a gene means a polynucleotide sequence comprising the coding region of a gene, or in other words, the nucleic acid sequence which encodes a gene product. The coding region may be present in either a cDNA, genomic DNA, or RNA form. When present in a DNA form, the oligonucleotide may be single-stranded (i.e., the sense strand) or double-stranded. Suitable control elements such as enhancers/promoters, splice junctions, polyadenylation signals, etc. may be placed in close proximity to the coding region of the gene if needed to permit proper initiation of transcription and/or correct processing of the primary RNA transcript. Alternatively, the coding region utilized in the vector may contain endogenous enhancers/promoters, splice junctions, intervening sequences, polyadenylation signals, etc., or a combination of both endogenous and exogenous control elements.

(25) A peptide or polypeptide is a linked sequence of two or more amino acids linked by peptide bonds. The polypeptide can be natural, synthetic, or a modification or combination of natural and synthetic. Peptides and polypeptides include proteins such as binding proteins, receptors, and antibodies. The terms polypeptide, protein, and peptide are used interchangeably herein. Primary structure refers to the amino acid sequence of a particular peptide. Secondary structure refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains, e.g., enzymatic domains, extracellular domains, transmembrane domains, pore domains, and cytoplasmic tail domains. Domains are portions of a polypeptide that form a compact unit of the polypeptide and are typically 15 to 350 amino acids long. Exemplary domains include domains with enzymatic activity or ligand binding activity. Typical domains are made up of sections of lesser organization such as stretches of beta-sheet and alpha-helices. Tertiary structure refers to the complete three dimensional structure of a polypeptide monomer. Quaternary structure refers to the three dimensional structure formed by the noncovalent association of independent tertiary units.

(26) Recombinant when used with reference, e.g., to a cell, or polynucleotide, protein, or vector, indicates that the cell, nucleic acid, protein, or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native polynucleotide or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed, or not expressed at all. For example, the term recombinant DNA molecule as used herein refers to a DNA molecule which is comprised of segments of DNA joined together by means of molecular biological techniques. The term recombinant protein or recombinant polypeptide as used herein refers to a protein molecule which is expressed from a recombinant DNA molecule or recombinant polynucleotide.

(27) The term native protein as used herein to indicate that a protein does not contain amino acid residues encoded by vector sequences; the native protein contains only those amino acids found in the protein as it occurs in nature. A native protein may be produced by recombinant means or may be isolated from a naturally occurring source.

(28) An open reading frame includes at least 3 consecutive codons which are not stop codons. The term codon as used herein refers to any group of three consecutive nucleotide bases in a given messenger RNA molecule, or coding strand of DNA or polynucleotide that specifies a particular amino acid, a starting signal, or a stopping signal for translation. The term codon also refers to base triplets in a DNA strand.

(29) The terms in operable combination, in operable order, and operably linked as used herein refer to the linkage of polynucleotide sequences in such a manner that a polynucleotide molecule capable of directing the transcription of a given gene and/or the synthesis of a desired protein molecule is produced. The term also refers to the linkage of amino acid sequences in such a manner so that a functional protein is produced.

(30) As used herein, the term restriction endonuclease or restriction enzyme refers to a member or members of a classification of catalytic molecules that bind a cognate sequence of a polynucleotide and cleave the polynucleotide at a precise location within that sequence. Restriction endonuclease may be bacterial enzymes. Restriction endonuclease may cut double-stranded DNA at or near a specific nucleotide sequence.

(31) As used herein, recognition site or restriction site refers to a sequence of specific bases or nucleotides that is recognized by a restriction enzyme if the sequence is present in double-stranded DNA; or, if the sequence is present in single-stranded RNA, the sequence of specific bases or nucleotides that would be recognized by a restriction enzyme if the RNA was reverse transcribed into cDNA and the cDNA employed as a template with a DNA polymerase to generate a double-stranded DNA; or, if the sequence is present in single-stranded DNA, the sequence of specific bases or nucleotides that would be recognized by a restriction enzyme if the single-stranded DNA was employed as a template with a DNA polymerase to generate a double-stranded DNA; or, if the sequence is present in double-stranded RNA, the sequence of specific bases or nucleotides that would be recognized by a restriction enzyme if either strand of RNA was reverse transcribed into cDNA and the cDNA employed as a template with a DNA polymerase to generate a double-stranded DNA. The term unique restriction enzyme site or unique recognition site indicates that the recognition sequence for a given restriction enzyme appears once within a polynucleotide.

(32) As used herein, the term regulatory element refers to a genetic element which controls some aspect of the expression of polynucleotide sequences. For example, a promoter is a regulatory element that facilitates the initiation of transcription of an operably linked coding region. Other regulatory elements may include splicing signals, polyadenylation signals, termination signals, and the like. Transcriptional control signals in eukaryotes include promoter and enhancer elements. Promoters and enhancers include short arrays of polynucleotide sequences that interact specifically with cellular proteins involved in transcription (Maniatis et al., Science, 236: 1237 (1987), incorporated herein by reference). Conventional promoter and enhancer elements have been isolated from a variety of eukaryotic sources such as, for example, genes in yeast, insect and mammalian cells, and viruses (analogous control elements, i.e., promoters, are also found in prokaryotes). The selection of a particular promoter and enhancer depends on what cell type is to be used to express the protein of interest. Some eukaryotic promoters and enhancers have a broad host range while others are functional in a limited subset of cell types (for review see Voss et al., Trends Biochem. Sci., 11:287 (1986) and Maniatis et al., supra (1987)). For example, the SV40 early gene enhancer is very active in a wide variety of cell types from many mammalian species and has been widely used for the expression of proteins in mammalian cells (Dijkema et al. EMBO J. 1985, 4, 761). Two other examples of promoter/enhancer elements active in a broad range of mammalian cell types are those from the human elongation factor 10 gene (Uetsuki et al. J. Biol. Chem. 1989, 264, 5791; Kim et al. Gene, 1990, 91, 217; Mizushima et al. Nuc. Acids. Res. 1990, 18, 5322) and the long terminal repeats of the Rous sarcoma virus (Gorman et al. Proc. Natl. Acad. Sci. USA 1982, 79, 6777) and the human cytomegalovirus (Boshart et al. Cell 1985, 41, 521).

(33) As used herein, the term promoter/enhancer denotes a segment of a polynucleotide that contains sequences capable of providing both promoter and enhancer functions (i.e., the functions provided by a promoter element and an enhancer element, see above for a discussion of these functions). For example, the long terminal repeats of retroviruses contain both promoter and enhancer functions. The enhancer/promoter may be endogenous or exogenous or heterologous. An endogenous enhancer/promoter is one which is naturally linked with a given gene in the genome. An exogenous or heterologous enhancer/promoter is one which is placed in juxtaposition to a gene by means of genetic manipulation (i.e., molecular biological techniques) such that transcription of that gene is directed by the linked enhancer/promoter.

(34) Replication origins are unique polynucleotide segments that contain multiple short repeated sequences that are recognized by multimeric origin-binding proteins and which play a key role in assembling DNA replication enzymes at the origin site.

(35) The presence of splicing signals on an expression vector often results in higher levels of expression of the recombinant transcript. Splicing signals mediate the removal of introns from the primary RNA transcript and consist of a splice donor and acceptor site (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, New York (1989) pp. 16.7-16.8). An example of a splice donor and acceptor site is the splice junction from the 16S RNA of SV40.

(36) As used herein, the term purified or to purify or isolate refers to the removal of contaminants from a sample.

(37) As used herein the term portion when in reference to a protein or polynucleotide (as in a portion of a given protein) refers to fragments of that protein or polynucleotide. The protein fragments may range in size from two or more amino acid residues to the entire amino acid sequence minus one amino acid. Polynucleotide fragments may range in size from two or more nucleotides to the entire polynucleotide sequence minus one nucleotide.

(38) As used herein, the term fusion protein refers to a chimeric protein containing the protein of interest joined to a different peptide or protein fragment. The fusion partner may, for example, enhance the solubility of a linked protein of interest, allow identification and/or purification of the recombinant fusion protein, may provide an epitope tag or affinity domain to allow identification and/or purification of the recombinant fusion protein, e.g., from a host cell which expresses the fusion or a culture supernatant of that cell, or both, or may have another property or activity, e.g., two functional enzymes can be fused to produce a single protein with multiple enzymatic activities. If desired, the fusion protein may be removed from the protein of interest by a variety of enzymatic or chemical means known to the art. Thus, examples of fusion protein producing sequences useful in the vectors of the invention include epitope tag encoding sequences, affinity domain encoding sequences, or other functional protein encoding sequences, and the like. The use of the term functional protein encoding sequence, as used herein, indicates that the fusion protein producing element of a vector encodes a protein or peptide having a particular activity, such as an enzymatic activity, e.g., luciferase or dehalogenase, a binding activity, and the like, e.g., thioredoxin. For example, a functional protein encoding sequence may encode a kinase catalytic domain (Hanks and Hunter, FASEB J. 1995, 9, 576-595), producing a fusion protein that can enzymatically add phosphate moieties to particular amino acids, or may encode a Src Homology 2 (SH2) domain (Sadowski et al. Mol. Cell. Bio. 1986, 6, 4396; Mayer and Baltimore, Trends Cell. Biol. 1993, 3, 8), producing a fusion protein that specifically binds to phosphorylated tyrosines.

(39) The term specificity as used herein refers to the number of true negatives divided by the number of true negatives plus the number of false positives, where specificity (spec) may be within the range of 0<spec<1. Hence, a method that has both sensitivity and specificity equaling one, or 100%, is preferred.

(40) Sample or test sample as used herein can mean any sample in which the presence and/or level of an activity, a biomarker, target, agent, vector, or molecule, etc., is to be detected or determined. Samples may include liquids, solutions, emulsions, mixtures, or suspensions. Samples may include a medical sample. Samples may include any biological fluid or tissue, such as blood, whole blood, fractions of blood such as plasma and serum, peripheral blood mononuclear cells (PBMCs), muscle, interstitial fluid, sweat, saliva, urine, tears, synovial fluid, bone marrow, cerebrospinal fluid, nasal secretions, sputum, amniotic fluid, bronchoalveolar lavage fluid, gastric lavage, emesis, fecal matter, lung tissue, peripheral blood mononuclear cells, total white blood cells, lymph node cells, spleen cells, tonsil cells, cancer cells, tumor cells, bile, digestive fluid, skin, or combinations thereof. In some embodiments, the sample comprises an aliquot. In other embodiments, the sample comprises a biological fluid. Samples can be obtained by any means known in the art. The sample can be used directly as obtained from a patient or can be pre-treated, such as by filtration, distillation, extraction, concentration, centrifugation, inactivation of interfering components, addition of reagents, and the like, to modify the character of the sample in some manner as discussed herein or otherwise as is known in the art. Samples may be obtained before treatment, before diagnosis, during treatment, after treatment, or after diagnosis, or a combination thereof.

(41) As used herein, the term selectable marker or selectable marker gene refers to the use of a gene which encodes an enzymatic activity that confers the ability to grow in medium lacking what would otherwise be an essential nutrient (e.g., the TRPI gene in yeast cells), and/or confer upon the cell resistance to an antibiotic or drug in which the selectable marker is expressed. Selection markers may provide a means to select for or against growth of cells which have been successfully transformed with a vector containing the selection marker sequence and express the marker. A selectable marker may be used to confer a particular phenotype upon a host cell. When a host cell must express a selectable marker to grow in selective medium, the marker is said to be a positive selectable marker (e.g., drug or antibiotic resistance genes which confer the ability to grow in the presence of the appropriate antibiotic, or enable cells to detoxify an exogenously added drug that would otherwise kill the cell). Another example of a positive selection marker is a an auxotrophic marker, which allows cells to synthesize an essential component (usually an amino acid) while grown in media which lacks that essential component. Selectable auxotrophic gene sequences include, for example, hisD, which allows growth in histidine free media in the presence of histidinol. Selectable markers can also be used to select against host cells containing a particular gene (e.g., the sacB gene which, if expressed, kills the bacterial host cells grown in medium containing 5% sucrose); selectable markers used in this manner are referred to as negative selectable markers or counter-selectable markers. In some embodiments, selectable markers include resistance genes such as antibiotic resistance genes.

(42) Subject as used herein can mean an organism that wants or is in need of the herein described compounds or methods. The subject may be a human or a non-human animal. The subject may be a microorganism. The subject may be a mammal. The mammal may be a primate or a non-primate. The mammal can be a primate such as a human; a non-primate such as, for example, dog, cat, horse, cow, pig, mouse, rat, camel, llama, goat, rabbit, sheep, hamster, and guinea pig; or non-human primate such as, for example, monkey, chimpanzee, gorilla, orangutan, and gibbon. The subject may be of any age or stage of development, such as, for example, an adult, an adolescent, or an infant.

(43) Substantially identical can mean that a first and second amino acid or polynucleotide sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% over a region of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 amino acids or nucleotides, respectively.

(44) The terms transformation and transfection as used herein refer to the introduction of foreign DNA or polynucleotide into prokaryotic or eukaryotic cells. Transformation of prokaryotic cells may be accomplished by a variety of means known to the art including, for example, the treatment of host cells with CaCl.sub.2 to make competent cells, electroporation, etc. Transfection of eukaryotic cells may be accomplished by a variety of means known to the art including, for example, calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, lipofection, protoplast fusion, retroviral infection, and biolistics.

(45) The terms treat, treated, or treating as used herein refers to a therapeutic wherein the object is to slow down (lessen) an undesired physiological condition, disorder or disease, or to obtain beneficial or desired clinical results. For the purposes of this invention, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of the extent of the condition, disorder or disease; stabilization (i.e., not worsening) of the state of the condition, disorder or disease; delay in onset or slowing of the progression of the condition, disorder or disease; amelioration of the condition, disorder or disease state; and remission (whether partial or total), whether detectable or undetectable, or enhancement or improvement of the condition, disorder or disease. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment.

(46) Variant as used herein with respect to a polynucleotide means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a polynucleotide that is substantially identical to a referenced polynucleotide or the complement thereof; or (iv) a polynucleotide that hybridizes under stringent conditions to the referenced polynucleotide, complement thereof, or a sequences substantially identical thereto.

(47) A variant can further be defined as a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Representative examples of biological activity include the ability to be bound by a specific antibody or polypeptide or to promote an immune response. Variant can mean a substantially identical sequence. Variant can mean a functional fragment thereof. Variant can also mean multiple copies of a polypeptide. The multiple copies can be in tandem or separated by a linker. Variant can also mean a polypeptide with an amino acid sequence that is substantially identical to a referenced polypeptide with an amino acid sequence that retains at least one biological activity. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids. See Kyte et al., J. Mol. Biol. 1982, 157, 105-132. The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indices of 2 are substituted. The hydrophobicity of amino acids can also be used to reveal substitutions that would result in polypeptides retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a polypeptide permits calculation of the greatest local average hydrophilicity of that polypeptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity, as discussed in U.S. Pat. No. 4,554,101, which is fully incorporated herein by reference. Substitution of amino acids having similar hydrophilicity values can result in polypeptides retaining biological activity, for example immunogenicity, as is understood in the art. Substitutions can be performed with amino acids having hydrophilicity values within 2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties. A variant can be a polynucleotide sequence that is substantially identical over the full length of the full gene sequence or a fragment thereof. The polynucleotide sequence can be 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the gene sequence or a fragment thereof. A variant can be an amino acid sequence that is substantially identical over the full length of the amino acid sequence or fragment thereof. The amino acid sequence can be 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the amino acid sequence or a fragment thereof. In some embodiments, variants include homologues. Homologues may be polynucleotides or polypeptides or genes inherited in two species by a common ancestor.

(48) As used herein, the term vector is used in reference to a polynucleotide that transfers polynucleotide segment(s) from one cell to another. A vector may also be referred to as a vehicle and is a type of polynucleotide construct or nucleic acid construct. Vectors include circular nucleic acid constructs such as plasmids, cosmids, etc., as well as linear nucleic acid constructs (e.g., lambda, phage constructs, PCR products), viruses, and other mediums. A vector may include expression signals such as a promoter and/or an enhancer, and in such a case it is referred to as an expression vector. The term expression vector as used herein refers to a polynucleotide molecule containing a desired coding sequence and appropriate polynucleotide sequences necessary for the expression of the operably linked coding sequence in a particular host organism. The expression vector can be transfected and into an organism to express a gene. The expression vector may be recombinant. A polynucleotide sequence for encoding a desired protein can be inserted or introduced into an expression vector. A vector may include polynucleotide sequences to promote or control expression in prokaryotes such as a promoter, an operator (optional), and a ribosome binding site, and other sequences. A vector may include polynucleotide sequences to promote or control expression in eukaryotes such as a promoter, enhancers, termination signal, and polyadenylation signal.

2. Amoebas

(49) An amoeba is a type of cell or organism which has the ability to alter its shape, primarily by extending and retracting pseudopods. Pseudopods are bulges of cytoplasm formed by the coordinated action of actin microfilaments pushing out the plasma membrane that surrounds the cell. Amoebas do not form a single taxonomic group; rather, amoebas are found in every major lineage of eukaryotic organisms. Amoebas occur not only among the protozoa, but also in fungi, algae, and animals. Amoebas may be present in freshwater, saltwater, brackish water, or a combination thereof. The size of an amoeba may vary, depending on the species. In some embodiments, the amoeba has a diameter of about 2.0 m to about 25 cm, about 5 m to about 50 m, about 10 m to about 45 m, about 12 m to about 40 m, about 5 m to about 1 cm, about 5 m to about 20 m, or about 8 m to about 15 m.

(50) Amoebas may include, for example, Naegleria fowleri (brain-eating amoeba), Naegleria gruberi, Acanthamoeba spp. such as Acanthamoeba castellanii, Balamuthia ssp. such as Balamuthia mandrillaris, Entamoeba ssp. such as Entamoeba histolytica, Entamoeba coli, Entamoeba dispar, Entamoeba gingivalis, and Entamoeba hartmanni, Endolimax nana, Hartmannella vermiformis, and Dictyostelium discoideum. In some embodiments, the amoebas may be described as protozoan parasites.

(51) Diseases caused by amoebas include, for example, amebic encephalitis, meningoencephalitis such as primary amoebic meningoencephalitis (PAM; also known as naegleriasis) and granulomatous amoebic meningoencephalitis, amoebic keratitis, cutaneous amoebiasis, and amoebiasis (amoebic dysentery). In some embodiments, amoebic keratitis causes blindness. In some embodiments, amoebic keratitis particularly affects subjects wearing contact lenses. E. dispar and E. histolytica may cause amoebiasis. N. fowleri may cause PAM. Acanthamoeba spp. may cause amoebic keratitis, cutaneous amoebiasis, and/or encephalitis. B. mandrillaris may cause granulomatous amoebic meningoencephalitis.

(52) a. Naegleria fowleri

(53) In some embodiments, the amoeba is N. fowleri. N. fowleri is a free-living amoeba that may be found in warm fresh water, such as ponds, lakes, rivers, and hot springs. N. fowleri may also be found in the soil near warm-water discharges of industrial plants, or in unchlorinated or minimally-chlorinated swimming pools. N. fowleri occurs in three forms as a cyst, a trophozoite (ameboid), and a biflagellate (it has two flagella). N. fowleri does not form a cyst in human tissue. N. fowleri may be found in human tissue as the amoeboid trophozoite stage. N. fowleri may also be found in the flagellate form in the cerebrospinal fluid. The trophozoite stage can transition to the more mobile flagellate stage if pH or osmolarity changes occur surrounding the subject, or it can encyst if the environment becomes depleted of nutrients, cold, or dry (soil) to survive the unfavorable conditions. N. fowleri is infective in the trophozoite stage. Infections most often occur when water containing N. fowleri is inhaled through the nose of the subject, where it then enters the nasal and olfactory nerve tissue, traveling to the brain through the cribriform plate. The penetration of the nasal mucosa and subsequent migration and infection of the brain through the olfactory lobe can result in PAM. N. fowleri normally eat bacteria, but during human infections, the trophozoites can consume astrocytes and neurons.

3. Expression Vector

(54) Provided herein is an expression vector. The expression vector may be used to transfect an amoeba. In some embodiments, the expression vector is referred to as an amoebic transfection vector. In some embodiments, the expression vector includes a single piece of polynucleotide in linear or circular form. The expression vector may be double-stranded. The expression vectors may contain one or more polynucleotide sequences that generally have some function in the replication, maintenance, or integrity of the vector, such as, for example, origins of replication, as well as one or more selectable marker genes. The expression vector may include a promoter from a protein-encoding gene from an amoeba, a selection marker, and a nucleic acid sequence encoding a polypeptide of interest. The expression vector may also include sequences for a poly(A) site, a multiple cloning site (MCS), a gene encoding a fluorescent protein, or a combination thereof. A polynucleotide sequence of the expression vector may be operably linked to another polynucleotide sequence in the expression vector using conventional recombinant DNA techniques. Suitable techniques are described in Sambrook, J. et al., (1989) Molecular Cloning. A Laboratory Manual, second edition, Cold Spring Harbor Laboratory Press: Cold Spring Harbor, N.Y., incorporated herein by reference. A polynucleotide sequence can be linked directly to other flanking sequence(s) or can be linked via intervening nucleotides. Intervening polynucleotide sequences of about 0 to about 100 nucleotides, or about 0 to about 20 nucleotides, may be present in between sequences of the vector. For example, in some embodiments, an intervening polynucleotide of 9 nucleotides may be present in between the MCS and the gene encoding a fluorescent protein of the vector.

(55) In some embodiments, the selection marker is positioned downstream of the promoter. In some embodiments, the selection marker is positioned downstream of the promoter and upstream of the poly(A) site. In some embodiments, the promoter is upstream of the MCS. In some embodiments, the promoter, poly(A) site, and selection marker are upstream of the MCS. In some embodiments, the vector comprises a polynucleotide sequence of SEQ ID NO: 7.

(56) a. Promoter

(57) The expression vector may include a promoter. As used herein, promoter refers to a part of polynucleotide sequence where transcription regulatory factors bind to direct expression of a gene. In some embodiments, a promoter capable of inducing efficient and stable gene expression can be used to increase gene expression level. A promoter may be inducible, initiating transcription in response to an inducing agent or, in contrast, a promoter may be constitutive, whereby an inducing agent does not regulate the rate of transcription. The promoter may be regulatable. For example, a regulatable promoter may include an inducible promoter. In some embodiments, the promoter is an inducible promoter. In some embodiments, the promoter is a constitutive promoter. The promoter may be from a gene that is constitutively expressed in all stages of an amoeba. In some embodiments, the promoter is from a gene from an amoeba of the genus Naegleria. In some embodiments, the promoter is from a gene from N. fowleri. The promoter may be from a protein-coding gene from an amoeba. In some embodiments, the promoter is from a gene coding for actin, tubulin, or ribosomal RNA in an amoeba. In some embodiments, the promoter is from the ACT1 gene. In some embodiments, the promoter is from the ACT1 gene of an amoeba of the genus Naegleria. In some embodiments, the promoter is from the ACT1 gene from N. fowleri. In some embodiments, the promoter comprises a polynucleotide sequence of SEQ ID NO: 4.

(58) b. Selection Markers

(59) The expression vector may include at least one selection marker. In some embodiments, the selection marker is selected from hygromycin, puromycin, noursecothricin, and bleomycin resistance genes, or a combination thereof. A vector may include a single selection marker. A vector may include multiple different selection markers. A plurality of vectors may include multiple different selection markers, each vector including one or more selection markers. Multiple selection markers may be used, for example, to facilitate multiple rounds of transfection, different genes being expressed, multiple genes being knocked out, or a combination thereof. In some embodiments, the vector includes a hygromycin resistance gene. In some embodiments, the hygromycin resistance gene comprises a polynucleotide sequence of SEQ ID NO: 6.

(60) c. Poly(A) Site

(61) The expression vector may include a poly(A) site. As used herein, poly(A) site may also be referred to as polyA tail, polyA signal, polyA, polyadenylic acid, or polyadenylic acid tail, and it refers to a polynucleotide sequence that directs both the termination and polyadenylation of the nascent RNA transcript. The poly(A) site may include a plurality of adenine nucleotides, such as a consecutive sequence of adenine nucleotides. Poly(A) sites are normally present at the 3 terminal of mRNA of eukaryotic cells. Efficient polyadenylation of the recombinant transcript is desirable as transcripts lacking a poly(A) site may be unstable and rapidly degraded. The poly(A) site utilized in an expression vector may be heterologous or endogenous. An endogenous poly(A) site is one that is found naturally at the 3 end of the coding region of a given gene in the genome. A heterologous poly(A) site is one which is one which is isolated from one gene and placed 3 of another gene. The length of a poly(A) site may be, for example, 10 to 200 nucleotides, or 50 to 150 nucleotides. Poly(A) tail is normally involved in stabilization, translation, and transport of mRNA from the nucleus to cytoplasm. Poly(A) tail may direct both the termination and polyadenylation of the nascent RNA transcript. Efficient polyadenylation of the recombinant transcript may be desirable as transcripts lacking a poly(A) tail may be unstable and/or rapidly degraded. The poly(A) site utilized in an expression vector may be heterologous or endogenous. Examples of poly(A) sites and a description thereof may be found in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor (1989), incorporated herein by reference. In some embodiments, the poly(A) site comprises a polynucleotide sequence of SEQ ID NO: 5. Efficient expression of recombinant DNA sequences in eukaryotic cells may require the expression of signals directing the efficient termination and polyadenylation of the resulting transcript. Transcription termination signals are generally found downstream of the polyadenylation signal and may be a few hundred nucleotides in length.

(62) d. Multiple Cloning Site (MCS)

(63) The expression vector may include a multiple cloning site (MCS). The MCS may also be referred to as a polylinker. The term multiple cloning site refers to a polynucleotide sequence comprising restriction sites for the purpose of cloning polynucleotide fragments into an expression vector. The MCS may be used for the insertion and/or excision of polynucleotide sequences such as the coding region of a gene. In some embodiments, the vector includes a MCS comprising a polynucleotide sequence of SEQ ID NO: 2. In some embodiments, the vector includes a MCS comprising a polynucleotide sequence of SEQ ID NO: 3. In some embodiments, the vector does not include a cytomegalovirus (CMV) promoter.

(64) e. Polypeptide of Interest

(65) The expression vector may include a nucleic acid sequence encoding a polypeptide of interest, operably linked to the promoter. In some embodiments, the polypeptide of interest comprises an affinity tag for purification. In some embodiments, the polypeptide of interest comprises a fluorescent protein.

(66) i) Fluorescent Protein

(67) In some embodiments, the vector comprises a polynucleotide encoding a fluorescent protein. The polypeptide of interest may comprise a fluorescent protein. A fluorescent protein may be in addition to the polypeptide of interest. The vector may encode a fusion protein comprising a protein of interest and a fluorescent protein. The polynucleotide encoding a fluorescent protein may be operably linked to the promoter and to the polypeptide of interest.

(68) Fluorescent proteins include, for example, Aequorea-derived proteins such as Green Fluorescent Protein (GFP), Enhanced Green Fluorescent Protein (EGFP), Yellow Fluorescent Protein (YFP), and Cyan Fluorescent Protein (CFP), as well as proteins derived from coral species including, but not limited to, Discosoma and Trachyphyllia geoffroyi. Other proteins having fluorescent or other signaling properties can also be used. Specific examples of fluorescent proteins (and their encoding nucleic acids) are well known in the art including, without limitation, those reported as Genbank Accession Nos. AB195239, DD431502-DD431504, DD420089-DD420091, AY013821, AY013824-AY013827, EF064258-EF064259, AF435-427-AF435-434, DQ092360-DQ092365, DQ525024-DQ525025, X83959-X83960, AY533296, AB041904, X96418, BD136947-BD136949, U73901, AX250563-AX250571, AF302837, AF183395, AF058694-AF058695, U50963, L29345, M62653-M62654, DQ301560, AY679106-AY679108, AY678264-AY678271, AF168419-AF168420, AF272711, AY786536-AY786537, AF545828, AF506025-AF506027, AF420593, BAC20344, BD440518-BD440519, and AB085641, each of which is hereby incorporated by reference in its entirety. In some embodiments, the fluorescent protein comprises GFP. In some embodiments, the fluorescent protein comprises EGFP. EGFP may comprise a polypeptide having an amino acid sequence of SEQ ID NO: 8. EGFP may comprise a polypeptide encoded by a polynucleotide sequence of SEQ ID NO: 9.

4. Transfection

(69) Further provided herein is an amoeba transfected with an expression vector as detailed herein. In some embodiments, the amoeba transfected with an expression vector as detailed herein has reduced virulence compared to a control amoeba. The control may be an untransformed amoeba or an amoeba transformed with a different vector.

(70) An amoeba may be transfected with an expression vector as detailed herein according to any suitable means known by those of skill in the art. In some embodiments, an amoeba may be transfected with an expression vector by electroporation.

(71) Host cells which are transfected with the vector as detailed herein can be screened using conventional techniques. For example, when the gene to be expressed is a gene which confers resistance to a particular antibiotic, screening can be accomplished by gradually or immediately increasing the concentration of that particular antibiotic. Confirmation that gene knockout or gene complementation has occurred can be obtained by Southern blots of restriction enzyme-digested DNA from the transformed amoeba.

(72) Further provided herein is an amoeba transfected with an expression vector as detailed herein. In some embodiments, the transfected amoeba is less virulent than the wild-type amoeba.

5. Vaccine

(73) Further provided herein is a vaccine comprising an amoeba transfected with an expression vector as detailed herein. A transformed or transfected amoeba may be used to generate vaccines against amoeba-mediated diseases. If the transformed amoeba is less virulent than wild-type, the transformed microorganisms can be used as modified forms. Conventional techniques can be used to generate live vaccines using the modified forms of the amoeba. Alternatively, the transformed amoeba can be destroyed and used to formulate killed vaccines using conventional techniques. In yet another embodiment, polypeptides or fragments thereof from the transformed amoeba can be isolated and formulated into synthetic vaccines using conventional techniques. The vaccine may be administered to a subject to treat or prevent a disease.

6. Methods

(74) a. Methods of Expressing a Foreign Protein in an Amoeba

(75) Provided herein are methods of expressing a polypeptide of interest in an amoeba. The method may include transforming an amoeba with the expression vector detailed herein, isolating the transformed amoeba, and expressing the polypeptide of interest in the amoeba. The polypeptide of interest may be a foreign protein. The polypeptide of interest may comprise the foreign protein.

(76) In some embodiments, the transforming is performed by electroporation. In some embodiments, the isolating comprises culturing the amoeba in the presence of the antibiotic of the antibiotic resistance gene, such as hygromycin, puromycin, nourseothricin, or bleomycin, or a combination thereof. The polypeptide of interest may be expressed during culturing of the amoeba. The polypeptide of interest may be expressed from a constitutive promoter. The polypeptide of interest may be expressed during culturing of the amoeba and independent of the influence of regulation. The polypeptide of interest may be expressed from a regulatable promoter. The regulatable promoter may be inducible. Transcription of the polynucleotide encoding the polypeptide of interest may be initiated in response to addition of an inducing agent at any time point to the culture media. The inducing agent may be specific for the inducible promoter. The inducing agent may be added to the culture at the beginning of culturing the amoeba, after 1 hour, after 2 hours, after 3 hours, after 4 hours, after 5 hours, after 12 hours, after 24 hours, after 2 days, after 3 days, after 4 days, after 1 week, or after 3 weeks of culturing the amoeba.

(77) b. Methods of Manipulating an Amoeba Genome

(78) Provided herein are methods of manipulating an amoeba genome. The method may include transforming the amoeba with the expression vector detailed herein, isolating the transformed amoeba, and expressing the polypeptide of interest in the amoeba. The polypeptide of interest may be a foreign protein. The polypeptide of interest may comprise the foreign protein.

(79) In some embodiments, the transforming is performed by electroporation. In some embodiments, the isolating comprises culturing the amoeba in the presence of the antibiotic of the antibiotic resistance gene, such as hygromycin, puromycin, nourseothricin, or bleomycin, or a combination thereof. The polypeptide of interest may be expressed during culturing of the amoeba. The polypeptide of interest may be expressed from a constitutive promoter. The polypeptide of interest may be expressed during culturing of the amoeba and independent of the influence of regulation. The polypeptide of interest may be expressed from a regulatable promoter. The regulatable promoter may be inducible. Transcription of the polynucleotide encoding the polypeptide of interest may be initiated in response to addition of an inducing agent at any time point to the culture media. The inducing agent may be specific for the inducible promoter. The inducing agent may be added to the culture at the beginning of culturing the amoeba, after 1 hour, after 2 hours, after 3 hours, after 4 hours, after 5 hours, after 12 hours, after 24 hours, after 2 days, after 3 days, after 4 days, after 1 week, or after 3 weeks of culturing the amoeba.

7. Examples

Example 1

Screening of Selection Markers

(80) Preliminary experiments revealed that N. fowleri has natural resistance to neomycin. Five different selection markers were screened for their suitability to use in an N. fowleri transfection system. MTS viability assays in N. fowleri revealed IC.sub.50 values of neomycin for 681 pg/m L, 1.4 pg/mL for hygromycin, 0.6 pg/mL for puromycin, 0.5 pg/mL for bleomycin, and 27 pg/mL for nourseothricin (TABLE 1 and FIG. 1). The results indicated that hygromycin, puromycin, bleomycin, and nourseothricin would be suitable independent selection markers for N. fowleri. Hygromycin was used in subsequent studies as the selectable marker, partly due to its easy use in other eukaryotic transfection systems.

(81) TABLE-US-00001 TABLE 1 Results from MTS viability assays in N. fowleri. Neo Hyg Puro Ble Nst IC.sub.50 Value 681.1 1.38 0.58 0.49 26.5 IC.sub.90 Value 2385.3 5.59 1.49 1.62 165.4 IC.sub.95 Value 3078.4 7.31 1.91 2.10 218.7

Example 2

Generation of a Naegleria-Specific Transfection Vector

(82) A Naegleria-specific transfection vector was engineered using the pEGFP-N3 mammalian vector (Clontech, Mountain View, Calif.; catalog number 6080-1; FIG. 5; SEQ ID NO: 1) as a backbone. The CMV promoter was replaced with the N. fowleri actin (ACT1) promoter (SEQ ID NO: 4) immediately upstream of the multiple cloning site (MCS; SEQ ID NO: 2; 591-665 nt of SEQ ID NO: 1) (FIG. 2A). This orientation of elements would also facilitate the expression of EGFP-tagged proteins. The hygromycin resistance gene (SEQ ID NO: 6) was also introduced into the vector. The hygromycin resistance gene (Hyg.sup.R; SEQ ID NO: 6) was flanked by the promoter region (SEQ ID NO: 4) and polyadenylation site (SEQ ID NO: 5) of the constitutively expressed N. fowleri beta-actin gene. The N. fowleri beta-actin ACT1 promoter (SEQ ID NO: 4) includes a TATA box motif (TATA (A/T) A (A/T) (A/G)) and six CAAT box motifs (e.g., CCAAT and ATTGG) for transcriptional regulation. The consensus motifs are underlined and the transcription start site is indicated in FIG. 2B, as identified from mRNA sequence analysis. The ACT1 3 untranslated region of the poly(A) site (SEQ ID NO: 5) that contains the poly(A) signal motif (AATAAA, underlined, yellow) and the poly(A) site (TA, underlined, red) was identified from mRNA sequence analysis. The ACT1 3 untranslated region of the poly(A) site (SEQ ID NO: 5) is followed by a GT-rich downstream element (underlined, teal; SEQ ID NO: 10) to enhance polyadenylation, as identified from gDNA sequence analysis. The result was the novel pNfEGFP-Hyg transfection vector (SEQ ID NO: 7; FIG. 2B).

Example 3

Quantification of EGFP Expression in Naegleria

(83) N. fowleri amoebae were transfected with the pNfEGFP-Hyg vector (detailed in Example 2) by electroporation. Transfection was performed by electroporation (BioRad GenePulser Xcell with 500 pF, 200V and ohm electroporation conditions). Transfectants were selected by growing in the presence of 20 to 40 g/mL hygromycin.

(84) Transfectants were grown for 4 weeks or 12 weeks in 40 g/mL hygromycin. Total DNA was isolated from the Naegleria. Quantitative PCR was used to measure the presence of EGFP DNA and hence demonstrated continuous expression of pNfEGFPHyg vector DNA in N. fowleri transfectants (FIG. 3). Untransfected amebae served as control. N. fowleri actin gene was used as internal standard.

(85) Expression of enhanced green fluorescence protein (EGFP) in transfected amoebae after 10 weeks of hygromycin selection (40 g/mL) was examined with microscopy. The results confirmed the quantitative PCR results and demonstrated stable expression of EGFP from the pNfEGFP-Hyg vector in transfected Naegleria. Results are shown in FIG. 4. The top two images of FIG. 4 are with phase contrast light microscopy. The bottom two images of FIG. 4 are the corresponding EGFP fluorescence microscopy images of live amoebae. EGFP protein by itself, without tagging to another protein of interest (which the multiple cloning site of pNfEGFPHyg permits as an option) was concentrated in digestive vacuoles of the live amoebae.

(86) The foregoing description of the specific aspects will so fully reveal the general nature of the invention that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific aspects, without undue experimentation, without departing from the general concept of the present disclosure. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed aspects, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.

(87) The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary aspects, but should be defined only in accordance with the following claims and their equivalents.

(88) All publications, patents, patent applications, and/or other documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, and/or other document were individually indicated to be incorporated by reference for all purposes.

(89) For reasons of completeness, various aspects of the invention are set out in the following numbered clauses:

(90) Clause 1. An expression vector comprising: a promoter from a protein-encoding gene from an amoeba; a selection marker selected from hygromycin resistance gene, puromycin resistance gene, nourseothricin resistance gene, and bleomycin resistance gene; and a nucleic acid sequence encoding a polypeptide of interest, operably linked to the promoter.

(91) Clause 2. The vector of clause 1, wherein the amoeba is N. fowleri.

(92) Clause 3. The vector of clause 1 or 2, wherein the promoter is from the ACT1 gene from N. fowleri.

(93) Clause 4. The vector of clause 3, wherein the promoter comprises a polynucleotide sequence of SEQ ID NO: 4.

(94) Clause 5. The vector of any one of clauses 1-4, wherein the vector further comprises a poly(A) site, operably linked to the promoter.

(95) Clause 6. The vector of clause 5, wherein the poly(A) site comprises a polynucleotide sequence of SEQ ID NO: 5.

(96) Clause 7. The vector of any one of clauses 5-7, wherein the selection marker is positioned downstream of the promoter and upstream of the poly(A) site.

(97) Clause 8. The vector of any one of clauses 1-7, wherein the selection marker comprises the hygromycin resistance gene.

(98) Clause 9. The vector of clause 8, wherein the hygromycin resistance gene comprises a polynucleotide sequence of SEQ ID NO: 6.

(99) Clause 10. The vector of any one of clauses 1-9, wherein the vector does not include a cytomegalovirus (CMV) promoter.

(100) Clause 11. The vector of any one of clauses 1-10, wherein the vector further comprises a multiple cloning site (MCS), and wherein the promoter is upstream of the MCS.

(101) Clause 12. The vector of clause 11, wherein the promoter, poly(A) site, and selection marker are upstream of the MCS.

(102) Clause 13. The vector of any one of clauses 11-12, wherein the MCS comprises a polynucleotide sequence of SEQ ID NO: 3.

(103) Clause 14. The vector of any one of clauses 1-13, wherein the vector further comprises a polynucleotide encoding a fluorescent protein.

(104) Clause 15. The vector of clause 14, wherein the polynucleotide encoding a fluorescent protein is operably linked to the promoter and to the polypeptide of interest.

(105) Clause 16. The vector of any one of clauses 1-15, wherein the vector comprises a polynucleotide sequence of SEQ ID NO: 7.

(106) Clause 17. An amoeba transformed with the vector of any one of clauses 1-16.

(107) Clause 18. The amoeba of clause 17, wherein the amoeba has reduced virulence compared to a control amoeba.

(108) Clause 19. The amoeba of clause 18, wherein the control comprises an untransformed amoeba or an amoeba transformed with a different vector.

(109) Clause 20. A vaccine comprising the amoeba of any one of clauses 17-19.

(110) Clause 21. A method of expressing a foreign protein in an amoeba, the method comprising: transforming an amoeba with the vector of any one of clauses 1-16, wherein the polypeptide of interest comprises the foreign protein; isolating the transformed amoeba; and expressing the foreign protein in the amoeba.

(111) Clause 22. A method of manipulating an amoeba genome, the method comprising: transforming the amoeba with the vector of any one of clauses 1-16; isolating the transformed amoeba; and expressing the polypeptide of interest in the amoeba.

(112) Clause 23. The method of clause 21 or 22, wherein the transforming is performed by electroporation.

(113) Clause 24. The method of any one of clauses 21-23, wherein the isolating comprises culturing the amoeba in the presence of hygromycin, puromycin, nourseothricin, or bleomycin, or a combination thereof.

(114) TABLE-US-00002 SEQUENCES pEGFP-N3mammalianvector(4729nt) SEQIDNO:1 TAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAG TTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACC CCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGAC TTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTA CATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAAT GGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCA GTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTAC ATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCA TTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATG TCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAG GTCTATATAAGCAGAGCTGGTTTAGTGAACCGTCAGATCCGCTAGCGCTACCGGA CTCAGATCTCGAGCTCAAGCTTCGAATTCTGCAGTCGACGGTACCGCGGGCCCGG GATCCATCGCCACCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCC CATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGC GAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCA CCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGT GCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCC GCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCA ACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCAT CGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTG GAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACG GCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCT CGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCC GACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGC GCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCAT GGACGAGCTGTACAAGTAAAGCGGCCGCGACTCTAGATCATAATCAGCCATACCA CATTTGTAGAGGTTTTACTTGCTTTAAAAAACCTCCCACACCTCCCCCTGAACCT GAAACATAAAATGAATGCAATTGTTGTTGTTAACTTGTTTATTGCAGCTTATAAT GGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCAC TGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTAAGGCGTAAATTG TAAGCGTTAATATTTTGTTAAAATTCGCGTTAAATTTTTGTTAAATCAGCTCATT TTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACC GAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACG TGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACG TGAACCATCACCCTAATCAAGTTTTTTGGGGTCGAGGTGCCGTAAAGCACTAAAT CGGAACCCTAAAGGGAGCCCCCGATTTAGAGCTTGACGGGGAAAGCCGGCGAACG TGGCGAGAAAGGAAGGGAAGAAAGCGAAAGGAGCGGGCGCTAGGGCGCTGGCAAG TGTAGCGGTCACGCTGCGCGTAACCACCACACCCGCCGCGCTTAATGCGCCGCTA CAGGGCGCGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTT TATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATA AATGCTTCAATAATATTGAAAAAGGAAGAGTCCTGAGGCGGAAAGAACCAGCTGT GGAATGTGTGTCAGTTAGGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAG TATGCAAAGCATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGC TCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAG TCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACTCCGCCCAGTTCCGCCCATTC TCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCCGCCTCG GCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTT GCAAAGATCGATCAAGAGACAGGATGAGGATCGTTTCGCATGATTGAACAAGATG GATTGCACGCAGGTTCTCCGGCCGCTTGGGTGGAGAGGCTATTCGGCTATGACTG GGCACAACAGACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAG GGGCGCCCGGTTCTTTTTGTCAAGACCGACCTGTCCGGTGCCCTGAATGAACTGC AAGACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCGTTCCTTGCGCAGC TGTGCTCGACGTTGTCACTGAAGCGGGAAGGGACTGGCTGCTATTGGGCGAAGTG CCGGGGCAGGATCTCCTGTCATCTCACCTTGCTCCTGCCGAGAAAGTATCCATCA TGGCTGATGCAATGCGGCGGCTGCATACGCTTGATCCGGCTACCTGCCCATTCGA CCACCAAGCGAAACATCGCATCGAGCGAGCACGTACTCGGATGGAAGCCGGTCTT GTCGATCAGGATGATCTGGACGAAGAGCATCAGGGGCTCGCGCCAGCCGAACTGT TCGCCAGGCTCAAGGCGAGCATGCCCGACGGCGAGGATCTCGTCGTGACCCATGG CGATGCCTGCTTGCCGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATC GACTGTGGCCGGCTGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCC GTGATATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTA CGGTATCGCCGCTCCCGATTCGCAGCGCATCGCCTTCTATCGCCTTCTTGACGAG TTCTTCTGAGCGGGACTCTGGGGTTCGAAATGACCGACCAAGCGACGCCCAACCT GCCATCACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGA ATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGG AGTTCTTCGCCCACCCTAGGGGGAGGCTAACTGAAACACGGAAGGAGACAATACC GGAAGGAACCCGCGCTATGACGGCAATAAAAAGACAGAATAAAACGCACGGTGTT GGGTCGTTTGTTCATAAACGCGGGGTTCGGTCCCAGGGCTGGCACTCTGTCGATA CCCCACCGAGACCCCATTGGGGCCAATACGCCCGCGTTTCTTCCTTTTCCCCACC CCACCCCCCAAGTTCGGGTGAAGGCCCAGGGCTCGCAGCCAACGTCGGGGCGGCA GGCCCTGCCATAGCCTCAGGTTACTCATATATACTTTAGATTGATTTAAAACTTC ATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAA AATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATC AAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAA AAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCT TTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTA GTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACC TCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCT TACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGA ACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGA GATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGC GGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTT CCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGAC TTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGC CAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATG TTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCATGCAT Multiplecloningsite(MCS)ofpEGFP-N3vector(from591-665 ntoftheplasmid,75nt) SEQIDNO:2 GCTAGCGCTACCGGACTCAGATCTCGAGCTCAAGCTTCGAATTCTGCAGT CGACGGTACCGCGGGCCCGGGATCC Multiplecloningsite(MCS)ofpNfEGFP-Hygvector(44nt) SEQIDNO:3 AAGCTTCGAATTCTGCAGTCGACGGTACCGCGGGCCCGGGATCC promoterfromtheACT1geneinN.fowleriusedin pNfEGFP-Hygvector(335nt) SEQIDNO:4 CAAGCCTCATTCTTGAAGTTGTCAATTTGAAAGGGAGAAATTGTTGGCAT TTACAGTAAGACACTTGCTTTCTTTGAGGATGATCAGACATCTCTCAGAA ATGCACACCTTTCATCAAGTGAATGACAATTTCATTGGGAAGGCAACTTT CATTTATGGTTTGGGTCATCATCCATCACTATCAAGTTTACAATACATCA AAAATATCATTGGTTTGTTGAAGGTCCAGCAACACGTCACACCAAATCTT TAAATTTTTTCAATAATTATTAACAGCATTCTTTCACACAAACAAAAAAC TCAACAACAACTTCCTCTCCAACAAGAACAACAAA poly(A)siteofpNfEGFP-Hygvector(100nt) SEQIDNO:5 ATTGACCTTGGATGCACATTATCAAATTCCATTGTAATAAAACATAAAAT CTATGTAAAATCATGCATGAGTTGTGTCTTTGTAAAATTGATTTGTAGTC hygromycinresistancegene,includingATGstartcodonand TAGstopcodon(1026nt) SEQIDNO:6 ATGAAAAAGCCTGAACTCACCGCGACGTCTGTCGAGAAGTTTCTGATCGAAAAGT TCGACAGCGTCTCCGACCTGATGCAGCTCTCGGAGGGCGAAGAATCTCGTGCTTT CAGCTTCGATGTAGGAGGGCGTGGATATGTCCTGCGGGTAAATAGCTGCGCCGAT GGTTTCTACAAAGATCGTTATGTTTATCGGCACTTTGCATCGGCCGCGCTCCCGA TTCCGGAAGTGCTTGACATTGGGGAATTCAGCGAGAGCCTGACCTATTGCATCTC CCGCCGTGCACAGGGTGTCACGTTGCAAGACCTGCCTGAAACCGAACTGCCCGCT GTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGATCGCTGCGGCCGATCTTAGCC AGACGAGCGGGTTCGGCCCATTCGGACCGCAAGGAATCGGTCAATACACTACATG GCGTGATTTCATATGCGCGATTGCTGATCCCCATGTGTATCACTGGCAAACTGTG ATGGACGACACCGTCAGTGCGTCCGTCGCGCAGGCTCTCGATGAGCTGATGCTTT GGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGTGCACGCGGATTTCGGCTCCAA CAATGTCCTGACGGACAATGGCCGCATAACAGCGGTCATTGACTGGAGCGAGGCG ATGTTCGGGGATTCCCAATACGAGGTCGCCAACATCTTCTTCTGGAGGCCGTGGT TGGCTTGTATGGAGCAGCAGACGCGCTACTTCGAGCGGAGGCATCCGGAGCTTGC AGGATCGCCGCGGCTCCGGGCGTATATGCTCCGCATTGGTCTTGACCAACTCTAT CAGAGCTTGGTTGACGGCAATTTCGATGATGCAGCTTGGGCGCAGGGTCGATGCG ACGCAATCGTCCGATCCGGAGCCGGGACTGTCGGGCGTACACAAATCGCCCGCAG AAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAAGTACTCGCCGATAGTGGAAAC CGACGCCCCAGCACTCGTCCGAGGGCAAAGGAATAG pNfEGFP-Hygvector(5918bp) SEQIDNO:7 TAGTTATTATGCAAGCCTCATTCTTGAAGTTGTCAATTTGAAAGGGAGAAATTGT TGGCATTTACAGTAAGACACTTGCTTTCTTTGAGGATGATCAGACATCTCTCAGA AATGCACACCTTTCATCAAGTGAATGACAATTTCATTGGGAAGGCAACTTTCATT TATGGTTTGGGTCATCATCCATCACTATCAAGTTTACAATACATCAAAAATATCA TTGGTTTGTTGAAGGTCCAGCAACACGTCACACCAAATCTTTAAATTTTTTCAAT AATTATTAACAGCATTCTTTCACACAAACAAAAAACTCAACAACAACTTCCTCTC CAACAAGAACAACAAAGATCTATGAAAAAGCCTGAACTCACCGCGACGTCTGTCG AGAAGTTTCTGATCGAAAAGTTCGACAGCGTCTCCGACCTGATGCAGCTCTCGGA GGGCGAAGAATCTCGTGCTTTCAGCTTCGATGTAGGAGGGCGTGGATATGTCCTG CGGGTAAATAGCTGCGCCGATGGTTTCTACAAAGATCGTTATGTTTATCGGCACT TTGCATCGGCCGCGCTCCCGATTCCGGAAGTGCTTGACATTGGGGAATTCAGCGA GAGCCTGACCTATTGCATCTCCCGCCGTGCACAGGGTGTCACGTTGCAAGACCTG CCTGAAACCGAACTGCCCGCTGTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGA TCGCTGCGGCCGATCTTAGCCAGACGAGCGGGTTCGGCCCATTCGGACCGCAAGG AATCGGTCAATACACTACATGGCGTGATTTCATATGCGCGATTGCTGATCCCCAT GTGTATCACTGGCAAACTGTGATGGACGACACCGTCAGTGCGTCCGTCGCGCAGG CTCTCGATGAGCTGATGCTTTGGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGT GCACGCGGATTTCGGCTCCAACAATGTCCTGACGGACAATGGCCGCATAACAGCG GTCATTGACTGGAGCGAGGCGATGTTCGGGGATTCCCAATACGAGGTCGCCAACA TCTTCTTCTGGAGGCCGTGGTTGGCTTGTATGGAGCAGCAGACGCGCTACTTCGA GCGGAGGCATCCGGAGCTTGCAGGATCGCCGCGGCTCCGGGCGTATATGCTCCGC ATTGGTCTTGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTCGATGATGCAG CTTGGGCGCAGGGTCGATGCGACGCAATCGTCCGATCCGGAGCCGGGACTGTCGG GCGTACACAAATCGCCCGCAGAAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAA GTACTCGCCGATAGTGGAAACCGACGCCCCAGCACTCGTCCGAGGGCAAAGGAAT AGATTGACCTTGGATGCACATTATCAAATTCCATTGTAATAAAACATAAAATCTA TGTAAAATCATGCATGAGTTGTGTCTTTGTAAAATTGATTTGTAGTCCAAGCCTC ATTCTTGAAGTTGTCAATTTGAAAGGGAGAAATTGTTGGCATTTACAGTAAGACA CTTGCTTTCTTTGAGGATGATCAGACATCTCTCAGAAATGCACACCTTTCATCAA GTGAATGACAATTTCATTGGGAAGGCAACTTTCATTTATGGTTTGGGTCATCATC CATCACTATCAAGTTTACAATACATCAAAAATATCATTGGTTTGTTGAAGGTCCA GCAACACGTCACACCAAATCTTTAAATTTTTTCAATAATTATTAACAGCATTCTT TCACACAAACAAAAAACTCAACAACAACTTCCTCTCCAACAAGAACAACAAAGCT TCGAATTCTGCAGTCGACGGTACCGCGGGCCCGGGATCCATCGCCACCATGGTGA GCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGG CGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACC TACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCT GGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCC CGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTC CAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGG TGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTT CAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCAC AACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGA TCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAA CACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACC CAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGG AGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAAAG CGGCCGCGACTCTAGATCATAATCAGCCATACCACATTTGTAGAGGTTTTACTTG CTTTAAAAAACCTCCCACACCTCCCCCTGAACCTGAAACATAAAATGAATGCAAT TGTTGTTGTTAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGC ATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGT CCAAACTCATCAATGTATCTTAAGGCGTAAATTGTAAGCGTTAATATTTTGTTAA AATTCGCGTTAAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAAT CGGCAAAATCCCTTATAAATCAAAAGAATAGACCGAGATAGGGTTGAGTGTTGTT CCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGC GAAAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCATCACCCTAATCAAG TTTTTTGGGGTCGAGGTGCCGTAAAGCACTAAATCGGAACCCTAAAGGGAGCCCC CGATTTAGAGCTTGACGGGGAAAGCCGGCGAACGTGGCGAGAAAGGAAGGGAAGA AAGCGAAAGGAGCGGGCGCTAGGGCGCTGGCAAGTGTAGCGGTCACGCTGCGCGT AACCACCACACCCGCCGCGCTTAATGCGCCGCTACAGGGCGCGTCAGGTGGCACT TTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAA ATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAA AAGGAAGAGTCCTGAGGCGGAAAGAACCAGCTGTGGAATGTGTGTCAGTTAGGGT GTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAA TTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATG CAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCA TCCCGCCCCTAACTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAAT TTTTTTTATTTATGCAGAGGCCGAGGCCGCCTCGGCCTCTGAGCTATTCCAGAAG TAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAAGATCGATCAAGAGACA GGATGAGGATCGTTTCGCATGATTGAACAAGATGGATTGCACGCAGGTTCTCCGG CCGCTTGGGTGGAGAGGCTATTCGGCTATGACTGGGCACAACAGACAATCGGCTG CTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAGGGGCGCCCGGTTCTTTTTGTC AAGACCGACCTGTCCGGTGCCCTGAATGAACTGCAAGACGAGGCAGCGCGGCTAT CGTGGCTGGCCACGACGGGCGTTCCTTGCGCAGCTGTGCTCGACGTTGTCACTGA AGCGGGAAGGGACTGGCTGCTATTGGGCGAAGTGCCGGGGCAGGATCTCCTGTCA TCTCACCTTGCTCCTGCCGAGAAAGTATCCATCATGGCTGATGCAATGCGGCGGC TGCATACGCTTGATCCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCAT CGAGCGAGCACGTACTCGGATGGAAGCCGGTCTTGTCGATCAGGATGATCTGGAC GAAGAGCATCAGGGGCTCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGCGAGCA TGCCCGACGGCGAGGATCTCGTCGTGACCCATGGCGATGCCTGCTTGCCGAATAT CATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGTGGCCGGCTGGGTGTG GCGGACCGCTATCAGGACATAGCGTTGGCTACCCGTGATATTGCTGAAGAGCTTG GCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTACGGTATCGCCGCTCCCGATTC GCAGCGCATCGCCTTCTATCGCCTTCTTGACGAGTTCTTCTGAGCGGGACTCTGG GGTTCGAAATGACCGACCAAGCGACGCCCAACCTGCCATCACGAGATTTCGATTC CACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGC TGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCTAGGG GGAGGCTAACTGAAACACGGAAGGAGACAATACCGGAAGGAACCCGCGCTATGAC GGCAATAAAAAGACAGAATAAAACGCACGGTGTTGGGTCGTTTGTTCATAAACGC GGGGTTCGGTCCCAGGGCTGGCACTCTGTCGATACCCCACCGAGACCCCATTGGG GCCAATACGCCCGCGTTTCTTCCTTTTCCCCACCCCACCCCCCAAGTTCGGGTGA AGGCCCAGGGCTCGCAGCCAACGTCGGGGCGGCAGGCCCTGCCATAGCCTCAGGT TACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCT AGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTC GTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCT TTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGG TGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTT CAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCAC CACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTAC CAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACG ATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAG CCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTAT GAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGG CAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTAT CTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGAT GCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACG GTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCT GATTCTGTGGATAACCGTATTACCGCCATGCAT EGFP(241aminoacids) SEQIDNO:8 msrvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfi cttgklpvpwptlvttltygvqcfsrypdhmkqhdffksampegyvqert iffkddgnyktraevkfegdtlvnrielkgidfkedgnilghkleynyns hnvyimadkqkngikvnfkirhniedgsvqladhyqqntpigdgpvllpd nhylstqsalskdpnekrdhmvllefvtaagitlgmdelyk EGFP(1150nt) SEQIDNO:9 ATGTCTAGAGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCAT CCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCG GCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATC TGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCT GACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGC ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGGTAGAT TTATGCATCCTCTTGTCATGAGAAGTCGAATTGTTCCCATTCTGTGTGTT GCAGCTACAGATGGAGATACATAGAGATACTCGTGGATTTTGCTTAGTGT TGAGTTTTGTTCTGGTTGTGAACTAAAAGTTTATACATTTGCAGGAAATA AATAGCCTTTTGTTTAAATCAAAAGGTCTTACCTATGTTAGTGTGAAGCA TTGGATCCCAAAGAACTCCAAAATGCGATGAGGCATATTTAATCTTGTCT GGACTAGTAACAGGTTGGGATGACCACCTGTGAAGCTCCAACAGGATTGC CTCCTCACGCAATGTTTGAGGTCTGATGTTCAATAGCTTGTTTTGTTTCA CTTTGCTTTGGACTTTCTTTTCGCCAATGAGCTATGTTTCTGATGGTTTT CACTCTTTTGGTGTGTAGAGAACCATCTTCTTCAAGGACGACGGCAACTA CAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCA TCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCAC AAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAA GCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGG ACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGC GACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGC CCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGT TCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA GT-richdomain(30nt) SEQIDNO:10 GTTGTGTCTTTGTAAAATTGATTTGTAGTC