PD-1 CAR-T CELL, PREPARATION METHOD THEREFOR, AND APPLICATION THEREOF

20190117691 ยท 2019-04-25

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are a PD-1 CAR-T cell, a preparation method thereof, and an application thereof. By means of chimeric antigen receptor-modified T cell transformation, PD-1-CD8?-4-1BB-CD3? molecules are expressed in a T cell. The CAR-T cell prepared by the method can specifically recognize and bind with tumor cells with high PDL-1 protein expression, and is applicable to preparation of a drug for preventing and treating tumor diseases.

Claims

1-9. (canceled)

10. A PD-1 CAR-T cell expressing a PD-1-CD8-4-1 BB-CD3? fusion protein, wherein the PD-1 portion of the fusion protein is expressed on a surface of the CAR-T cell and the 4-1 BB-CD3? portion of the fusion protein is expressed inside the CAR-T cell.

11. The PD-1 CAR-T cell of claim 10, wherein the amino acid sequence of PD-1 in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:5; and the amino acid sequence of CD8 in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:1.

12. The PD-1 CAR-T cell of claim 10, wherein the amino acid sequence of 4-1BB in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:2; wherein the 4-1BB in the PD-1-CD8-4-1 BB-CD3? fusion protein can be replaced by CD28 that has the amino acid sequence of SEQ ID NO:3.

13. The PD-1 CAR-T cell of claim 10, wherein the amino acid sequence of CD3? in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:4.

14. The PD-1 CAR-T cell of claim 10, wherein the amino acid sequence of the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:6.

15. The PD-1 CAR-T cell of claim 10, wherein the T cell is derived from human periphery blood T lymphocytes.

16. A method of making a PD-1 CAR-T cell, comprising: (1) cloning a gene encoding a PD-1-CD8-4-1 BB-CD3? fusion protein into a lentiviral expression vector; (2) packaging and preparing a lentivirus by expressing lentiviral envelop plasmid and the lentiviral expression vector of step (1) in a 293 T cell; (3) isolating and expanding human peripheral blood T lymphocytes, and infecting the T lymphocytes with the lentivirus of step (2) to obtain the PD-1 CAR-T cells expressing the PD-1-CD8-4-1 BB-CD3? fusion protein; wherein the PD-1 portion of the fusion protein is expressed on a surface of the CAR-T cell and the 4-1 BB-CD3? portion of the fusion protein is expressed inside the CAR-T cell.

17. The method of claim 16, wherein the amino acid sequence of PD-1 in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:5; and the amino acid sequence of CD8 in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:1.

18. The method of claim 16, wherein the amino acid sequence of 4-1 BB in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:2; wherein the 4-1 BB in the PD-1-CD8-4-1BB-CD3? fusion protein can be replaced by CD28 that has the amino acid sequence of SEQ ID NO:3.

19. The method of claim 16, wherein the amino acid sequence of CD3? in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:4.

20. The method of claim 16, wherein the amino acid sequence of the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:6.

21. The method of claim 16, wherein the T cell is derived from human periphery blood T lymphocytes.

22. A method of treating tumor by administering to a patient a PD-1 CAR-T cell expressing a PD-1-CD8-4-1 BB-CD3? fusion protein; wherein the PD-1 portion of the fusion protein is expressed on a surface of the CAR-T cell and the 4-1 BB-CD3? portion of the fusion protein is expressed inside the CAR-T cell.

23. The method of claim 22, wherein the amino acid sequence of PD-1 in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:5; and the amino acid sequence of CD8 in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:1.

24. The method of claim 22, wherein the amino acid sequence of 4-1 BB in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:2; wherein the 4-1 BB in the PD-1-CD8-4-1BB-CD3? fusion protein can be replaced by CD28 that has the amino acid sequence of SEQ ID NO:3.

25. The method of claim 22, wherein the amino acid sequence of CD3? in the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:4.

26. The method of claim 22, wherein the amino acid sequence of the PD-1-CD8-4-1 BB-CD3? fusion protein is SEQ ID NO:6.

27. The method of claim 22, wherein the tumor is characterized with high expression level of PDL-1.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0020] In order to more clearly illustrate the technical solutions in the embodiments of the present invention, the drawings used in the description of the embodiments will be briefly described below. It is obvious that the figures in the following description are only some embodiments of the present invention. For a person of ordinary skilled in the art, other drawings can be obtained based on these figures without any creative work. The figures include:

[0021] FIG. 1 illustrates a map of a PRRLSIN-PD-1 lentiviral plasmid vector;

[0022] FIG. 2 illustrates a flow cytometry result of MCF7-PDL1 engineering cell line with high expression level of PD-L1;

[0023] FIG. 3 illustrates a flow cytometry result of the proportion of T cells two days after PBMC activation;

[0024] FIG. 4 illustrates a viral infection effect diagram after PD-1-CART was infected with different volumes of virus for 14 days;

[0025] FIG. 5 illustrates a result of the CAR-PD1 killing experiment in vitro: a diagram of different ratios of effect;

[0026] FIG. 6 illustrates a diagram of PD-1-CAR-T cell proliferation;

[0027] FIG. 7 illustrates a diagram of PD-1-CAR-T cells killing effect in vitro under different effect-target ratio conditions.

DETAILED DESCRIPTION OF THE INVENTION

[0028] The technical solutions in the embodiments of the present invention are clearly and completely described below. It is obvious that the described embodiments are only a part of the embodiments of the present invention, not all of the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by a person skilled in the art without any creative work is within the scope of the protection of the present invention.

Embodiment 1

Preparation of a Lentiviral Expression Vector

[0029] The gene encoding the PD1-CD8?-4-1BB-CD3? was synthesized, then the gene was ligated into the PRRSLIN vector by enzyme restriction and transformation, and the upstream of the gene is EP-1? promoter. The vector was transformed into Stbl3 Escherichia coli strain, and screened by ampicillin to obtain positive clones, then the plasmids were extracted and identified by restriction enzyme digestion, and PRRLSIN-PD-1 lentiviral transfection vector was obtained, the structure of which is as shown in FIG. 1.

Embodiment 2

Preparation of Lentivirus

[0030] (1) Twenty-four hours before transfection, seeding 293T cells into 15 cm culture dishes at a cell density of approximately 8?10.sup.6 cell per dish, which could ensure that the cells are at about 80% of confluence and distributed uniformly in the culture dish during transfection.
(2) Prepare solution A and solution B
Solution A: 6.25 ml of 2?HEPES buffer (using 5 large dishes that are packed together could achieve the best effects).
Solution B: adding the following plasmids, respectively, and mixing: 112.5 ?g of pRRLSIN-EF-ROBO1 (target plasmid); 39.5 ?g of pMD2.G (VSV-G envelop); 73 ?g of pCMVR8.74 (gag, pol, tat, rev); 625 ?l of 2M calcium ion solution. Total volume of solution A: 6.25 ml.

[0031] The solution B was mixed completely, and the solution A was added dropwise while the solution A was gently rocked, then let the solution sit for 5-15 minutes. The above mixed solution of A and B was gently rocked and added to the dish containing 293T cells dropwise, then the culture dish was gently shaken back and forth to distribute the mixture of DNA and calcium ions evenly. The culture dish was placed in an incubator to incubate for 16-18 hours (do not rotate the culture dish). Fresh medium was replaced and continued incubating, then the supernatant containing virus was collected after 48 hours and 72 hours, respectively. The supernatant containing virus was observed by fluorescence microscopy, more than 95% of the cells should show green fluorescence. The supernatant was centrifuged at 500 g for 10 minutes at 10? C., followed by being filtered with PES membrane (0.45 ?m). Beckman Coulter Ultra-clear SW28 centrifuge tubes were sterilized with 70% ethanol, and sterilized under UV light for 30 minutes. The filtered supernatant containing lentivirus was transferred to a centrifuge tube. A layer of 20% sucrose was carefully spread on the bottom of the centrifuge tube (1 ml of sucrose was added per 8 ml of supernatant). The centrifuge tube was equilibrated with PBS, and centrifuged at 25,000 rpm (82, 700 g) for 2 hours at 4? C. The centrifuge tube was taken out carefully, and the supernatant was poured off, followed by being inverted to remove residual liquid. 100 ?l of PBS was added in the centrifuge tube and sealed, then placed at 4? C. for 2 hours, gently rocked once per 20 minutes during the time, followed by being centrifuged for 1 minute (25? C.) at 500 g, and the virus supernatant was collected. After being cooled on ice, the virus supernatant was stored at ?80? C.

Embodiment 3

Preparation of PD-1 CAR-T Cells

[0032] 0.5 ml of blood was taken and tested for pathogenic microorganisms rapidly to exclude microbial infections such as HBV, HCV, HDV and HEV, HIV-1/2, treponema pallidum and parasites; 50 ml of blood was collected with heparin bottle (heparin anticoagulation) under sterile conditions, and immediately (4? C., within 24 hours) sent to the cell preparation laboratory to ensure that this process was free of pathogenic microbial contamination. After the patient's blood was obtained, the surface of the heparin bottle was wiped with an alcohol cotton ball for disinfection in the GMP preparation room, then the heparin bottle was placed in a biological safety cabinet. Two 50 ml centrifuge tubes were opened in advance, then the blood was transferred into the two 50 ml centrifuge tubes and tightened up. The above 50 ml centrifuge tubes filled with blood were placed in a centrifuge and centrifuged at 400 g (2000 rpm) for 10 min at room temperature, then the supernatant plasma was collected and the precipitate layer was removed after centrifugation. The collected autologous plasma was inactivated at 56? C. for 30 minutes. After being stood for 15 minutes at 4? C., the collected autologous plasma was centrifuged at 900 g for 30 min at 4? C. to take the supernatant for use. The enriched blood cells above were diluted to 30 ml/tube with physiological saline, and two new 50 ml centrifuge tubes were opened, then 15 ml of human lymphocyte separation liquid was added to each centrifuge tube. The diluted blood cell solution was slowly added to the centrifuge tube which contains the human lymphatic separation solution with a pipette, and tightened up. It is noted that the blood should be added to the upper layer of the lymphatic separation solution, and the interface of the human lymphatic separation solution should not be broken. The added blood cell solution was placed in a centrifuge which was adjusted to a minimum rate of rise-and-fall, then the added blood cell solution was centrifuged at 400 g (2000 rpm) for 20 min at room temperature. The middle white blood cell layer of two tubes was collected in a 15 ml sterile centrifuge tube, and 5 ml of physiological saline was added, and then washed twice (the collected middle white blood cell layer was centrifuged at 400 g for 10 minutes) to obtain peripheral blood mononuclear cells (PBMC). Complete growth medium was made, the concentration of V-VIVO15 added autologous AB (FBS) was 5%, the concentration of IL-2 was 40 ng/ml, and the isolated PBMC was diluted to 2?10.sup.6/ml with medium, then 50 ?l was taken, and the T cells purity of PBMC was detected by flow cytometer. On 0 day, Buffer1 was made that 1% FBS was added to PBS, the beads were rocked for 30 s or manually shaken up and down for 5 min CD3/CD28 beads were taken out according to the ratio of beads to T cells of 3-1, and the beads were put in 1.5 ml EP tube, followed by adding 1 ml buffer 1 to clean the beads. After that, the beads were suck from the EP tube for 1 min with magnet and washing solution was discarded, which was repeated twice, then the beads were re-suspended to the original volume with the medium, and the cells and beads were mixed, followed by being added in a suitable culture bottle in 2?10.sup.6 PBMC/ML. On the second day, the density of cells was adjusted to 3-5?10.sup.6/ml, and the virus vector was added in the proportion of virus vector:cell of 1:5, meanwhile, 4 ?g/ml and 40 ng/ml IL.sup.?2 of polybrene were added. Fresh complete medium was added after 4 hours, and the density of cells was adjusted to 1?10.sup.6/ml to continuous culture. All the cells were centrifuged, and fresh medium was added to continuous culture. Half a volume change was replaced per 2-3 days to maintain the density of the cell in 0.5-1?10.sup.6/ml. When the number of cells reached 10.sup.9 in the period of 10-12 days, the cells were centrifuged at 400 g for 5 min to get immune cells, followed by being washed twice with pre-cooled PBS (400 g, 5 min). The cells were count by hemocytometer, and the cell group and the proportion of CART cells were detected by flow cytometer. The color change, cell density, and cell morphology of the medium was observed daily and recorded accordingly. The interleukin 2 which is required by the total volume was added in the process of gradually expanding cultivation.

[0033] The results showed that the proportion of T cells detected by flow cytometry reached more than 80% (see FIG. 3) after two days of PBMC activation. After virus infection of T cells, the infection effects of PD-1-CART with different volumes virus at 14-day were detected. The results showed that 35.8% of the cells were successfully infected (FIG. 4) and PD-1-CART cells were prepared.

Embodiment 4

Construction and Detection of Engineering Cell Lines

[0034] (1) Preparation of lentivirus PD-L1 (The specific preparing method is as the method in the second embodiment);
(2) Infection of MCF cells: 500,000 MCF7 cells were inoculated in 6-well plates the day before infection. When the cells grow to 80% on the second day, 500 ?l of packaged PD-L1 virus was added in a 6-well plate, meanwhile, control cell (no virus added) was set, culture medium was changed after 12-16 hours, and then the positive cells of PD-L1 were sorted by flow cytometer 3 days after infection;
(3) Detection of engineered cell lines: 20,000 cells were taken from the sorted positive cells of PD-L1, followed by being centrifuged at 400 g for 5 min, then washed twice with pre-cooled PBS, and 2.5 ul of PD-L1 antibody (Biolegend) was added and incubated in the dark for 20 min, after that, centrifuged and washed once with pre-cooled PBS, then the cells was re-suspended with 100 ?l PBS, and the expression of PD-L1 was detected by flow cytometer, see FIG. 2. The experimental results confirmed that the engineered cell lines were successfully constructed, which can be used as a target cell for subsequent killing experiments.

Embodiment 5

Activity Assay of PD-1 CAR-T Cells In Vitro

[0035] ELISA was used to detect LDH release, which was to detect the killing effect of PD-1 CAR-T cells on MCF7-PD-L1 target cells.

(1) Adjusting the target cells to 5?10.sup.4/ml with RPMI-1640 medium containing 5% calf serum.
(2) Adding target cells to 96-well cell culture plates, and adding 100 ?l to each well. Three effector cells naturally released control wells were only added 100 ?l of culture solution without adding target cells.
(3) Adding 100 ?l of effector cells to each well, and the ratio of effector cells to target cells was 50:1; 25:1; 10:1; 5:1; or 1:1. Natural release wells were only added 100 ?l of culture medium without effector cells, and incubating the effector cells and the target cells for 6 hours. Meanwhile, setting up three replicate wells for each experiment.
(4) Adding 10 ?l Lysis Solution (10?) to the largest release well (positive control), and incubating for 45 min-60 min Meanwhile, placing three replicate wells each experiment.
(5) Taking out 50 ?l of the test sample and the control sample in the above 3 and 4 steps, respectively, and adding in the fresh 96-well microtiter plate, then adding the assay buffer and the substance mix, followed by being protected from light for 30 minutes.
(6) Adding 50 ?l stop solution.
(7) Measuring absorbance value at 490 nm or 492 nm in an hour.
(8) Killing rate=experimental group LDH (OD)/Max LDH release group (OD).
(9) Calculation formula: Killing efficiency=(experimental?effector spontaneous?target spontaneous)/(target maximum?target spontaneous)?100%.

[0036] The results showed that the prepared PD-1-CAR-T cells could significantly kill the target cell lines with high expression of PDL1, and the different proportions of PD-1 CAR-T and target cells (MCF7-PDL1) were co-incubated for 4 hours, followed by being detected by ELISA experiment. The result of ELISA experiment showed that the cell killing efficiency also increased (see FIG. 5), and microscopic imaging showed that tumor cells were obviously dead (FIG. 7) with the increasing of the E:T ratio. At the same time, different proportions of CAR-T cells were incubated with target cells (MCF7-PDL1) for 16 hours under the stimulation of the target cell strain, and the number of T cells was counted by MTT. The results showed that CAR-PD1 cells proliferated significantly with the increase of E:T ratio.

[0037] PD-1 CAR-T cells and their preparation methods can also be applied to the preparation of PD-1 CAR-NK cells, except that T cells are replaced with NK cells, and other molecular elements are unchanged.

TABLE-US-00001 Sequencelist: TheaminoacidsequenceofCD8? SEQIDNO:1is: IYIWAPLAGTCGVLLLSLVITLYC. Thesequenceof4-1BBSEQIDNO:2is: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL. ThesequenceofCD28SEQIDNO:3is: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS. ThemolecularsequenceofCD3? SEQIDNO:4is: RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR. ThesequenceofPD-1SEQIDNO:5is: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQTLV. TheaminoacidsequenceofPD-1-CD8?-4-1BB-CD3? fusionproteinSEQIDNO:6is: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQTLVIYIWAPLAGTCGVLLLSLVITLYCKRGRKK LLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYK QGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQK DKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR.