MODIFIED STEM CELL MEMORY T CELLS, METHODS OF MAKING AND METHODS OF USING SAME

20190119640 ยท 2019-04-25

    Inventors

    Cpc classification

    International classification

    Abstract

    The disclosure provides a method of producing modified stem memory T cells (e.g. CAR-T cells) for administration to a subject as, for example an adoptive cell therapy.

    Claims

    1.-304. (canceled)

    305. A composition comprising a plurality of modified early memory T-cells, wherein at least one modified early memory T cell of the plurality comprises a sequence encoding a non-naturally occurring antigen receptor, wherein one or more of a stem cell-like T cell, a stem cell memory T cell (T.sub.SCM) and a central memory T cell (T.sub.CM) comprise at least 10% of the plurality of modified early memory T-cells, and wherein at least 10% of the modified early memory T cells of the plurality express CD62L and CD45RA.

    306. The composition of claim 305, wherein at least 10% of the modified early memory T cells of the plurality express one or more of CD127, CD45RO, CD95 and IL-210.

    307. The composition of claim 305, wherein the non-naturally occurring antigen receptor is a non-naturally occurring T-Cell Receptor (TCR).

    308. The composition of claim 307, wherein the non-naturally occurring T-cell receptor comprises one or more mutation(s) compared to a wild-type TCR.

    309. The composition of claim 307, wherein the non-naturally occurring T-cell receptor is a recombinant TCR.

    310. The composition of claim 305, wherein the non-naturally occurring antigen receptor is a Chimeric Antigen Receptor (CAR).

    311. The composition of claim 310, wherein the CAR comprises (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises one or more sequences that each specifically bind an antigen; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain.

    312. The composition of claim 311, wherein the antigen recognition region comprises at least one of a single chain antibody (scFv), a VHH, an antibody mimetic, a protein scaffold and a Centyrin.

    313. The composition of claim 311, wherein the antigen recognition region comprises at least one single chain antibody (scFv).

    314. The composition of claim 311, wherein the antigen recognition region comprises at least one VHH.

    315. The composition of claim 311, wherein the antigen recognition region comprises at least one Centyrin.

    316. The composition of claim 305, wherein at least one modified early memory T cell of the plurality further comprises a genomic editing composition.

    317. The composition of claim 316, wherein the genomic editing composition comprises a sequence encoding a DNA binding domain and a sequence encoding a nuclease domain.

    318. The composition of claim 316, wherein at least one modified early memory T cell of the plurality further comprises a donor sequence composition.

    319. The composition of claim 318, wherein the donor sequence composition comprises a sequence encoding the non-naturally occurring antigen receptor.

    320. The composition of claim 319, wherein the sequence encoding the non-naturally occurring antigen receptor comprises a single-stranded or double-stranded DNA molecule.

    321. The composition of claim 318, wherein the donor sequence composition is inserted into a specific site in the genome contacted with the composition by homologous recombination or by endogenous DNA repair mechanisms.

    322. The composition of claim 305, wherein at least one modified early memory T cell of the plurality further comprises a transposon comprising a sequence encoding the non-naturally occurring antigen receptor.

    323. The composition of claim 322, wherein at least one modified early memory T cell of the plurality further comprises a transposase composition comprising a transposase or a sequence encoding the transposase.

    324. The composition of claim 323, wherein the transposase composition comprises a piggyBac transposase or a sequence encoding the piggyBac transposase.

    325. The composition of claim 305, wherein a genomic safe harbor site comprises a sequence encoding the non-naturally occurring antigen receptor.

    326. The composition of claim 305, wherein the composition further comprises a T-cell expansion composition.

    327. The composition of claim 326, wherein the composition or the T-cell expansion composition comprises one or more of octanoic acid, nicotinamide, 2,4,7,9-tetramethyl-5-decyn-4,7-diol (TMDD), diisopropyl adipate (DIPA), n-butyl-benzenesulfonamide, 1,2-benzenedicarboxylic acid, bis(2-methylpropyl) ester, palmitic acid, linoleic acid, oleic acid, stearic acid hydrazide, oleamide, a sterol and an alkane.

    328. The composition of claim 305, wherein at least 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of modified early memory T-cells of the plurality express CD62L and CD45RA.

    329. The composition of claim 305, wherein at least 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of modified early memory T-cells of the plurality express one or more of CD127, CD45RO, CD95 and IL-2R?.

    330. The composition of claim 305, wherein one or more of a stem cell-like T cell, a stem cell memory T cell (T.sub.SCM) and a central memory T cell (T.sub.CM) comprise at least 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified early memory T-cells.

    331. The composition of claim 305, wherein stem cell memory T cells (T.sub.SCMs) or T.sub.SCM-like cells comprise at least 1%, 2%, 5%, 7%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified early memory T-cells.

    332. The composition of claim 305, wherein central memory T cells (T.sub.CMs) comprise at least 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified early memory T-cells.

    333. The composition of claim 305, further comprising a T-cell activator composition comprising one or more of an anti-human CD3 monospecific tetrameric antibody complex, an anti-human CD28 monospecific tetrameric antibody complex and an anti-human CD2 monospecific tetrameric antibody complex.

    334. The composition of claim 333, comprising a plurality of activated and modified early memory T-cells.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0098] FIG. 1 is a series of plots depicting the emergence of the CAR-T.sub.SCM phenotype at Day 11 of the method of Example 1. Cells were nucleofected with a surrogate CARTyrin plasmid. CAR-T.sub.SCM cells express CD62L and CD45RA as shown in the bottom two plots.

    [0099] FIG. 2 is a series of plots depicting the purity of the CAR-T.sub.SCM produced by the method of Example 1 at day 19. The population of CAR-T.sub.SCM cells produced by the method described in Example 1 at day 19 contained no B cells or lymphocytes. The majority of the cells are CD3+ T-cells. Only 1.1% are Natural Killer cells and 1.7% are Natural Killer T-cells.

    [0100] FIG. 3 is a plot showing that at Day 11 of the method described in Example 1, the majority of the T-cells produced express the CARTyrin.

    [0101] FIG. 4 is a series of plots depicting an enrichment of the CAR-T.sub.SCM phenotype at Day 19 of the method described in Example 1. Cells were nucleofected with a surrogate CARTyrin plasmid. CAR-T.sub.SCM cells express CD62L and CD45RA as shown in the bottom two plots.

    [0102] FIG. 5 is a series of plots depicting the absence of T-cell exhaustion at Day 19 of the method described in Example 1. At Day 19, the cell population produced by this method does not express PD1, which is a marker for T cell activation and exhaustion. These cells expressing the CARTyrin have almost successfully reached a resting state post-manufacture. They do not exhibit signs of antigen-independent (tonic) signaling which would otherwise drive higher levels of PD1 expression. Tonic signaling is hypothesized to be caused by some CAR molecules that lead to early exhaustion and reduced efficacy of a CAR T-cell therapy.

    [0103] FIG. 6A is a series of plots depicting T cells transposed with a plasmid containing a sequence encoding a transposon comprising a sequence encoding an inducible caspase polypeptide (a safety switch, iC9), a CARTyrin (anti-BCMA), and a selectable marker. Left-hand plots depict live T cells exposed to transposase in the absence of the plasmid. Right-hand plots depict live T cells exposed to transposase in the presence of the plasmid. Cells were exposed to either a hyperactive transposase (the Super piggyBac) or a wild type piggyBac transposase.

    [0104] FIG. 6B is a series of plots depicting T cells transposed with a plasmid containing a sequence encoding a green fluorescent protein (GFP). Left-hand plots depict live T cells exposed to transposase in the absence of the plasmid. Right-hand plots depict live T cells exposed to transposase in the presence of the plasmid. Cells were exposed to either a hyperactive transposase (the Super piggyBac) or a wild type piggyBac transposase.

    [0105] FIG. 6C is a table depicting the percent of transformed T cells resulting from transposition with WT versus hyperactive piggyBac transposase. T cells contacted with the hyperactive piggyBac transposase (the Super piggyBac transposase) were transformed at a rate 4-fold greater than WT transposase.

    [0106] FIG. 6D is a graph depicting the percent of transformed T cells resulting from transposition with WT versus hyperactive piggyBac transposase 5 days after nucleofection. T cells contacted with the hyperactive piggyBac transposase (the Super piggyBac transposase) were transformed at a rate far greater than WT transposase.

    [0107] FIG. 7 is a graph showing a phenotypic difference between piggyBac?- and lentivirus-produced CAR+ T cells. CAR+ T cells were produced using either piggyBac transposition or lentivirus transduction. Human pan T cells were transposed with piggyBac encoding CAR, stimulated with anti-CD3/CD28 beads at day 2 post-transposition, expanded, and examined on day 19 post-transposition. For production using lentivirus, pan T cells were stimulated with aCD3/CD28 beads, transduced with lentivirus encoding CAR (MOI 5), expanded, and examined on day 18 post-stimulation. Then, each population of CAR+ T cells was characterized based on their expression of the standard memory markers CD62L, CD45RA and CD95. The percentage of each CAR+ T cell subset was defined as na?ve (CD62L+CD45RA+), T.sub.CM (CD62L+CD45RA?), Tem (CD62L?CD45RA?) and Teff (CD62L?CD45RA+). All CAR+ T cells were CD95+.

    [0108] FIGS. 8A-B is a pair of graphs showing that piggyBac? preferentially transposes na?ve T cells. Human pan T cells were sorted (using a BD FACSAria II flow cytometer) into na?ve (CD62L+CD45RA+), T.sub.CM (CD62L+CD45RA?), Tem (CD62L?CD45RA?), and Teff (CD62L?CD45RA+) subsets. The sorted subsets were each either transposed with piggyBac-GFP or transduced with lentivirus-GFP. For the former, each sorted subset was transposed with PiggyBac-GFP, stimulated with anti-CD3/CD28 beads at day 2 post-transposition, expanded, and examined on day 19 post-transposition. For the latter, the sorted subsets were stimulated with aCD3/CD28 beads, transduced with lentivirus encoding GFP (MOI 5), expanded, and examined on day 19 post-stimulation. n=3 donors.

    [0109] FIG. 9 is a pair of graphs showing that the piggyBac? manufacturing process yields high levels of T.sub.SCM in samples from multiple myeloma (MM) patients even when na?ve T cells are rare. T cells from MM patients (triangles) and healthy donors (circles) were characterized for memory marker expression by flow cytometry before (left) and after (right) the Poseida manufacturing process. Expression of CD45RA and CD62L was assessed by FACS and plots are shown for the MM patients and a healthy donor. It is known that T cells from MM patients generally have lower frequencies of na?ve and T.sub.SCM cells, but higher frequencies of Teff, unlike those from healthy normal donors which are the opposite. Regardless of the input frequency of na?ve and T.sub.SCM from different MM patients, production of P-BCMA-101 using the Poseida manufacturing process resulted in a product that exhibited a high level of CD8+T.sub.SCM (E). This was also true for a MM patient who was actively receiving treatment (red triangle).

    [0110] FIGS. 10A-B is a series of Fluorescence Activated Cell Sorting (FACs) plots characterizing T and T.sub.SCM cell markers in human pan T cells transformed with the Sleeping Beauty (SB100x) transposition system and the methods of the disclosure. Sleeping Beauty (SB100x) Transposition yields predominately T.sub.SCM phenotype using Poseida manufacture process. Human pan T cells were transposed using 1 ?g of either a Sleeping Beauty or piggyBac transposon plasmid and SB100x or SPB mRNA, respectively as shown. Following transposition, cells were expanded ex vivo and all non-transposed cells were depleted using the Poseida manufacture drug selection system. Following 18 days in culture, cells were stained with the phenotypic markers CD4, CD8, CD45RA, and CD62L. Stem cell memory phenotype (T.sub.SCM) is defined by CD45RA and CD62L double positive cells and make up >65% of the cells in all of samples. All panels in a column share common x-axis and y-axis parameters. In each row of FIG. 10A, from top to bottom, are shown data from T cells transposed with (top), 2.5 microgram (?g) of the Sleeping Beauty transposon SB100x, (second from top) 5 ?g of SB100x and (3.sup.rd from top) 10 ?g of SB100x. In each row of FIG. 10B, from top to bottom are shown data from T cells transposed with (top) 5 ?g of the piggyBac transposon P-BCMA-101 and (bottom), an unstained control. In FIGS. 10A and 10B, the x-axis, in order from left to right, in the first and second columns shows Forward Scatter (FSC), units from 0 to 250 thousand (abbreviated k), in increments of 50 k. The x axis of the third column from the left shows CD8 expression, with markings reading from 0 to 10.sup.5 incrementing by powers of 10. The final right hand column shows CD62L expression, with markings reading from 0 to 10.sup.5 incrementing by powers of 10. In FIGS. 10A and 10B, the y-axis, in the first column, shows Side Scatter (SSC), in units from 0 to 250 k in increments of 50 k. The y-axis in the second column from the left shows expression of the cell viability marker 7 aminoactinomycin D (7AAD), from 0 to 10.sup.5 incrementing by powers of 10. The y-axis of the third column from the left shows the expression of the marker CD4, from 0 to 10.sup.5 incrementing by powers of 10. The y-axis in the right hand column show expression of the marker CD45RA, from 0 to 10.sup.5 incrementing by powers of 10.

    [0111] FIG. 11 is a schematic diagram showing the human coagulation pathway leading to blood clotting. Contact activation, for example by damaging an endothelium, activates an intrinsic clotting pathway. Tissue factors activate an extrinsic clotting pathway, for example following trauma. Both pathways converge onto the conversion of Prothrombin into Thrombin, which catalyzes the conversion of fibrinogen into fibrin. Polymerized fibrin together with platelets forms a clot. In the absence of Factor IX (circled), clotting is defective. Factor VIII (FVIII) deficiency leads to development of Hemophilia A. Factor IX (FIX) deficiency leads to development of Hemophilia B. Hemophilia B is a rare disease, occurring with a frequency of about one in between 25,000 and 30,000. Sixty percent of hemophilia B cases are severe. Fewer than one percent of individuals with Hemophilia B have normal FIX levels. Prior to the compositions and methods of the disclosure, the standard treatment for hemophilia B involved an infusion of recombinant FIX every 2 to 3 days, at an expense of approximately $250,000 per year. In sharp contrast to this standard treatment option, T.sub.SCM cells of the disclosure are maintained in humans for several decades.

    [0112] FIG. 12 is a series of Fluorescence-Activated Cell Sorting (FACS plots) depicting FIX-secreting T cells. T cells encoding a human Factor IX transgene showed a T.sub.SCM phenotype in approximately 80% of cells. The 6 panels are described in order from left to right. (1) Forward scatter (FSC) on the x-axis versus side scatter (SSC) on the y-axis. The x-axis is from 0 to 250 thousand (abbreviated k) in increments of 50 k, the y-axis is for 0 to 250 k, in increments of 50 k. (2) FSC on the x-axis versus the cell viability marker 7 aminoactinomycin D (7AAD). The x-axis is labeled from 0 to 250 k in increments of 50 k. The y-axis reads, from top to bottom, ?10.sup.3, 0, 10.sup.3, 10.sup.4, 10.sup.5. (3) On the x-axis is shown anti-CD56-APC conjugated to a Cy7 dye (CDC56-APC-Cy7), units from 0 to 10.sup.5 incrementing in powers of 10. On the y-axis is shown anti-CD3 conjugated to phycoerythrin (PE), units from 0 to 10.sup.5 incrementing in powers of 10. (4) On the x-axis is shown anti-CD8 conjugated to fluorescein isothiocyanate (FITC), units from 0 to 10.sup.5 incrementing in powers of 10. On the y-axis is shown anti-CD4 conjugated to Brilliant Violet 650 dye (BV650), units from 0 to 10.sup.5 incrementing in powers of 10. (5) On the x-axis is shown an anti CD62L antibody conjugated to a Brilliant Violet 421 dye (BV421), units from 0 to 10.sup.5 incrementing in powers of 10. On the y-axis is shown an anti-CD45RA antibody conjugated to PE and Cy7, units from 0 to 10.sup.5 incrementing in powers of 10. This panel is boxed. (6) On the x-axis is shown an anti-CCR7 antibody conjugated to Brilliant Violet 786 (BV786), units from 0 to 10.sup.5 incrementing in powers of 10. On the y-axis is shown anti-CD45RA conjugated to PE and Cy7, units from 0 to 10.sup.5 incrementing in powers of 10.

    [0113] FIG. 13A is a graph showing human Factor IX secretion during production of modified T cells of the disclosure. On the y-axis, Factor IX concentration in nanograms (ng) per milliliter (mL) from 0 to 80 in increments of 20. On the x-axis are shown 9 day and 12 day T cells.

    [0114] FIG. 13B is a graph showing the clotting activity of the secreted Factor IX produced by the T cells. On the y-axis is shown percent Factor IX activity relative to human plasma, from 0 to 8 in increments of 2. On the x-axis are 9 and 12 day T cells.

    [0115] FIGS. 14A-E are a series of plasmid maps for site-specific integration into the AAVS1 site using either HR or MMEJ and corresponding sequences. Donor plasmids for testing stable integration into the genome of human pan T cells via A) site-specific (AAVS1) homologous recombination (HR), B) site-specific (AAVS1) microhomology-mediated end-joining (MMEJ) recombination and C) TTAA-specific piggyBac? transposition. For HR and MMEJ donor plasmids, GFP-2A-DHFR gene expression cassettes were flanked by CRISPR/Cas9 targeting sites and homology arms for AAVS1 site integration; for piggyBac? donor plasmid, GFP-2A-DHFR gene expression cassette is flanked by piggyBac? transposon elements. The homology arms for the HR and MMEJ plasmids are 500 bp and 25 bp, respectively. Panels D and E depict SEQ ID NOs 41 and 42 respectively.

    [0116] FIG. 15 is a graph showing transgene (GFP) expression in primary human pan T cells 3 days post-nucleofection. HR or MMEJ donor plasmids were co-delivered with or without CRISPR ribonucleoprotein (RNP) targeting reagents into pan T cells via nucleofection. T cells receiving donor plasmids alone were included as controls. Pan T cells were also modified using the piggyBac? transposon delivery system. T cells were activated via TCR stimulation on Day 0 and GFP+ T cell percentage was accessed at day 3 post-nucleofection by flow cytometry and data are summarized in bar graph.

    [0117] FIG. 16 is a graph showing transgene (GFP) expression in primary human pan T cells 11 days post-nucleofection and selection. Activated T cells with stably integrated transgenes were selected by methotrexate addition using the DHFR selection gene encoded in the bi-cistronic GFP-2A-DHFR integration cassettes. GFP+ cell percentage was assessed at Day 11 post-nucleofection by flow cytometry and data are summarized in bar graph. GFP+ cells were highly enriched via selection in pan T cells receiving transposition reagents, RNP plus HR or MMEJ donor plasmids, but not in T cells receiving donor plasmids alone.

    [0118] FIGS. 17A-C is a series of graphs showing the phenotype of primary human pan T cells modified by HR and MMEJ at the AAVS1 site. The phenotype of GFP+CD8+ pan T cells was analyzed at Day 11 post-nucleofection by flow cytometry. A) Cells were stained with 7AAD (cell viability), CD4, CD8, CD45RA and CD62L, and FACS plots show gating strategy. CD8+ T cell subsets were defined by expression of CD45RA+CD62L+(stem cell memory T cells (T.sub.SCM)), CD45RA-CD62L+(central memory T cells (T.sub.CM)), CD45RA-CD62L? (effector memory T cells (Tem)), and CD45RA+CD62L? (T effectors (Teff)). B) Percentage of total GFP+ CD8+ T cells in each T cell subset is summarized in bar graph. An enriched population of GFP+ T.sub.SCM was achieved in all cases using either the piggyBac? transposon system, or HR and MMEJ in combination with Cas9 RNP. C) The total number of pan T cells was analyzed at day 13 post-nucleofection and data are summarized in bar graph.

    [0119] FIGS. 18A-B is a pair of photographs of gel electrophoresis results showing site-specific integration into the AAVS1 site. Selected cells from each group were harvested and genomic DNA was extracted and used as template for PCR to confirm site-specific integration into the AAVS1 site for A) HR and B) MMEJ. Two pairs of primers individually amplify the 5-end junction (with one primer priming the promoter region of the insertion EF1a-2r CACCGGAGCCAATTCCCACT (SEQ ID NO: 36) and the other priming the AAVS1 region beyond the 500 bp homologue arm at the 5-end AAVS-3r CTGCACCACGTGATGTCCTC (SEQ ID NO: 37), yielding a 0.73 kb DNA fragment for both HR or MMEJ) and 3-end junction (with one primer priming the polyA signaling region SV40 pA-1r GTAACCATTATAAGCTGCAATAAACAAG (SEQ ID NO: 38) and the other priming the AAVS1 region beyond the 500 bp 5-homologue arm AAVS-2f CTGGGGACTCTTTAAGGAAAGAAG (SEQ ID NO: 39), yielding a 0.76 kb DNA fragment for HR or MMEJ) of the AAVS1 target site. PCR products were displayed on Agarose gel. Non-specific bands in HR samples are the result of only a single round of PCR and would likely have been resolved given additional rounds.

    DETAILED DESCRIPTION

    [0120] The disclosure provides a method for producing human chimeric antigen receptor (CAR) expressing-T cells using the piggyBac? Transposon System under conditions that preserve or induce stem-cell memory T cells (T.sub.SCM) with potent CAR activity (referred to herein as a CAR-T.sub.SCM. Compositions comprising CAR-T.sub.SCM produced using the methods of the disclosure comprise >60% CAR-T.sub.SCM and exhibit a distinct functional profile that is consistent with this T cell subset. Other T cell subsets found in the compositions of the disclosure include, but are not limited to, central memory CAR-T cells (CAR-T.sub.CM), effector memory CAR-T cells (CAR-T.sub.EM), effector CAR-T cells (CAR-T.sub.E), and terminally-differentiated effector CAR-T cells (CAR-T.sub.TE). A linear pathway of differentiation may be responsible for generating these cells: Na?ve T cells (T.sub.N)>T.sub.SCM>T.sub.CM>T.sub.EM>T.sub.E>T.sub.TE, whereby T.sub.N is the parent precursor cell that directly gives rise to T.sub.SCM, which then, in turn, directly gives rise to T.sub.CM, etc. Compositions comprising CAR-T.sub.SCM, CARTyrin-T.sub.SCM and/or VCAR-T.sub.SCM of the disclosure may comprise one or more of each parental CAR-T cell subset with CAR-T.sub.SCM being the most abundant (e.g. T.sub.SCM>T.sub.CM>T.sub.EM>T.sub.E>T.sub.TE). While, the absolute quantities/abundances and relative proportions of each parental T cell subset may vary among samples of patient blood and naturally-occurring cell populations, and naturally-occurring cell populations may have a high abundance and/or proportion of T.sub.SCM, compositions of the disclosure comprising non-naturally occurring CAR-T.sub.SCM are more potent and efficacious in treating patients against diseases and cancers.

    [0121] Immunotherapy using chimeric-antigen receptor (CAR)-T cells is emerging as an exciting therapeutic approach for cancer therapies. Autologous CAR-modified T cells targeting a tumor-associated antigen (Ag) can result in robust tumor killing, in some cases resulting in complete remission of CD19.sup.+ hematological malignancies. Unlike traditional biologics and chemotherapeutics, CAR-T cells possess the capacity to rapidly reproduce upon Ag recognition, thereby potentially obviating the need for repeat treatments. To achieve this, CAR-T cells must not only drive tumor destruction initially, but must also persist in the patient as a stable population of viable memory T cells to prevent potential cancer relapses. Thus, intensive efforts have been focused on the development of CAR molecules that do not cause T cell exhaustion through Ag-independent (tonic) signaling, as well as of a CAR-T product containing early memory cells, especially stem cell memory (T.sub.SCM). A stem cell-like CAR-T would exhibit the greatest capacity for self-renewal and multipotent capacity to derive central memory (T.sub.CM), effector memory (T.sub.EM) and effector T cells (TE), thereby producing better tumor eradication and long-term CAR-T engraftment.

    [0122] CAR-T.sub.SCM of the disclosure may comprise a Centyrin-based CAR, referred to as a CARTyrin (and hence, the cell may be referred to as a CARTyrin-TscM). Centyrins are alternative scaffold molecules based on human consensus tenascin FN3 domain, are smaller than scFv molecules, and can be selected for monomeric properties that favor stability and decrease the likelihood of tonic signaling in CAR molecules. CARTyrins of the disclosure may be introduced to T cells using a plasmid DNA transposon encoding the CARTyrin that is flanked by two cis-regulatory insulator elements to help stabilize CARTyrin expression by blocking improper gene activation or silencing.

    [0123] CAR-T.sub.SCM of the disclosure may comprise a VHH-based CAR, referred to as a VCAR (and hence, the cell may be referred to as a VCAR-T.sub.SCM) VCARs of the disclosure may be introduced to T cells using a plasmid DNA transposon encoding the VHH that is flanked by two cis-regulatory insulator elements to help stabilize VHH expression by blocking improper gene activation or silencing.

    [0124] In certain embodiments of the methods of the disclosure, the piggyBac? (PB) Transposon System may be used for stable integration of antigen-specific (including cancer antigen-specific) CARTyrin or VCAR into resting pan T cells, whereby the transposon was co-delivered along with an mRNA transposase enzyme (although the transposon and transposase would be comprised in separate compositions until they were introduced into a cell), called Super piggyBac? (SPB), in a single electroporation reaction. Delivery of piggyBac? transposon into untouched, resting primary human pan T cells resulted in 20-30% of cells with stable integration and expression of PB-delivered genes. Unexpectedly, a majority of these modified CARTyrin-expressing T cells were positive for expression of CD62L and CD45RA, markers commonly associated with stem memory T-cells (T.sub.SCM cells). To confirm that this phenotype was retained upon CAR-T cell stimulation and expansion, the modified CARTyrin-expressing T cells positive for expression of CD62L and CD45RA were activated via stimulation of CD3 and CD28. As a result of stimulation of CD3 and CD28, >60% of CARTyrin+ T cells exhibited a stem-cell memory phenotype. Furthermore, these cells, which expressed a CARTyrin specific for a cancer antigen, were fully capable of expressing potent anti-tumor effector function.

    [0125] To determine whether or not the PB system directly contributed to enhancing the expression of stem-like markers, the phenotype of CAR-T cells generated either by PB transposition or lentiviral (LV) transduction was compared. To do this, a new vector was constructed by subcloning the CARTyrin transgene into a common LV construct for production of virus. Following introduction of the CARTyrin to untouched resting T cells either by PB-transposition or LV-transduction, the CARTyrin.sup.+ cells were expanded and then allowed to return to a resting state. A variety of phenotypic and functional characteristics were measured including kinetic analysis of memory and exhaustion-associated markers, secondary proliferation in response to homeostatic cytokine or tumor-associated Ag, cytokine production, and lytic capability in response to target tumor cells. Unlike the PB-transposed CARTyrin.sup.+ T cells, the LV-transduced CARTyrin.sup.+ T cells did not exhibit an augmented memory phenotype. In addition, PB-transposed cells exhibited a comparable or greater capability for secondary proliferation and killing of target tumor cells. Together, these data demonstrate that CAR-T cells produced by PB transposition are predominantly T.sub.SCM cells, a highly desirable product phenotype in the CAR-T field. Furthermore, these CARTyrin.sup.+ T cells exhibit strong anti-tumor activity and may give rise to cells that persist longer in vivo due to the use of a Centyrin-based CAR, which may be less prone to tonic signaling and functional exhaustion.

    Chimeric Antigen Receptors

    [0126] The disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises one or more sequences that each specifically bind an antigen; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain. In certain embodiments, the antigen recognition region may comprise two sequences that each specifically bind an antigen to produce a bi-specific or tandem CAR. In certain embodiments, the antigen recognition region may comprise three sequences that each specifically bind an antigen to produce a tri-specific CAR. In certain embodiments, the ectodomain may further comprise a signal peptide. Alternatively, or in addition, in certain embodiments, the ectodomain may further comprise a hinge between the antigen recognition region and the transmembrane domain. Sequences that each specifically bind an antigen may include, but not limited to, a single chain antibody (e.g. a scFv), a sequence comprising one or more fragments of an antibody (e.g. a VHH, referred to in the context of a CAR as a VCAR), an antibody mimic, and a Centyrin (referred to in the context of a CAR as a CARTyrin).

    [0127] In certain embodiments of the CARs of the disclosure, the signal peptide may comprise a sequence encoding a human CD2, CD3?, CD3?, CD3?, CD3?, CD4, CD8?, CD19, CD28, 4-1BB or GM-CSFR signal peptide. In certain embodiments of the CARs of the disclosure, the signal peptide may comprise a sequence encoding a human CD8a signal peptide. The human CD8a signal peptide may comprise an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 8). The human CD8a signal peptide may comprise an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 8) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 8). The human CD8a signal peptide may be encoded by a nucleic acid sequence comprising atggcactgccagtcaccgccctgctgctgcctctggctctgctgctgcacgcagctagacca (SEQ ID NO: 9).

    [0128] In certain embodiments of the CARs of the disclosure, the transmembrane domain may comprise a sequence encoding a human CD2, CD3?, CD3?, CD3?, CD3?, CD4, CD8?, CD19, CD28, 4-1BB or GM-CSFR transmembrane domain. In certain embodiments of the CARs of the disclosure, the transmembrane domain may comprise a sequence encoding a human CD8a transmembrane domain. The CD8a transmembrane domain may comprise an amino acid sequence comprising IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 10) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 10). The CD8a transmembrane domain may be encoded by the nucleic acid sequence comprising atctacatttgggcaccactggccgggacctgtggagtgctgctgctgagcctggtcatcacactgtactgc (SEQ ID NO: 11).

    [0129] In certain embodiments of the CARs of the disclosure, the endodomain may comprise a human CD3? endodomain.

    [0130] In certain embodiments of the CARs of the disclosure, the at least one costimulatory domain may comprise a human 4-1BB, CD28, CD40, ICOS, MyD88, OX-40 intracellular segment, or any combination thereof. In certain embodiments of the CARs of the disclosure, the at least one costimulatory domain may comprise a CD28 and/or a 4-1BB costimulatory domain. The CD28 costimulatory domain may comprise an amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 12) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 12). The CD28 costimulatory domain may be encoded by the nucleic acid sequence comprising cgcgtgaagtttagtcgatcagcagatgccccagcttacaaacagggacagaaccagctgtataacgagctgaatctgggccgccgagag gaatatgacgtgctggataagcggagaggacgcgaccccgaaatgggaggcaagcccaggcgcaaaaaccctcaggaaggcctgtat aacgagctgcagaaggacaaaatggcagaagcctattctgagatcggcatgaagggggagcgacggagaggcaaagggcacgatgg gctgtaccagggactgagcaccgccacaaaggacacctatgatgctctgcatatgcaggcactgcctccaagg (SEQ ID NO: 13). The 4-1BB costimulatory domain may comprise an amino acid sequence comprising KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 14) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 14). The 4-1BB costimulatory domain may be encoded by the nucleic acid sequence comprising aagagaggcaggaagaaactgctgtatattttcaaacagccatcatgcgccccgtgcagactacccaggaggaagacgggtgctcctgt cgattccctgaggaagaggaaggcgggtgtgagctg (SEQ ID NO: 15). The 4-1BB costimulatory domain may be located between the transmembrane domain and the CD28 costimulatory domain.

    [0131] In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8?, IgG4, and/or CD4 sequence. In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8a sequence. The hinge may comprise a human CD8a amino acid sequence comprising TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 16) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 16). The human CD8a hinge amino acid sequence may be encoded by the nucleic acid sequence comprising actaccacaccagcacctagaccaccaactccagctccaaccatcgcgagtcagcccctgagtctgagacctgaggcctgcaggccagc tgcaggaggagctgtgcacaccaggggcctggacttcgcctgcgac (SEQ ID NO: 17).

    [0132] The disclosure provides a composition comprising the CAR of the disclosure and at least one pharmaceutically acceptable carrier.

    [0133] The disclosure provides a transposon comprising the CAR of the disclosure. Transposons of the disclosure be episomally maintained or integrated into the genome of the recombinant/modified cell. The transposon may be part of a two component piggyBac system that utilizes a transposon and transposase for enhanced non-viral gene transfer.

    [0134] Transposons of the disclosure may comprise a selection gene for identification, enrichment and/or isolation of cells that express the transposon. Exemplary selection genes encode any gene product (e.g. transcript, protein, enzyme) essential for cell viability and survival. Exemplary selection genes encode any gene product (e.g. transcript, protein, enzyme) essential for conferring resistance to a drug challenge against which the cell is sensitive (or which could be lethal to the cell) in the absence of the gene product encoded by the selection gene. Exemplary selection genes encode any gene product (e.g. transcript, protein, enzyme) essential for viability and/or survival in a cell media lacking one or more nutrients essential for cell viability and/or survival in the absence of the selection gene. Exemplary selection genes include, but are not limited to, neo (conferring resistance to neomycin), DHFR (encoding Dihydrofolate Reductase and conferring resistance to Methotrexate), TYMS (encoding Thymidylate Synthetase), MGMT (encoding O(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDH1 (encoding Aldehyde dehydrogenase 1 family, member A1), FRANCF, RAD51C (encoding RAD51 Paralog C), GCS (encoding glucosylceramide synthase), and NKX2.2 (encoding NK2 Homeobox 2).

    [0135] Transposons of the disclosure may comprise at least one self-cleaving peptide(s) located, for example, between one or more of a sequence that specifically binds an antigen and a selection gene of the disclosure. The at least one self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0136] Transposons of the disclosure may comprise a first and a second self-cleaving peptide, the first self-cleaving peptide located, for example, upstream of one or more of a sequence that specifically binds an antigen of the disclosure the second self-cleaving peptide located, for example, downstream of the one or more of a sequence that specifically binds an antigen of the disclosure. The first and/or the second self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 023). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0137] The disclosure provides a composition comprising the transposon the disclosure. In certain embodiments, a method introducing the composition may further comprise a composition comprising a plasmid comprising a sequence encoding a transposase enzyme. The sequence encoding a transposase enzyme may be an mRNA sequence.

    [0138] Transposons of the disclosure may comprise piggyBac transposons. Transposase enzymes of the disclosure may include piggyBac transposases or compatible enzymes.

    [0139] The disclosure provides a vector comprising the CAR of the disclosure. In certain embodiments, the vector is a viral vector. The vector may be a recombinant vector.

    [0140] Viral vectors of the disclosure may comprise a sequence isolated or derived from a retrovirus, a lentivirus, an adenovirus, an adeno-associated virus or any combination thereof. The viral vector may comprise a sequence isolated or derived from an adeno-associated virus (AAV). The viral vector may comprise a recombinant AAV (rAAV). Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure comprise two or more inverted terminal repeat (ITR) sequences located in cis next to one or more of a sequence that specifically binds an antigen. Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to all serotypes (e.g. AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, and AAV9). Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to, self-complementary AAV (scAAV) and AAV hybrids containing the genome of one serotype and the capsid of another serotype (e.g. AAV2/5, AAV-DJ and AAV-DJ8). Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to, rAAV-LK03.

    [0141] Viral vectors of the disclosure may comprise a selection gene. The selection gene may encode a gene product essential for cell viability and survival. The selection gene may encode a gene product essential for cell viability and survival when challenged by selective cell culture conditions. Selective cell culture conditions may comprise a compound harmful to cell viability or survival and wherein the gene product confers resistance to the compound. Exemplary selection genes of the disclosure may include, but are not limited to, neo (conferring resistance to neomycin), DHFR (encoding Dihydrofolate Reductase and conferring resistance to Methotrexate), TYMS (encoding Thymidylate Synthetase), MGMT (encoding O(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDH1 (encoding Aldehyde dehydrogenase 1 family, member A1), FRANCF, RAD51C (encoding RAD51 Paralog C), GCS (encoding glucosylceramide synthase), NKX2.2 (encoding NK2 Homeobox 2) or any combination thereof.

    [0142] Viral vectors of the disclosure may comprise at least one self-cleaving peptide. In some embodiments, the vector may comprise at least one self-cleaving peptide and wherein a self-cleaving peptide is located between a CAR and a selection gene. In some embodiments, the vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located upstream of a CAR and a second self-cleaving peptide is located downstream of a CAR. The self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0143] The disclosure provides a vector comprising the CAR of the disclosure. In certain embodiments, the vector is an mRNA vector. The vector may be a recombinant mRNA vector. T cells of the disclosure may be expanded prior to contacting the T-cell and the mRNA vector comprising the CAR of the disclosure. The T cell comprising the mRNA vector, the modified T cell, may then be administered to a subject.

    [0144] The disclosure provides a vector comprising the CAR of the disclosure. In certain embodiments, the vector is a nanoparticle. Exemplary nanoparticle vectors of the disclosure include, but are not limited to, nucleic acids (e.g. RNA, DNA, synthetic nucleotides, modified nucleotides or any combination thereof), amino acids (L-amino acids, D-amino acids, synthetic amino acids, modified amino acids, or any combination thereof), polymers (e.g. polymersomes), micelles, lipids (e.g. liposomes), organic molecules (e.g. carbon atoms, sheets, fibers, tubes), inorganic molecules (e.g. calcium phosphate or gold) or any combination thereof. A nanoparticle vector may be passively or actively transported across a cell membrane.

    [0145] Nanoparticle vectors of the disclosure may comprise a selection gene. The selection gene may encode a gene product essential for cell viability and survival. The selection gene may encode a gene product essential for cell viability and survival when challenged by selective cell culture conditions. Selective cell culture conditions may comprise a compound harmful to cell viability or survival and wherein the gene product confers resistance to the compound. Exemplary selection genes of the disclosure may include, but are not limited to, neo (conferring resistance to neomycin), DHFR (encoding Dihydrofolate Reductase and conferring resistance to Methotrexate), TYMS (encoding Thymidylate Synthetase), MGMT (encoding O(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDH1 (encoding Aldehyde dehydrogenase 1 family, member A1), FRANCF, RAD51C (encoding RAD51 Paralog C), GCS (encoding glucosylceramide synthase), NKX2.2 (encoding NK2 Homeobox 2) or any combination thereof.

    [0146] Nanoparticle vectors of the disclosure may comprise at least one self-cleaving peptide. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a self-cleaving peptide is located between a CAR and the nanoparticle. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located upstream of a CAR and a second self-cleaving peptide is located downstream of a CAR. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located between a CAR and the nanoparticle and a second self-cleaving peptide is located downstream of the CAR. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located between a CAR and the nanoparticle and a second self-cleaving peptide is located downstream of the CAR, for example, between the CAR and a selection gene. The self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0147] The disclosure provides a composition comprising a vector of the disclosure.

    CARTyrins

    [0148] The disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises at least one Centyrin; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain. As used throughout the disclosure, a CAR comprising a Centyrin is referred to as a CARTyrin. In certain embodiments, the antigen recognition region may comprise two Centyrins to produce a bi-specific or tandem CAR. In certain embodiments, the antigen recognition region may comprise three Centyrins to produce a tri-specific CAR. In certain embodiments, the ectodomain may further comprise a signal peptide. Alternatively, or in addition, in certain embodiments, the ectodomain may further comprise a hinge between the antigen recognition region and the transmembrane domain.

    [0149] The disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises at least one protein scaffold or antibody mimetic; (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain. In certain embodiments, the antigen recognition region may comprise two scaffold proteins or antibody mimetics to produce a bi-specific or tandem CAR. In certain embodiments, the antigen recognition region may comprise three protein scaffolds or antibody mimetics to produce a tri-specific CAR. In certain embodiments, the ectodomain may further comprise a signal peptide. Alternatively, or in addition, in certain embodiments, the ectodomain may further comprise a hinge between the antigen recognition region and the transmembrane domain.

    [0150] In certain embodiments of the CARs of the disclosure, the signal peptide may comprise a sequence encoding a human CD2, CD3?, CD3?, CD3?, CD3?, CD4, CD8a, CD19, CD28, 4-1BB or GM-CSFR signal peptide. In certain embodiments of the CARs of the disclosure, the signal peptide may comprise a sequence encoding a human CD8a signal peptide. The human CD8a signal peptide may comprise an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 8). The human CD8a signal peptide may comprise an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 8) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the an amino acid sequence comprising MALPVTALLLPLALLLHAARP (SEQ ID NO: 8). The human CD8a signal peptide may be encoded by a nucleic acid sequence comprising atggcactgccagtcaccgccctgctgctgcctctggctctgctgctgcacgcagctagacca (SEQ ID NO: 9).

    [0151] In certain embodiments of the CARs of the disclosure, the transmembrane domain may comprise a sequence encoding a human CD2, CD3?, CD3?, CD3?, CD3?, CD4, CD8a, CD19, CD28, 4-1BB or GM-CSFR transmembrane domain. In certain embodiments of the CARs of the disclosure, the transmembrane domain may comprise a sequence encoding a human CD8a transmembrane domain. The CD8a transmembrane domain may comprise an amino acid sequence comprising IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 10) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 10). The CD8a transmembrane domain may be encoded by the nucleic acid sequence comprising atctacatttgggcaccactggccgggacctgtggagtgctgctgctgagcctggtcatcacactgtactgc (SEQ ID NO: 11).

    [0152] In certain embodiments of the CARs of the disclosure, the endodomain may comprise a human CD3? endodomain.

    [0153] In certain embodiments of the CARs of the disclosure, the at least one costimulatory domain may comprise a human 4-1BB, CD28, CD40, ICOS, MyD88, OX-40 intracellular segment, or any combination thereof. In certain embodiments of the CARs of the disclosure, the at least one costimulatory domain may comprise a CD28 and/or a 4-1BB costimulatory domain. The CD28 costimulatory domain may comprise an amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 12) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 12). The CD28 costimulatory domain may be encoded by the nucleic acid sequence comprising cgcgtgaagtttagtcgatcagcagatgccccagcttacaaacagggacagaaccagctgtataacgagctgaatctgggccgccgagag gaatatgacgtgctggataagcggagaggacgcgaccccgaaatgggaggcaagcccaggcgcaaaaaccctcaggaaggcctgtat aacgagctgcagaaggacaaaatggcagaagcctattctgagatcggcatgaagggggagcgacggagaggcaaagggcacgatgg gctgtaccagggactgagcaccgccacaaaggacacctatgatgctctgcatatgcaggcactgcctccaagg (SEQ ID NO: 13). The 4-1BB costimulatory domain may comprise an amino acid sequence comprising KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 14) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 14). The 4-1BB costimulatory domain may be encoded by the nucleic acid sequence comprising aagagaggcaggaagaaactgctgtatattttcaaacagccatcatgcgccccgtgcagactacccaggaggaagacgggtgctcctgt cgattccctgaggaagaggaaggcgggtgtgagctg (SEQ ID NO: 15). The 4-1BB costimulatory domain may be located between the transmembrane domain and the CD28 costimulatory domain.

    [0154] In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8a, IgG4, and/or CD4 sequence. In certain embodiments of the CARs of the disclosure, the hinge may comprise a sequence derived from a human CD8a sequence. The hinge may comprise a human CD8a amino acid sequence comprising TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 16) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 16). The human CD8a hinge amino acid sequence may be encoded by the nucleic acid sequence comprising actaccacaccagcacctagaccaccaactccagctccaaccatcgcgagtcagcccctgagtctgagacctgaggcctgcaggccagc tgcaggaggagctgtgcacaccaggggcctggacttcgcctgcgac (SEQ ID NO: 17).

    [0155] Centyrins of the disclosure may comprise a protein scaffold, wherein the scaffold is capable of specifically binding an antigen. Centyrins of the disclosure may comprise a protein scaffold comprising a consensus sequence of at least one fibronectin type III (FN3) domain, wherein the scaffold is capable of specifically binding an antigen. The at least one fibronectin type III (FN3) domain may be derived from a human protein. The human protein may be Tenascin-C. The consensus sequence may comprise LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYDLTG LKPGTEYTVSIYGVKGGHRSNPLSAEFTT (SEQ ID NO: 1) or MLPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYDLT GLKPGTEYTVSIYGVKGGHRSNPLSAEFTT (SEQ ID NO: 2). The consensus sequence may encoded by a nucleic acid sequence comprising atgctgcctgcaccaaagaacctggtggtgtctcatgtgacagaggatagtgccagactgtcatggactgctcccgacgcagccttcgata gtttatcatcgtgtaccgggagaacatcgaaaccggcgaggccattgtcctgacagtgccagggtccgaacgctcttatgacctgacagat ctgaagcccggaactgagtactatgtgcagatcgccggcgtcaaaggaggcaatatcagatccctctgtccgcaatcttcaccaca (SEQ ID NO: 3). The consensus sequence may be modified at one or more positions within (a) a A-B loop comprising or consisting of the amino acid residues TEDS (SEQ ID NO: 43) at positions 13-16 of the consensus sequence; (b) a B-C loop comprising or consisting of the amino acid residues TAPDAAF (SEQ ID NO: 44) at positions 22-28 of the consensus sequence; (c) a C-D loop comprising or consisting of the amino acid residues SEKVGE (SEQ ID NO: 45) at positions 38-43 of the consensus sequence; (d) a D-E loop comprising or consisting of the amino acid residues GSER (SEQ ID NO: 46) at positions 51-54 of the consensus sequence; (e) a E-F loop comprising or consisting of the amino acid residues GLKPG (SEQ ID NO: 47) at positions 60-64 of the consensus sequence; (f) a F-G loop comprising or consisting of the amino acid residues KGGHRSN (SEQ ID NO: 48) at positions 75-81 of the consensus sequence; or (g) any combination of (a)-(f). Centyrins of the disclosure may comprise a consensus sequence of at least 5 fibronectin type III (FN3) domains, at least 10 fibronectin type III (FN3) domains or at least 15 fibronectin type III (FN3) domains. The scaffold may bind an antigen with at least one affinity selected from a K.sub.D of less than or equal to 10.sup.?9M, less than or equal to 10.sup.?10 M, less than or equal to 10.sup.?11 M, less than or equal to 10.sup.?12M, less than or equal to 10.sup.?13M, less than or equal to 10.sup.?14M, and less than or equal to 10.sup.?15M. The K.sub.D may be determined by surface plasmon resonance.

    [0156] The disclosure provides a composition comprising the CAR of the disclosure and at least one pharmaceutically acceptable carrier.

    [0157] The disclosure provides a transposon comprising the CAR of the disclosure. Transposons of the disclosure be episomally maintained or integrated into the genome of the recombinant/modified cell. The transposon may be part of a two component piggyBac system that utilizes a transposon and transposase for enhanced non-viral gene transfer.

    [0158] Transposons of the disclosure may comprise a selection gene for identification, enrichment and/or isolation of cells that express the transposon. Exemplary selection genes encode any gene product (e.g. transcript, protein, enzyme) essential for cell viability and survival. Exemplary selection genes encode any gene product (e.g. transcript, protein, enzyme) essential for conferring resistance to a drug challenge against which the cell is sensitive (or which could be lethal to the cell) in the absence of the gene product encoded by the selection gene. Exemplary selection genes encode any gene product (e.g. transcript, protein, enzyme) essential for viability and/or survival in a cell media lacking one or more nutrients essential for cell viability and/or survival in the absence of the selection gene. Exemplary selection genes include, but are not limited to, neo (conferring resistance to neomycin), DHFR (encoding Dihydrofolate Reductase and conferring resistance to Methotrexate), TYMS (encoding Thymidylate Synthetase), MGMT (encoding O(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDH1 (encoding Aldehyde dehydrogenase 1 family, member A1), FRANCF, RAD51C (encoding RAD51 Paralog C), GCS (encoding glucosylceramide synthase), and NKX2.2 (encoding NK2 Homeobox 2).

    [0159] Transposons of the disclosure may comprise at least one self-cleaving peptide(s) located, for example, between on or more of a protein scaffold, Centyrin or CARTyrin of the disclosure and a selection gene of the disclosure. The at least one self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0160] Transposons of the disclosure may comprise a first and a second self-cleaving peptide, the first self-cleaving peptide located, for example, upstream of one or more of a protein scaffold, Centyrin or CARTyrin of the disclosure the second self-cleaving peptide located, for example, downstream of the one or more of a protein scaffold, Centyrin or CARTyrin of the disclosure. The first and/or the second self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO:21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0161] The disclosure provides a composition comprising the transposon the disclosure. In certain embodiments, a method introducing the composition may further comprise a composition comprising a plasmid comprising a sequence encoding a transposase enzyme. The sequence encoding a transposase enzyme may be an mRNA sequence.

    [0162] Transposons of the disclosure may comprise piggyBac transposons. Transposase enzymes of the disclosure may include piggyBac transposases or compatible enzymes.

    [0163] The disclosure provides a vector comprising the CAR of the disclosure. In certain embodiments, the vector is a viral vector. The vector may be a recombinant vector.

    [0164] Viral vectors of the disclosure may comprise a sequence isolated or derived from a retrovirus, a lentivirus, an adenovirus, an adeno-associated virus or any combination thereof. The viral vector may comprise a sequence isolated or derived from an adeno-associated virus (AAV). The viral vector may comprise a recombinant AAV (rAAV). Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure comprise two or more inverted terminal repeat (ITR) sequences located in cis next to a sequence encoding a protein scaffold, Centyrin or CARTyrin of the disclosure. Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to all serotypes (e.g. AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, and AAV9). Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to, self-complementary AAV (scAAV) and AAV hybrids containing the genome of one serotype and the capsid of another serotype (e.g. AAV2/5, AAV-DJ and AAV-DJ8). Exemplary adeno-associated viruses and recombinant adeno-associated viruses of the disclosure include, but are not limited to, rAAV-LK03.

    [0165] Viral vectors of the disclosure may comprise a selection gene. The selection gene may encode a gene product essential for cell viability and survival. The selection gene may encode a gene product essential for cell viability and survival when challenged by selective cell culture conditions. Selective cell culture conditions may comprise a compound harmful to cell viability or survival and wherein the gene product confers resistance to the compound. Exemplary selection genes of the disclosure may include, but are not limited to, neo (conferring resistance to neomycin), DHFR (encoding Dihydrofolate Reductase and conferring resistance to Methotrexate), TYMS (encoding Thymidylate Synthetase), MGMT (encoding O(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDH1 (encoding Aldehyde dehydrogenase 1 family, member A1), FRANCF, RAD51C (encoding RAD51 Paralog C), GCS (encoding glucosylceramide synthase), NKX2.2 (encoding NK2 Homeobox 2) or any combination thereof.

    [0166] Viral vectors of the disclosure may comprise at least one self-cleaving peptide. In some embodiments, the vector may comprise at least one self-cleaving peptide and wherein a self-cleaving peptide is located between a CAR and a selection gene. In some embodiments, the vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located upstream of a CAR and a second self-cleaving peptide is located downstream of a CAR. The self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0167] The disclosure provides a vector comprising the CAR of the disclosure. In certain embodiments, the vector is an mRNA vector. The vector may be a recombinant mRNA vector. T cells of the disclosure may be expanded prior to contacting the T-cell and the mRNA vector comprising the CAR of the disclosure. The T cell comprising the mRNA vector, the modified T cell, may then be administered to a subject.

    [0168] The disclosure provides a vector comprising the CAR of the disclosure. In certain embodiments, the vector is a nanoparticle. Exemplary nanoparticle vectors of the disclosure include, but are not limited to, nucleic acids (e.g. RNA, DNA, synthetic nucleotides, modified nucleotides or any combination thereof), amino acids (L-amino acids, D-amino acids, synthetic amino acids, modified amino acids, or any combination thereof), polymers (e.g. polymersomes), micelles, lipids (e.g. liposomes), organic molecules (e.g. carbon atoms, sheets, fibers, tubes), inorganic molecules (e.g. calcium phosphate or gold) or any combination thereof. A nanoparticle vector may be passively or actively transported across a cell membrane.

    [0169] Nanoparticle vectors of the disclosure may comprise a selection gene. The selection gene may encode a gene product essential for cell viability and survival. The selection gene may encode a gene product essential for cell viability and survival when challenged by selective cell culture conditions. Selective cell culture conditions may comprise a compound harmful to cell viability or survival and wherein the gene product confers resistance to the compound. Exemplary selection genes of the disclosure may include, but are not limited to, neo (conferring resistance to neomycin), DHFR (encoding Dihydrofolate Reductase and conferring resistance to Methotrexate), TYMS (encoding Thymidylate Synthetase), MGMT (encoding O(6)-methylguanine-DNA methyltransferase), multidrug resistance gene (MDR1), ALDH1 (encoding Aldehyde dehydrogenase 1 family, member A1), FRANCF, RAD51C (encoding RAD51 Paralog C), GCS (encoding glucosylceramide synthase), NKX2.2 (encoding NK2 Homeobox 2) or any combination thereof.

    [0170] Nanoparticle vectors of the disclosure may comprise at least one self-cleaving peptide. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a self-cleaving peptide is located between a CAR and the nanoparticle. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located upstream of a CAR and a second self-cleaving peptide is located downstream of a CAR. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located between a CAR and the nanoparticle and a second self-cleaving peptide is located downstream of the CAR. In some embodiments, the nanoparticle vector may comprise at least one self-cleaving peptide and wherein a first self-cleaving peptide is located between a CAR and the nanoparticle and a second self-cleaving peptide is located downstream of the CAR, for example, between the CAR and a selection gene. The self-cleaving peptide may comprise, for example, a T2A peptide, GSG-T2A peptide, an E2A peptide, a GSG-E2A peptide, an F2A peptide, a GSG-F2A peptide, a P2A peptide, or a GSG-P2A peptide. A T2A peptide may comprise an amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising EGRGSLLTCGDVEENPGP (SEQ ID NO: 18). A GSG-T2A peptide may comprise an amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 19). A GSG-T2A peptide may comprise a nucleic acid sequence comprising ggatctggagagggaaggggaagcctgctgacctgtggagacgtggaggaaaacccaggacca (SEQ ID NO: 20). An E2A peptide may comprise an amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising QCTNYALLKLAGDVESNPGP (SEQ ID NO: 21). A GSG-E2A peptide may comprise an amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 22). An F2A peptide may comprise an amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 23). A GSG-F2A peptide may comprise an amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 24). A P2A peptide may comprise an amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising ATNFSLLKQAGDVEENPGP (SEQ ID NO: 25). A GSG-P2A peptide may comprise an amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26) or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity to the amino acid sequence comprising GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 26).

    [0171] The disclosure provides a composition comprising a vector of the disclosure.

    Scaffold Proteins

    [0172] A Centyrin is one example of a protein scaffold of the disclosure. An antigen recognition region of a CAR of the disclosure may comprise at least one protein scaffold.

    [0173] Protein scaffolds of the disclosure may be derived from a fibronectin type III (FN3) repeat protein, encoding or complementary nucleic acids, vectors, host cells, compositions, combinations, formulations, devices, and methods of making and using them. In a preferred embodiment, the protein scaffold is comprised of a consensus sequence of multiple FN3 domains from human Tenascin-C (hereinafter Tenascin). In a further preferred embodiment, the protein scaffold of the present invention is a consensus sequence of 15 FN3 domains. The protein scaffolds of the disclosure can be designed to bind various molecules, for example, a cellular target protein. In a preferred embodiment, the protein scaffolds of the disclosure can be designed to bind an epitope of a wild type and/or variant form of an antigen.

    [0174] Protein scaffolds of the disclosure may include additional molecules or moieties, for example, the Fc region of an antibody, albumin binding domain, or other moiety influencing half-life. In further embodiments, the protein scaffolds of the disclosure may be bound to a nucleic acid molecule that may encode the protein scaffold.

    [0175] The disclosure provides at least one method for expressing at least one protein scaffold based on a consensus sequence of multiple FN3 domains, in a host cell, comprising culturing a host cell as described herein under conditions wherein at least one protein scaffold is expressed in detectable and/or recoverable amounts.

    [0176] The disclosure provides at least one composition comprising (a) a protein scaffold based on a consensus sequence of multiple FN3 domains and/or encoding nucleic acid as described herein; and (b) a suitable and/or pharmaceutically acceptable carrier or diluent.

    [0177] The disclosure provides a method of generating libraries of a protein scaffold based on a fibronectin type III (FN3) repeat protein, preferably, a consensus sequence of multiple FN3 domains and, more preferably, a consensus sequence of multiple FN3 domains from human Tenascin. The library is formed by making successive generations of scaffolds by altering (by mutation) the amino acids or the number of amino acids in the molecules in particular positions in portions of the scaffold, e.g., loop regions. Libraries can be generated by altering the amino acid composition of a single loop or the simultaneous alteration of multiple loops or additional positions of the scaffold molecule. The loops that are altered can be lengthened or shortened accordingly. Such libraries can be generated to include all possible amino acids at each position, or a designed subset of amino acids. The library members can be used for screening by display, such as in vitro or CIS display (DNA, RNA, ribosome display, etc.), yeast, bacterial, and phage display.

    [0178] Protein scaffolds of the disclosure provide enhanced biophysical properties, such as stability under reducing conditions and solubility at high concentrations; they may be expressed and folded in prokaryotic systems, such as E. coli, in eukaryotic systems, such as yeast, and in in vitro transcription/translation systems, such as the rabbit reticulocyte lysate system.

    [0179] The disclosure provides an isolated, recombinant and/or synthetic protein scaffold based on a consensus sequence of fibronectin type III (FN3) repeat protein, including, without limitation, mammalian-derived scaffold, as well as compositions and encoding nucleic acid molecules comprising at least one polynucleotide encoding protein scaffold based on the consensus FN3 sequence. The disclosure further includes, but is not limited to, methods of making and using such nucleic acids and protein scaffolds, including diagnostic and therapeutic compositions, methods and devices.

    [0180] The protein scaffolds of the disclosure offer advantages over conventional therapeutics, such as ability to administer locally, orally, or cross the blood-brain barrier, ability to express in E. Coli allowing for increased expression of protein as a function of resources versus mammalian cell expression ability to be engineered into bispecific or tandem molecules that bind to multiple targets or multiple epitopes of the same target, ability to be conjugated to drugs, polymers, and probes, ability to be formulated to high concentrations, and the ability of such molecules to effectively penetrate diseased tissues and tumors.

    [0181] Moreover, the protein scaffolds possess many of the properties of antibodies in relation to their fold that mimics the variable region of an antibody. This orientation enables the FN3 loops to be exposed similar to antibody complementarity determining regions (CDRs). They should be able to bind to cellular targets and the loops can be altered, e.g., affinity matured, to improve certain binding or related properties.

    [0182] Three of the six loops of the protein scaffold of the disclosure correspond topologically to the complementarity determining regions (CDRs 1-3), i.e., antigen-binding regions, of an antibody, while the remaining three loops are surface exposed in a manner similar to antibody CDRs. These loops span at or about residues 13-16, 22-28, 38-43, 51-54, 60-64, and 75-81 of SEQ ID NO: 1. Preferably, the loop regions at or about residues 22-28, 51-54, and 75-81 are altered for binding specificity and affinity. One or more of these loop regions are randomized with other loop regions and/or other strands maintaining their sequence as backbone portions to populate a library and potent binders can be selected from the library having high affinity for a particular protein target. One or more of the loop regions can interact with a target protein similar to an antibody CDR interaction with the protein.

    [0183] Scaffolds of the disclosure may comprise a single chain antibody (e.g. a scFv). Single chain antibodies of the disclosure may comprise three light chain and three heavy chain CDRs of an antibody. In certain embodiments, the single chain antibodies of the disclosure comprise three light chain and three heavy chain CDRs of an antibody, wherein the complementarity-determining regions (CDRs) of the single chain antibody are human sequences. The disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises at least one single chain antibody (e.g. a scFv); (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain. In certain embodiments, the antigen recognition region may comprise two single chain antibodies (e.g. two scFvs) to produce a bi-specific or tandem CAR. In certain embodiments, the antigen recognition region may comprise three single chain antibodies (e.g. three scFvs) to produce a tri-specific CAR. In certain embodiments, the ectodomain may further comprise a signal peptide. Alternatively, or in addition, in certain embodiments, the ectodomain may further comprise a hinge between the antigen recognition region and the transmembrane domain.

    [0184] Scaffolds of the disclosure may comprise a sequence comprising one or more fragments of an antibody (e.g. a VHH). Sequence comprising one or more fragments of an antibody of the disclosure may comprise two heavy chain variable regions of an antibody. In certain embodiments, the sequence comprises two heavy chain variable regions of an antibody, wherein the complementarity-determining regions (CDRs) of the VHH are human sequences. Scaffolds of the disclosure may comprise a sequence comprising one or more fragments of an antibody (e.g. a VHH). The disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an ectodomain comprising an antigen recognition region, wherein the antigen recognition region comprises at least one a sequence comprising one or more fragments of an antibody (e.g. a VHH); (b) a transmembrane domain, and (c) an endodomain comprising at least one costimulatory domain. In certain embodiments, the antigen recognition region may comprise two sequences comprising one or more fragments of an antibody (e.g. two VHHs) to produce a bi-specific or tandem CAR. In certain embodiments, the antigen recognition region may comprise three sequences comprising one or more fragments of an antibody (e.g. three VHHs) to produce a tri-specific CAR. In certain embodiments, the ectodomain may further comprise a signal peptide. Alternatively, or in addition, in certain embodiments, the ectodomain may further comprise a hinge between the antigen recognition region and the transmembrane domain.

    [0185] Scaffolds of the disclosure may comprise an antibody mimetic.

    [0186] The term antibody mimetic is intended to describe an organic compound that specifically binds a target sequence and has a structure distinct from a naturally-occurring antibody. Antibody mimetics may comprise a protein, a nucleic acid, or a small molecule. The target sequence to which an antibody mimetic of the disclosure specifically binds may be an antigen. Antibody mimetics may provide superior properties over antibodies including, but not limited to, superior solubility, tissue penetration, stability towards heat and enzymes (e.g. resistance to enzymatic degradation), and lower production costs. Exemplary antibody mimetics include, but are not limited to, an affibody, an afflilin, an affimer, an affitin, an alphabody, an anticalin, and avimer (also known as avidity multimer), a DARPin (Designed Ankyrin Repeat Protein), a Fynomer, a Kunitz domain peptide, and a monobody.

    [0187] Affibody molecules of the disclosure comprise a protein scaffold comprising or consisting of one or more alpha helix without any disulfide bridges. Preferably, affibody molecules of the disclosure comprise or consist of three alpha helices. For example, an affibody molecule of the disclosure may comprise an immunoglobulin binding domain. An affibody molecule of the disclosure may comprise the Z domain of protein A.

    [0188] Affilin molecules of the disclosure comprise a protein scaffold produced by modification of exposed amino acids of, for example, either gamma-B crystallin or ubiquitin. Affilin molecules functionally mimic an antibody's affinity to antigen, but do not structurally mimic an antibody. In any protein scaffold used to make an affilin, those amino acids that are accessible to solvent or possible binding partners in a properly-folded protein molecule are considered exposed amino acids. Any one or more of these exposed amino acids may be modified to specifically bind to a target sequence or antigen.

    [0189] Affimer molecules of the disclosure comprise a protein scaffold comprising a highly stable protein engineered to display peptide loops that provide a high affinity binding site for a specific target sequence. Exemplary affimer molecules of the disclosure comprise a protein scaffold based upon a cystatin protein or tertiary structure thereof. Exemplary affimer molecules of the disclosure may share a common tertiary structure of comprising an alpha-helix lying on top of an anti-parallel beta-sheet.

    [0190] Affitin molecules of the disclosure comprise an artificial protein scaffold, the structure of which may be derived, for example, from a DNA binding protein (e.g. the DNA binding protein Sac7d). Affitins of the disclosure selectively bind a target sequence, which may be the entirety or part of an antigen. Exemplary affitins of the disclosure are manufactured by randomizing one or more amino acid sequences on the binding surface of a DNA binding protein and subjecting the resultant protein to ribosome display and selection. Target sequences of affitins of the disclosure may be found, for example, in the genome or on the surface of a peptide, protein, virus, or bacteria. In certain embodiments of the disclosure, an affitin molecule may be used as a specific inhibitor of an enzyme. Affitin molecules of the disclosure may include heat-resistant proteins or derivatives thereof.

    [0191] Alphabody molecules of the disclosure may also be referred to as Cell-Penetrating Alphabodies (CPAB). Alphabody molecules of the disclosure comprise small proteins (typically of less than 10 kDa) that bind to a variety of target sequences (including antigens). Alphabody molecules are capable of reaching and binding to intracellular target sequences. Structurally, alphabody molecules of the disclosure comprise an artificial sequence forming single chain alpha helix (similar to naturally occurring coiled-coil structures). Alphabody molecules of the disclosure may comprise a protein scaffold comprising one or more amino acids that are modified to specifically bind target proteins. Regardless of the binding specificity of the molecule, alphabody molecules of the disclosure maintain correct folding and thermostability.

    [0192] Anticalin molecules of the disclosure comprise artificial proteins that bind to target sequences or sites in either proteins or small molecules. Anticalin molecules of the disclosure may comprise an artificial protein derived from a human lipocalin. Anticalin molecules of the disclosure may be used in place of, for example, monoclonal antibodies or fragments thereof. Anticalin molecules may demonstrate superior tissue penetration and thermostability than monoclonal antibodies or fragments thereof. Exemplary anticalin molecules of the disclosure may comprise about 180 amino acids, having a mass of approximately 20 kDa. Structurally, anticalin molecules of the disclosure comprise a barrel structure comprising antiparallel beta-strands pairwise connected by loops and an attached alpha helix. In preferred embodiments, anticalin molecules of the disclosure comprise a barrel structure comprising eight antiparallel beta-strands pairwise connected by loops and an attached alpha helix.

    [0193] Avimer molecules of the disclosure comprise an artificial protein that specifically binds to a target sequence (which may also be an antigen). Avimers of the disclosure may recognize multiple binding sites within the same target or within distinct targets. When an avimer of the disclosure recognize more than one target, the avimer mimics function of a bi-specific antibody. The artificial protein avimer may comprise two or more peptide sequences of approximately 30-35 amino acids each. These peptides may be connected via one or more linker peptides. Amino acid sequences of one or more of the peptides of the avimer may be derived from an A domain of a membrane receptor. Avimers have a rigid structure that may optionally comprise disulfide bonds and/or calcium. Avimers of the disclosure may demonstrate greater heat stability compared to an antibody.

    [0194] DARPins (Designed Ankyrin Repeat Proteins) of the disclosure comprise genetically-engineered, recombinant, or chimeric proteins having high specificity and high affinity for a target sequence. In certain embodiments, DARPins of the disclosure are derived from ankyrin proteins and, optionally, comprise at least three repeat motifs (also referred to as repetitive structural units) of the ankyrin protein. Ankyrin proteins mediate high-affinity protein-protein interactions. DARPins of the disclosure comprise a large target interaction surface.

    [0195] Fynomers of the disclosure comprise small binding proteins (about 7 kDa) derived from the human Fyn SH3 domain and engineered to bind to target sequences and molecules with equal affinity and equal specificity as an antibody.

    [0196] Kunitz domain peptides of the disclosure comprise a protein scaffold comprising a Kunitz domain. Kunitz domains comprise an active site for inhibiting protease activity. Structurally, Kunitz domains of the disclosure comprise a disulfide-rich alpha+beta fold. This structure is exemplified by the bovine pancreatic trypsin inhibitor. Kunitz domain peptides recognize specific protein structures and serve as competitive protease inhibitors. Kunitz domains of the disclosure may comprise Ecallantide (derived from a human lipoprotein-associated coagulation inhibitor (LACI)).

    [0197] Monobodies of the disclosure are small proteins (comprising about 94 amino acids and having a mass of about 10 kDa) comparable in size to a single chain antibody. These genetically engineered proteins specifically bind target sequences including antigens. Monobodies of the disclosure may specifically target one or more distinct proteins or target sequences. In preferred embodiments, monobodies of the disclosure comprise a protein scaffold mimicking the structure of human fibronectin, and more preferably, mimicking the structure of the tenth extracellular type III domain of fibronectin. The tenth extracellular type III domain of fibronectin, as well as a monobody mimetic thereof, contains seven beta sheets forming a barrel and three exposed loops on each side corresponding to the three complementarity determining regions (CDRs) of an antibody. In contrast to the structure of the variable domain of an antibody, a monobody lacks any binding site for metal ions as well as a central disulfide bond. Multispecific monobodies may be optimized by modifying the loops BC and FG. Monobodies of the disclosure may comprise an adnectin.

    Production and Generation of Scaffold Proteins

    [0198] At least one scaffold protein of the disclosure can be optionally produced by a cell line, a mixed cell line, an immortalized cell or clonal population of immortalized cells, as well known in the art. See, e.g., Ausubel, et al., ed., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, N.Y. (1987-2001); Sambrook, et al., Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor, N.Y. (1989); Harlow and Lane, Antibodies, a Laboratory Manual, Cold Spring Harbor, N.Y. (1989); Colligan, et al., eds., Current Protocols in Immunology, John Wiley & Sons, Inc., NY (1994-2001); Colligan et al., Current Protocols in Protein Science, John Wiley & Sons, NY, N.Y., (1997-2001).

    [0199] Amino acids from a scaffold protein can be altered, added and/or deleted to reduce immunogenicity or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, stability, solubility or any other suitable characteristic, as known in the art.

    [0200] Optionally, scaffold proteins can be engineered with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, the scaffold proteins can be optionally prepared by a process of analysis of the parental sequences and various conceptual engineered products using three-dimensional models of the parental and engineered sequences. Three-dimensional models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate sequences and can measure possible immunogenicity (e.g., Immunofilter program of Xencor, Inc. of Monrovia, Calif.). Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate sequence, i.e., the analysis of residues that influence the ability of the candidate scaffold protein to bind its antigen. In this way, residues can be selected and combined from the parent and reference sequences so that the desired characteristic, such as affinity for the target antigen(s), is achieved. Alternatively, or in addition to, the above procedures, other suitable methods of engineering can be used.

    piggyBac Transposon System

    [0201] The methods of the disclosure produce a modified T.sub.SCM of the disclosure regardless of the method used for introducing an antigen receptor into a primary human T cell of the disclosure. The methods of the disclosure produce a modified T.sub.SCM of the disclosure with greater efficacy and/or a greater abundance, proportion, yield of modified ?T.sub.SCM of the disclosure when the antigen receptor or the therapeutic protein of the disclosure is introduced to the primary human T cell using the piggyBac transposon system. A piggyBac transposon system of the disclosure may comprise a piggyBac transposon comprising an antigen receptor of the disclosure. Preferably, the primary human T cell contacts a piggyBac transposon comprising an antigen receptor of the disclosure and a transposase of the disclosure simultaneously (or in very close temporal proximity, e.g. the primary human T cell, the transposon and the transposase are contained in the same container (such as a cuvette) prior to introduction of the transposon and transposase into the cellhowever they would not be permitted to interact in the absence of the cell. Preferably, the primary human T cell contacts a piggyBac transposon comprising an antigen receptor of the disclosure and a Super piggyBac? (SPB) transposase of the disclosure simultaneously prior to introduction of the transposon and transposase into the cell. In certain preferred embodiments, the Super piggyBac? (SPB) transposase is an mRNA sequence encoding the Super piggyBac? (SPB) transposase.

    [0202] Additional disclosure regarding piggyBac transposons and Super piggyBac? (SPB) transposases may be found in International Patent Publication WO 2010/099296, U.S. Pat. Nos. 8,399,643, 9,546,382, 6,218,185, 6,551,825, 6,962,810, and 7,105,343, the contents of which are each herein incorporated by reference in their entireties.

    [0203] The disclosure provides methods of introducing a polynucleotide construct comprising a DNA sequence into a host cell. Preferably, the introducing steps are mediated by the piggyBac transposon system.

    [0204] In certain embodiments of the methods of the disclosure, the transposon is a plasmid DNA transposon with a sequence encoding the antigen receptor or the therapeutic protein flanked by two cis-regulatory insulator elements. In certain embodiments, the transposon is a piggyBac transposon. In certain embodiments, and, in particular, those embodiments wherein the transposon is a piggyBac transposon, the transposase is a piggyBac? or a Super piggyBac? (SPB) transposase. In certain embodiments, and, in particular, those embodiments wherein the transposase is a Super piggyBac? (SPB) transposase, the sequence encoding the transposase is an mRNA sequence.

    [0205] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac? (PB) transposase enzyme. The piggyBac (PB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00011 (SEQ ID NO: 4) 1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEI SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG 61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTGATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RMYIPNKPSK YGIKILMMCD 301 SGYKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPNEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0206] In certain embodiments of the methods of the disclosure, the transposase enzyme is a piggyBac? (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at one or more of positions 30, 165, 282, or 538 of the sequence:

    TABLE-US-00012 (SEQ ID NO: 4) 1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEI SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG 61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTGATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RMYIPNKPSK YGIKILMMCD 301 SGYKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPNEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0207] In certain embodiments, the transposase enzyme is a piggyBac? (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at two or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 4. In certain embodiments, the transposase enzyme is a piggyBac? (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at three or more of positions 30, 165, 282, or 538 of the sequence of SEQ ID NO: 4. In certain embodiments, the transposase enzyme is a piggyBac? (PB) transposase enzyme that comprises or consists of an amino acid sequence having an amino acid substitution at each of the following positions 30, 165, 282, and 538 of the sequence of SEQ ID NO: 4. In certain embodiments, the amino acid substitution at position 30 of the sequence of SEQ ID NO: 4 is a substitution of a valine (V) for an isoleucine (I). In certain embodiments, the amino acid substitution at position 165 of the sequence of SEQ ID NO: 4 is a substitution of a serine (S) for a glycine (G). In certain embodiments, the amino acid substitution at position 282 of the sequence of SEQ ID NO: 4 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 538 of the sequence of SEQ ID NO: 4 is a substitution of a lysine (K) for an asparagine (N).

    [0208] In certain embodiments of the methods of the disclosure, the transposase enzyme is a Super piggyBac? (SPB) transposase enzyme. In certain embodiments, the Super piggyBac? (SPB) transposase enzymes of the disclosure may comprise or consist of the amino acid sequence of the sequence of SEQ ID NO: 4 wherein the amino acid substitution at position 30 is a substitution of a valine (V) for an isoleucine (I), the amino acid substitution at position 165 is a substitution of a serine (S) for a glycine (G), the amino acid substitution at position 282 is a substitution of a valine (V) for a methionine (M), and the amino acid substitution at position 538 is a substitution of a lysine (K) for an asparagine (N). In certain embodiments, the Super piggyBac? (SPB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00013 (SEQ ID NO: 5) 1 MGSSLDDEHI LSALLQSDDE LVGEDSDSEV SDHVSEDDVQ SDTEEAFIDE VHEVQPTSSG 61 SEILDEQNVI EQPGSSLASN RILTLPQRTI RGKNKHCWST SKSTRRSRVS ALNIVRSQRG 121 PTRMCRNIYD PLLCFKLFFT DEIISEIVKW TNAEISLKRR ESMTSATFRD TNEDEIYAFF 181 GILVMTAVRK DNHMSTDDLF DRSLSMVYVS VMSRDRFDFL IRCLRMDDKS IRPTLRENDV 241 FTPVRKIWDL FIHQCIQNYT PGAHLTIDEQ LLGFRGRCPF RVYIPNKPSK YGIKILMMCD 301 SGTKYMINGM PYLGRGTQTN GVPLGEYYVK ELSKPVHGSC RNITCDNWFT SIPLAKNLLQ 361 EPYKLTIVGT VRSNKREIPE VLKNSRSRPV GTSMFCFDGP LTLVSYKPKP AKMVYLLSSC 421 DEDASINEST GKPQMVMYYN QTKGGVDTLD QMCSVMTCSR KTNRWPMALL YGMINIACIN 481 SFIIYSHNVS SKGEKVQSRK KFMRNLYMSL TSSFMRKRLE APTLKRYLRD NISNILPKEV 541 PGTSDDSTEE PVMKKRTYCT YCPSKIRRKA NASCKKCKKV ICREHNIDMC QSCF.

    [0209] In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac? or Super piggyBac? transposase enzyme may further comprise an amino acid substitution at one or more of positions 3, 46, 82, 103, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 258, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 486, 503, 552, 570 and 591 of the sequence of SEQ ID NO: 4 or SEQ ID NO: 5. In certain embodiments, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac? or Super piggyBac? transposase enzyme may further comprise an amino acid substitution at one or more of positions 46, 119, 125, 177, 180, 185, 187, 200, 207, 209, 226, 235, 240, 241, 243, 296, 298, 311, 315, 319, 327, 328, 340, 421, 436, 456, 470, 485, 503, 552 and 570. In certain embodiments, the amino acid substitution at position 3 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an asparagine (N) for a serine (S). In certain embodiments, the amino acid substitution at position 46 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a serine (S) for an alanine (A). In certain embodiments, the amino acid substitution at position 46 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a threonine (T) for an alanine (A). In certain embodiments, the amino acid substitution at position 82 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a tryptophan (W) for an isoleucine (I). In certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 119 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a proline (P) for an arginine (R). In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an alanine (A) a cysteine (C). In certain embodiments, the amino acid substitution at position 125 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a lysine (K) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 177 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a histidine (H) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an isoleucine (I) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 180 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a valine (V) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 185 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 187 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a glycine (G) for an alanine (A). In certain embodiments, the amino acid substitution at position 200 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a tryptophan (W) for a phenylalanine (F), In certain embodiments, the amino acid substitution at position 207 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a proline (P) for a valine (V). In certain embodiments, the amino acid substitution at position 209 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a phenylalanine (F) for a valine (V). In certain embodiments, the amino acid substitution at position 226 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a phenylalanine (F) for a methionine (M). In certain embodiments, the amino acid substitution at position 235 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an arginine (R) for a leucine (L). In certain embodiments, the amino acid substitution at position 240 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a lysine (K) for a valine (V). In certain embodiments, the amino acid substitution at position 241 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a phenylalanine (F). In certain embodiments, the amino acid substitution at position 243 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a lysine (K) for a proline (P). In certain embodiments, the amino acid substitution at position 258 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a serine (S) for an asparagine (N). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a tryptophan (W) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a tyrosine (Y) for a leucine (L). In certain embodiments, the amino acid substitution at position 296 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a phenylalanine (F) for a leucine (L). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an alanine (A) for a methionine (M). In certain embodiments, the amino acid substitution at position 298 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an isoleucine (I) for a proline (P). In certain embodiments, the amino acid substitution at position 311 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a valine for a proline (P). In certain embodiments, the amino acid substitution at position 315 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a lysine (K) for an arginine (R), In certain embodiments, the amino acid substitution at position 319 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a glycine (G) for a threonine (T). In certain embodiments, the amino acid substitution at position 327 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an arginine (R) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 328 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a valine (V) for a tyrosine (Y). In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a glycine (G) for a cysteine (C). In certain embodiments, the amino acid substitution at position 340 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a cysteine (C). In certain embodiments, the amino acid substitution at position 421 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a histidine (H) for the aspartic acid (D). In certain embodiments, the amino acid substitution at position 436 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an isoleucine (I) for a valine (V). In certain embodiments, the amino acid substitution at position 456 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a tyrosine (Y) for a methionine (M). In certain embodiments, the amino acid substitution at position 470 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a phenylalanine (F) for a leucine (L). In certain embodiments, the amino acid substitution at position 485 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a lysine (K) for a serine (S). In certain embodiments, the amino acid substitution at position 503 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a leucine (L) for a methionine (M). In certain embodiments, the amino acid substitution at position 503 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an isoleucine (I) for a methionine (M). In certain embodiments, the amino acid substitution at position 552 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a lysine (K) for a valine (V). In certain embodiments, the amino acid substitution at position 570 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a threonine (T) for an alanine (A). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a proline (P) for a glutamine (Q). In certain embodiments, the amino acid substitution at position 591 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an arginine (R) for a glutamine (Q).

    [0210] In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac? transposase enzyme may comprise or the Super piggyBac? transposase enzyme may further comprise an amino acid substitution at one or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 4 or SEQ ID NO: 5. In certain embodiments of the methods of the disclosure, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac? transposase enzyme may comprise or the Super piggyBac? transposase enzyme may further comprise an amino acid substitution at two, three, four, five, six or more of positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 4 or SEQ ID NO: 5. In certain embodiments, including those embodiments wherein the transposase comprises the above-described mutations at positions 30, 165, 282 and/or 538, the piggyBac? transposase enzyme may comprise or the Super piggyBac? transposase enzyme may further comprise an amino acid substitution at positions 103, 194, 372, 375, 450, 509 and 570 of the sequence of SEQ ID NO: 4 or SEQ ID NO: 5. In certain embodiments, the amino acid substitution at position 103 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a proline (P) for a serine (S). In certain embodiments, the amino acid substitution at position 194 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a valine (V) for a methionine (M). In certain embodiments, the amino acid substitution at position 372 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an alanine (A) for an arginine (R). In certain embodiments, the amino acid substitution at position 375 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an alanine (A) for a lysine (K). In certain embodiments, the amino acid substitution at position 450 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of an asparagine (N) for an aspartic acid (D). In certain embodiments, the amino acid substitution at position 509 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a glycine (G) for a serine (S). In certain embodiments, the amino acid substitution at position 570 of SEQ ID NO: 4 or SEQ ID NO: 5 is a substitution of a serine (S) for an asparagine (N). In certain embodiments, the piggyBac? transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 4. In certain embodiments, including those embodiments wherein the piggyBac? transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 4, the piggyBac? transposase enzyme may further comprise an amino acid substitution at positions 372, 375 and 450 of the sequence of SEQ ID NO: 4 or SEQ ID NO: 5. In certain embodiments, the piggyBac? transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 4, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 4, and a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 4. In certain embodiments, the piggyBac? transposase enzyme may comprise a substitution of a valine (V) for a methionine (M) at position 194 of SEQ ID NO: 4, a substitution of an alanine (A) for an arginine (R) at position 372 of SEQ ID NO: 4, a substitution of an alanine (A) for a lysine (K) at position 375 of SEQ ID NO: 4 and a substitution of an asparagine (N) for an aspartic acid (D) at position 450 of SEQ ID NO: 4.

    [0211] By introducing is intended presenting to the plant the polynucleotide construct in such a manner that the construct gains access to the interior of the host cell. The methods of the invention do not depend on a particular method for introducing a polynucleotide construct into a host cell, only that the polynucleotide construct gains access to the interior of one cell of the host. Methods for introducing polynucleotide constructs into bacteria, plants, fungi and animals are known in the art including, but not limited to, stable transformation methods, transient transformation methods, and virus-mediated methods.

    [0212] As used throughout the disclosure, the term endogenous refers to nucleic acid or protein sequence naturally associated with a target gene or a host cell into which it is introduced.

    [0213] By stable transformation is intended that the polynucleotide construct introduced into a plant integrates into the genome of the host and is capable of being inherited by progeny thereof.

    [0214] By transient transformation is intended that a polynucleotide construct introduced into the host does not integrate into the genome of the host.

    [0215] In preferred embodiments, the piggyBac transposon system is used to introduce exogenous sequences into a primary human T cell by stable transformation to generate a modified T.sub.SCM or T.sub.CM.

    Additional Transposon Systems

    [0216] In certain embodiments of the methods of the disclosure, the transposon is a Sleeping Beauty transposon. In certain embodiments, and, in particular, those embodiments wherein the transposon is a Sleeping Beauty transposon, the transposase is a Sleeping Beauty transposase or a hyperactive Sleeping Beauty transposase (SB100X).

    [0217] The disclosure provides a method of producing a modified stem memory T-cell (T.sub.SCM) or a modified central memory T-cell (T.sub.CM), comprising introducing into a primary human T cell (a) a transposon composition comprising a transposon comprising an antigen receptor or a therapeutic protein and (b) a transposase composition comprising a transposase or a sequence encoding the transposase; to produce a modified T cell, wherein the modified T cell expresses one or more cell-surface marker(s) of a modified stem memory T-cell (T.sub.SCM) or a modified central memory T-cell (T.sub.CM), thereby producing a modified stem memory T-cell (T.sub.SCM) or a modified central memory T-cell (T.sub.CM). The disclosure provides a method of producing a plurality of modified stem memory T-cells (T.sub.SCM) or a plurality of modified central memory T-cells (T.sub.CM), comprising introducing into a plurality of primary human T cells (a) a transposon composition comprising a transposon comprising an antigen receptor and (b) a transposase composition comprising a transposase or a sequence encoding the transposase; to produce a plurality of modified T cells, wherein at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between of the plurality of modified T cells expresses one or more cell-surface marker(s) of a stem memory T-cell (T.sub.SCM) or a central memory T-cell (T.sub.CM), thereby producing a plurality of modified stem memory T-cells (T.sub.SCM) or a plurality of modified central memory T-cells (T.sub.CM).

    [0218] In certain embodiments of the methods of the disclosure, the transposon is a Sleeping Beauty transposon. In certain embodiments, and, in particular, those embodiments wherein the transposon is a Sleeping Beauty transposon, the transposase is a Sleeping Beauty transposase or a hyperactive Sleeping Beauty transposase (SB100X).

    [0219] In certain embodiments of the methods of the disclosure, the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00014 (SEQ ID NO: 6) 1 MGKSKEISQD LRKKIVDLHK SGSSLGAISK RLKVPRSSVQ TIVRKYKHHG TTQPSYRSGR 61 RRYLSPRDER TLVRKVQINP RTTAKDLVKM LEETGTKVSI STVKRVLYRH NLKGRSARKK 121 PLLQNRHKKA RLRFATAHGD KDRTFWRNVL WSDETKIELF GHNDHRYVWR KKGEACKPKN 181 TIPTVKHGGG SIMLWGCFAA GGTGALHKID GIMRKENYVD ILKQHLKTSV RKLKLGRKWV 241 FQMDNDPKHT SKVVAKWLKD NKVKVLEWPS QSPDLNPIEN LWAELKKRVR ARRPTNLTQL 301 HQLCQEEWAK IHPTYCGKLV EGYPKRLTQV KQFKGNATKY.

    [0220] In certain embodiments of the methods of the disclosure, the hyperactive Sleeping Beauty (SB100X) transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to:

    TABLE-US-00015 (SEQ ID NO: 7) 1 MGKSKEISQD LRKRIVDLHK SGSSLGAISK RLAVPRSSVQ TIVRKYKHHG TTQPSYRSGR 61 RRYLSPRDER TLVRKVQINP RTTAKDLVKM LEETGTKVSI STVKRVLYRH NLKGHSARKK 121 PLLQNRHKKA RLRFATAHGD KDRTFWRNVL WSDETKIELF GHNDHRYVWR KKGEACKPKN 181 TIPTVKHGGG SIMLWGCFAA GGTGALHKID GIMDAVQYVD ILKQHLKTSV RKLKLGRKWV 241 FQHDNDPKHT SKVVAKWLKD NKVKVLEWPS QSPDLNPIEN LWAELKKRVR ARRPTNLTQL 301 HQLCQEEWAK IHPNYCGKLV EGYPKRLTQV KQFKGNATKY.

    [0221] In certain embodiments of the methods of the disclosure, the transposase is a Helitron transposase. Helitron transposases mobilize the Helraiser transposon, an ancient element from the bat genome that was active about 30 to 36 million years ago. An exemplary Helraiser transposon of the disclosure includes Helibat1, which comprises a nucleic acid sequence comprising:

    TABLE-US-00016 (SEQ ID NO: 27) 1 TCCTATATAA TAAAAGAGAA ACATGCAAAT TGACCATCCC TCCGCTACGC TCAAGCCACG 61 CCCACCAGCC AATCAGAAGT GACTATGCAA ATTAACCCAA CAAAGATGGC AGTTAAATTT 121 GCATACGCAG GTGTCAAGCG CCCCAGGAGG CAACGGCGGC CGCGGGCTCC CAGGACCTTC 181 GCTGGCCCCG GGAGGCGAGG CCGGCCGCGC CTAGCCACAC CCGCGGGCTC CCGGGACCTT 241 CGCCAGCAGA GAGCAGAGCG GGAGAGCGGG CGGAGAGCGG GAGGTTTGGA GGACTTGGCA 301 GAGCAGGAGG CCGCTGGACA TAGAGCAGAG CGAGAGAGAG GGTGGCTTGG AGGGCGTGGC 361 TCCCTCTGTC ACCCCAGCTT CCTCATCACA GCTGTGGAAA CTGACAGCAG GGAGGAGGAA 421 GTCCCACCCC CACAGAATCA GCCAGAATCA GCCGTTGGTC AGACAGCTCT CAGCGGCCTG 481 ACAGCCAGGA CTCTCATTCA CCTGCATCTC AGACCGTGAC AGTAGAGAGG TGGGACTATG 541 TCTAAAGAAC AACTGTTGAT ACAACGTAGC TCTGCAGCCG AAAGATGCCG GCGTTATCGA 601 CAGAAAATGT CTGCAGAGCA ACGTGCGTCT GATCTTGAAA GAAGGCGGCG CCTGCAACAG 661 AATGTATCTG AAGAGCAGCT ACTGGAAAAA CGTCGCTCTG AAGCCGAAAA ACAGCGGCGT 721 CATCGACAGA AAATGTCTAA AGACCAACGT GCCTTTGAAG TTGAAAGAAG GCGGTGGCGA 781 CGACAGAATA TGTCTAGAGA ACAGTCATCA ACAAGTACTA CCAATACCGG TAGGAACTGC 841 CTTCTCAGCA AAAATGGAGT ACATGAGGAT GCAATTCTCG AACATAGTTG TGGTGGAATG 901 ACTGTTCGAT GTGAATTTTG CCTATCACTA AATTTCTCTG ATGAAAAACC ATCCGATGGG 961 AAATTTACTC GATGTTGTAG CAAAGGGAAA GTCTGTCCAA ATGATATACA TTTTCCAGAT 1021 TACCCGGCAT ATTTAAAAAG ATTAATGACA AACGAAGATT CTGACAGTAA AAATTTCATG 1081 GAAAATATTC GTTCCATAAA TAGTTCTTTT GCTTTTGCTT CCATGGGTGC AAATATTGCA 1141 TCGCCATCAG GATATGGGCC ATACTGTTTT AGAATACACG GACAAGTTTA TCACCGTACT 1201 GGAACTTTAC ATCCTTCGGA TGGTGTTTCT CGGAAGTTTG CTCAACTCTA TATTTTGGAT 1261 ACAGCCGAAG CTACAAGTAA AAGATTAGCA ATGCCAGAAA ACCAGGGCTG CTCAGAAAGA 1321 CTCATGATCA ACATCAACAA CCTCATGCAT GAAATAAATG AATTAACAAA ATCGTACAAG 1381 ATGCTACATG AGGTAGAAAA GGAAGCCCAA TCTGAAGCAG CAGCAAAAGG TATTGCTCCC 1441 ACAGAAGTAA CAATGGCGAT TAAATACGAT CGTAACAGTG ACCCAGGTAG ATATAATTCT 1501 CCCCGTGTAA CCGAGGTTGC TGTCATATTC AGAAACGAAG ATGGAGAACC TCCTTTTGAA 1561 AGGGACTTGC TCATTCATTG TAAACCAGAT CCCAATAATC CAAATGCCAC TAAAATGAAA 1621 CAAATCAGTA TCCTGTTTCC TACATTAGAT GCAATGACAT ATCCTATTCT TTTTCCACAT 1681 GGTGAAAAAG GCTGGGGAAC AGATATTGCA TTAAGACTCA GAGACAACAG TGTAATCGAC 1741 AATAATACTA GACAAAATGT AAGGACACGA GTCACACAAA TGCAGTATTA TGGATTTCAT 1801 CTCTCTGTGC GGGACACGTT CAATCCTATT TTAAATGCAG GAAAATTAAC TCAACAGTTT 1861 ATTGTGGATT CATATTCAAA AATGGAGGCC AATCGGATAA ATTTCATCAA AGCAAACCAA 1921 TCTAAGTTGA GAGTTGAAAA ATATAGTGGT TTGATGGATT ATCTCAAATC TAGATCTGAA 1981 AATGACAATG TGCCGATTGG TAAAATGATA ATACTTCCAT CATCTTTTGA GGGTAGTCCC 2041 AGAAATATGC AGCAGCGATA TCAGGATGCT ATGGCAATTG TAACGAAGTA TGGCAAGCCC 2101 GATTTATTCA TAACCATGAC ATGCAACCCC AAATGGGCAG ATATTACAAA CAATTTACAA 2161 CGCTGGCAAA AAGTTGAAAA CAGACCTGAC TTGGTAGCCA GAGTTTTTAA TATTAAGCTG 2221 AATGCTCTTT TAAATGATAT ATGTAAATTC CATTTATTTG GCAAAGTAAT AGCTAAAATT 2281 CATGTCATTG AATTTCAGAA ACGCGGACTG CCTCACGCTC ACATATTATT GATATTAGAT 2341 AGTGAGTCCA AATTACGTTC AGAAGATGAC ATTGACCGTA TAGTTAAGGC AGAAATTCCA 2401 GATGAAGACC AGTGTCCTCG ACTTTTTCAA ATTGTAAAAT CAAATATGGT ACATGGACCA 2461 TGTGGAATAC AAAATCCAAA TAGTCCATGT ATGGAAAATG GAAAATGTTC AAAGGGATAT 2521 CCAAAAGAAT TTCAAAATGC GACCATTGGA AATATTGATG GATATCCCAA ATACAAACGA 2581 AGATCTGGTA GCACCATGTC TATTGGAAAT AAAGTTGTCG ATAACACTTG GATTGTCCCT 2641 TATAACCCGT ATTTGTGCCT TAAATATAAC TGTCATATAA ATGTTGAAGT CTGTGCATCA 2701 ATTAAAAGTG TCAAATATTT ATTTAAATAC ATCTATAAAG GGCACGATTG TGCAAATATT 2761 CAAATTTCTG AAAAAAATAT TATCAATCAT GACGAAGTAC AGGACTTCAT TGACTCCAGG 2821 TATGTGAGCG CTCCTGAGGC TGTTTGGAGA CTTTTTGCAA TGCGAATGCA TGACCAATCT 2881 CATGCAATCA CAAGATTAGC TATTCATTTG CCAAATGATC AGAATTTGTA TTTTCATACC 2941 GATGATTTTG CTGAAGTTTT AGATAGGGCT AAAAGGCATA ACTCGACTTT GATGGCTTGG 3001 TTCTTATTGA ATAGAGAAGA TTCTGATGCA CGTAATTATT ATTATTGGGA GATTCCACAG 3061 CATTATGTGT TTAATAATTC TTTGTGGACA AAACGCCGAA AGGGTGGGAA TAAAGTATTA 3121 GGTAGACTGT TCACTGTGAG CTTTAGAGAA CCAGAACGAT ATTACCTTAG ACTTTTGCTT 3181 CTGCATGTAA AAGGTGCGAT AAGTTTTGAG GATCTGCGAA CTGTAGGAGG TGTAACTTAT 3241 GATACATTTC ATGAAGCTGC TAAACACCGA GGATTATTAC TTGATGACAC TATCTGGAAA 3301 GATACGATTG ACGATGCAAT CATCCTTAAT ATGCCCAAAC AACTACGGCA ACTTTTTGCA 3361 TATATATGTG TGTTTGGATG TCCTTCTGCT GCAGACAAAT TATGGGATGA GAATAAATCT 3421 CATTTTATTG AAGATTTCTG TTGGAAATTA CACCGAAGAG AAGGTGCCTG TGTGAACTGT 3481 GAAATGCATG CCCTTAACGA AATTCAGGAG GTATTCACAT TGCATGGAAT GAAATGTTCA 3541 CATTTCAAAC TTCCGGACTA TCCTTTATTA ATGAATGCAA ATACATGTGA TCAATTGTAC 3601 GAGCAACAAC AGGCAGAGGT TTTGATAAAT TCTCTGAATG ATGAACAGTT GGCAGCCTTT 3661 CAGACTATAA CTTCAGCCAT CGAAGATCAA ACTGTACACC CCAAATGCTT TTTCTTGGAT 3721 GGTCCAGGTG GTAGTGGAAA AACATATCTG TATAAAGTTT TAACACATTA TATTAGAGGT 3781 CGTGGTGGTA CTGTTTTACC CACAGCATCT ACAGGAATTG CTGCAAATTT ACTTCTTGGT 3841 GGAAGAACCT TTCATTCCCA ATATAAATTA CCAATTCCAT TAAATGAAAC TTCAATTTCT 3901 AGACTCGATA TAAAGAGTGA AGTTGCTAAA ACCATTAAAA AGGCCCAACT TCTCATTATT 3961 GATGAATGCA CCATGGCATC CAGTCATGCT ATAAACGCCA TAGATAGATT ACTAAGAGAA 4021 ATTATGAATT TGAATGTTGC ATTTGGTGGG AAAGTTCTCC TTCTCGGAGG GGATTTTCGA 4081 CAATGTCTCA GTATTGTACC ACATGCTATG CGATCGGCCA TAGTACAAAC GAGTTTAAAG 4141 TACTGTAATG TTTGGGGATG TTTCAGAAAG TTGTCTCTTA AAACAAATAT GAGATCAGAG 4201 GATTCTGCTT ATAGTGAATG GTTAGTAAAA CTTGGAGATG GCAAACTTGA TAGCAGTTTT 4261 CATTTAGGAA TGGATATTAT TGAAATCCCC CATGAAATGA TTTGTAACGG ATCTATTATT 4321 GAAGCTACCT TTGGAAATAG TATATCTATA GATAATATTA AAAATATATC TAAACGTGCA 4381 ATTCTTTGTC CAAAAAATGA GCATGTTCAA AAATTAAATG AAGAAATTTT GGATATACTT 4441 GATGGAGATT TTCACACATA TTTGAGTGAT GATTCCATTG ATTCAACAGA TGATGCTGAA 4501 AAGGAAAATT TTCCCATCGA ATTTCTTAAT AGTATTACTC CTTCGGGAAT GCCGTGTCAT 4561 AAATTAAAAT TGAAAGTGGG TGCAATCATC ATGCTATTGA GAAATCTTAA TAGTAAATGG 4621 GGTCTTTGTA ATGGTACTAG ATTTATTATC AAAAGATTAC GACCTAACAT TATCGAAGCT 4681 GAAGTATTAA CAGGATCTGC AGAGGGAGAG GTTGTTCTGA TTCCAAGAAT TGATTTGTCC 4741 CCATCTGACA CTGGCCTCCC ATTTAAATTA ATTCGAAGAC AGTTTCCCGT GATGCCAGCA 4801 TTTGCGATGA CTATTAATAA ATCACAAGGA CAAACTCTAG ACAGAGTAGG AATATTCCTA 4861 CCTGAACCCG TTTTCGCACA TGGTCAGTTA TATGTTGCTT TCTCTCGAGT TCGAAGAGCA 4921 TGTGACGTTA AAGTTAAAGT TGTAAATACT TCATCACAAG GGAAATTAGT CAAGCACTCT 4981 GAAAGTGTTT TTACTCTTAA TGTGGTATAC AGGGAGATAT TAGAATAAGT TTAATCACTT 5041 TATCAGTCAT TGTTTGCATC AATGTTGTTT TTATATCATG TTTTTGTTGT TTTTATATCA 5101 TGTCTTTGTT GTTGTTATAT CATGTTGTTA TTGTTTATTT ATTAATAAAT TTATGTATTA 5161 TTTTCATATA CATTTTACTC ATTTCCTTTC ATCTCTCACA CTTCTATTAT AGAGAAAGGG 5221 CAAATAGCAA TATTAAAATA TTTCCTCTAA TTAATTCCCT TTCAATGTGC ACGAATTTCG 5281 TGCACCGGGC CACTAG.

    [0222] Unlike other transposases, the Helitron transposase does not contain an RNase-H like catalytic domain, but instead comprises a RepHel motif made up of a replication initiator domain (Rep) and a DNA helicase domain. The Rep domain is a nuclease domain of the HUH superfamily of nucleases.

    [0223] An exemplary Helitron transposase of the disclosure comprises an amino acid sequence comprising:

    TABLE-US-00017 (SEQ ID NO: 28) 1 MSKEQLLIQR SSAAERCRRY RQKMSAEQRA SDLERRRRLQ QNVSEEQLLE KRRSEAEKQR 61 RHRQKMSKDQ RAFEVERRRW RRQNMSREQS STSTTNTGRN CLLSKNGVHE DAILEHSCGG 121 MTVRCEFCLS LNFSDEKPSD GKFTRCCSKG KVCPNDIHFP DYPAYLKRLM TNEDSDSKNF 181 MENIRSINSS FAFASMGANI ASPSGYGPYC FRIHGQVYHR TGTLHPSDGV SRKFAQLYIL 241 DTAEATSKRL AMPENQGCSE RLMININNLM HEINELTKSY KMLHEVEKEA QSEAAAKGIA 301 PTEVTMAIKY DRNSDPGRYN SPRVTEVAVI FRNEDGEPPF ERDLLIHCKP DPNNPNATKM 361 KQISILFPTL DAMTYPILFP HGEKGWGTDI ALRLRDNSVI DNNTRQNVRT RVTQMQYYGF 421 HLSVRDTFNP ILNAGKLTQQ FIVDSYSKME ANRINFIKAN QSKLRVEKYS GLMDYLKSRS 481 ENDNVPIGKM IILPSSFEGS PRNMQQRYQD AMAIVTKYGK PDLFITMTCN PKWADITNNL 541 QRWQKVENRP DLVARVFNIK LNALLNDICK FHLFGKVIAK IHVIEFQKRG LPHAHILLIL 601 DSESKLRSED DIDRIVKAEI PDEDQCPRLF QIVKSNMVHG PCGIQNPNSP CMENGKCSKG 661 YPKEFQNATI GNIDGYPKYK RRSGSTMSIG NKVVDNTWIV PYNPYLCLKY NCHINVEVCA 721 SIKSVKYLFK YIYKGHDCAN IQISEKNIIN HDEVQDFIDS RYVSAPEAVW RLFAMRMHDQ 781 SHAITRLAIH LPNDQNLYFH TDDFAEVLDR AKRHNSTLMA WFLLNREDSD ARNYYYWEIP 841 QHYVFNNSLW TKRRKGGNKV LGRLFTVSFR EPERYYLRLL LLHVKGAISF EDLRTVGGVT 901 YDTFHEAAKH RGLLLDDTIW KDTIDDAIIL NMPKQLRQLF AYICVFGCPS AADKLWDENK 961 SHFIEDFCWK LHRREGACVN CEMHALNEIQ EVFTLHGMKC SHFKLPDYPL LMNANTCDQL 1021 YEQQQAEVLI NSLNDEQLAA FQTITSAIED QTVHPKCFFL DGPGGSGKTY LYKVLTHYIR 1081 GRGGTVLPTA STGIAANLLL GGRTFHSQYK LPIPLNETSI SRLDIKSEVA KTIKKAQLLI 1141 IDECTMASSH AINAIDRLLR EIMNLNVAFG GKVLLLGGDF RQCLSIVPHA MRSAIVQTSL 1201 KYCNVWGCFR KLSLKTNMRS EDSAYSEWLV KLGDGKLDSS FHLGMDIIEI PHEMICNGSI 1261 IEATFGNSIS IDNIKNISKR AILCPKNEHV QKLNEEILDI LDGDFHTYLS DDSIDSTDDA 1321 EKENFPIEFL NSITPSGMPC HKLKLKVGAI IMLLRNLNSK WGLCNGTRFI IKRLRPNIIE 1381 AEVLTGSAEG EVVLIPRIDL SPSDTGLPFK LIRRQFPVMP AFAMTINKSQ GQTLDRVGIF 1441 LPEPVFAHGQ LYVAFSRVRR ACDVKVKVVN TSSQGKLVKH SESVFTLNVV YREILE.

    [0224] In Helitron transpositions, a hairpin close to the 3 end of the transposon functions as a terminator. However, this hairpin can be bypassed by the transposase, resulting in the transduction of flanking sequences. In addition, Helraiser transposition generates covalently closed circular intermediates. Furthermore, Helitron transpositions can lack target site duplications. In the Helraiser sequence, the transposase is flanked by left and right terminal sequences termed LTS and RTS. These sequences terminate with a conserved 5-TC/CTAG-3 motif. A 19 bp palindromic sequence with the potential to form the hairpin termination structure is located 11 nucleotides upstream of the RTS and consists of the sequence

    TABLE-US-00018 (SEQ ID NO: 29) GTGCACGAATTTCGTGCACCGGGCCACTAG.

    [0225] In certain embodiments of the methods of the disclosure, the transposase is a Tol2 transposase. Tol2 transposons may be isolated or derived from the genome of the medaka fish, and may be similar to transposons of the hAT family. Exemplary Tol2 transposons of the disclosure are encoded by a sequence comprising about 4.7 kilobases and contain a gene encoding the Tol2 transposase, which contains four exons. An exemplary Tol2 transposase of the disclosure comprises an amino acid sequence comprising the following:

    TABLE-US-00019 (SEQ ID NO: 30) 1 MEEVCDSSAA ASSTVQNQPQ DQEHPWPYLR EFFSLSGVNK DSFKMKCVLC LPLNKEISAF 61 KSSPSNLRKH IERMHPNYLK NYSKLTAQKR KIGTSTHASS SKQLKVDSVF PVKHVSPVTV 121 NKAILRYIIQ GLHPFSTVDL PSFKELISTL QPGISVITRP TLRSKIAEAA LIMKQKVTAA 181 MSEVEWIATT TDCWTARRKS FIGVTAHWIN PGSLERHSAA LACKRLMGSH TFEVLASAMN 241 DIHSEYEIRD KVVCTTTDSG SNFMKAFRVF GVENNDIETE ARRCESDDTD SEGCGEGSDG 301 VEFQDASRVL DQDDGFEFQL PKHQKCACHL LNLVSSVDAQ KALSNEHYKK LYRSVFGKCQ 361 ALWNKSSRSA LAAEAVESES RLQLLRPNQT RWNSTFMAVD RILQICKEAG EGALRNICTS 421 LEVPMFNPAE MLFLTEWANT MRPVAKVLDI LQAETNTQLG WLLPSVHQLS LKLQRLHHSL 481 RYCDPLVDAL QQGIQTRFKH MFEDPEIIAA AILLPKFRTS WTNDETIIKR GMDYIRVHLE 541 PLDHKKELAN SSSDDEDFFA SLKPTTHEAS KELDGYLACV SDTRESLLTF PAICSLSIKT 601 NTPLPASAAC ERLFSTAGLL FSPKRARLDT NNFENQLLLK LNLRFYNFE.

    [0226] An exemplary Tol2 transposon of the disclosure, including inverted repeats, subterminal sequences and the Tol2 transposase, is encoded by a nucleic acid sequence comprising the following:

    TABLE-US-00020 (SEQ ID NO: 31) 1 CAGAGGTGTA AAGTACTTGA GTAATTTTAC TTGATTACTG TACTTAAGTA TTATTTTTGG 61 GGATTTTTAC TTTACTTGAG TACAATTAAA AATCAATACT TTTACTTTTA CTTAATTACA 121 TTTTTTTAGA AAAAAAAGTA CTTTTTACTC CTTACAATTT TATTTACAGT CAAAAAGTAC 181 TTATTTTTTG GAGATCACTT CATTCTATTT TCCCTTGCTA TTACCAAACC AATTGAATTG 241 CGCTGATGCC CAGTTTAATT TAAATGTTAT TTATTCTGCC TATGAAAATC GTTTTCACAT 301 TATATGAAAT TGGTCAGACA TGTTCATTGG TCCTTTGGAA GTGACGTCAT GTCACATCTA 361 TTACCACAAT GCACAGCACC TTGACCTGGA AATTAGGGAA ATTATAACAG TCAATCAGTG 421 GAAGAAAATG GAGGAAGTAT GTGATTCATC AGCAGCTGCG AGCAGCACAG TCCAAAATCA 481 GCCACAGGAT CAAGAGCACC CGTGGCCGTA TCTTCGCGAA TTCTTTTCTT TAAGTGGTGT 541 AAATAAAGAT TCATTCAAGA TGAAATGTGT CCTCTGTCTC CCGCTTAATA AAGAAATATC 601 GGCCTTCAAA AGTTCGCCAT CAAACCTAAG GAAGCATATT GAGGTAAGTA CATTAAGTAT 661 TTTGTTTTAC TGATAGTTTT TTTTTTTTTT TTTTTTTTTT TTTTTGGGTG TGCATGTTTT 721 GACGTTGATG GCGCGCCTTT TATATGTGTA GTAGGCCTAT TTTCACTAAT GCATGCGATT 781 GACAATATAA GGCTCACGTA ATAAAATGCT AAAATGCATT TGTAATTGGT AACGTTAGGT 841 CCACGGGAAA TTTGGCGCCT ATTGCAGCTT TGAATAATCA TTATCATTCC GTGCTCTCAT 901 TGTGTTTGAA TTCATGCAAA ACACAAGAAA ACCAAGCGAG AAATTTTTTT CCAAACATGT 961 TGTATTGTCA AAACGGTAAC ACTTTACAAT GAGGTTGATT AGTTCATGTA TTAACTAACA 1021 TTAAATAACC ATGAGCAATA CATTTGTTAC TGTATCTGTT AATCTTTGTT AACGTTAGTT 1081 AATAGAAATA CAGATGTTCA TTGTTTGTTC ATGTTAGTTC ACAGTGCATT AACTAATGTT 1141 AACAAGATAT AAAGTATTAG TAAATGTTGA AATTAACATG TATACGTGCA GTTCATTATT 1201 AGTTCATGTT AACTAATGTA GTTAACTAAC GAACCTTATT GTAAAAGTGT TACCATCAAA 1261 ACTAATGTAA TGAAATCAAT TCACCCTGTC ATGTCAGCCT TACAGTCCTG TGTTTTTGTC 1321 AATATAATCA GAAATAAAAT TAATGTTTGA TTGTCACTAA ATGCTACTGT ATTTCTAAAA 1381 TCAACAAGTA TTTAACATTA TAAAGTGTGC AATTGGCTGC AAATGTCAGT TTTATTAAAG 1441 GGTTAGTTCA CCCAAAAATG AAAATAATGT CATTAATGAC TCGCCCTCAT GTCGTTCCAA 1501 GCCCGTAAGA CCTCCGTTCA TCTTCAGAAC ACAGTTTAAG ATATTTTAGA TTTAGTCCGA 1561 GAGCTTTCTG TGCCTCCATT GAGAATGTAT GTACGGTATA CTGTCCATGT CCAGAAAGGT 1621 AATAAAAACA TCAAAGTAGT CCATGTGACA TCAGTGGGTT AGTTAGAATT TTTTGAAGCA 1681 TCGAATACAT TTTGGTCCAA AAATAACAAA ACCTACGACT TTATTCGGCA TTGTATTCTC 1741 TTCCGGGTCT GTTGTCAATC CGCGTTCACG ACTTCGCAGT GACGCTACAA TGCTGAATAA 1801 AGTCGTAGGT TTTGTTATTT TTGGACCAAA ATGTATTTTC GATGCTTCAA ATAATTCTAC 1861 CTAACCCACT GATGTCACAT GGACTACTTT GATGTTTTTA TTACCTTTCT GGACATGGAC 1921 AGTATACCGT ACATACATTT TCAGTGGAGG GACAGAAAGC TCTCGGACTA AATCTAAAAT 1981 ATCTTAAACT GTGTTCCGAA GATGAACGGA GGTGTTACGG GCTTGGAACG ACATGAGGGT 2041 GAGTCATTAA TGACATCTTT TCATTTTTGG GTGAACTAAC CCTTTAATGC TGTAATCAGA 2101 GAGTGTATGT GTAATTGTTA CATTTATTGC ATACAATATA AATATTTATT TGTTGTTTTT 2161 ACAGAGAATG CACCCAAATT ACCTCAAAAA CTACTCTAAA TTGACAGCAC AGAAGAGAAA 2221 GATCGGGACC TCCACCCATG CTTCCAGCAG TAAGCAACTG AAAGTTGACT CAGTTTTCCC 2281 AGTCAAACAT GTGTCTCCAG TCACTGTGAA CAAAGCTATA TTAAGGTACA TCATTCAAGG 2341 ACTTCATCCT TTCAGCACTG TTGATCTGCC ATCATTTAAA GAGCTGATTA GTACACTGCA 2401 GCCTGGCATT TCTGTCATTA CAAGGCCTAC TTTACGCTCC AAGATAGCTG AAGCTGCTCT 2461 GATCATGAAA CAGAAAGTGA CTGCTGCCAT GAGTGAAGTT GAATGGATTG CAACCACAAC 2521 GGATTGTTGG ACTGCACGTA GAAAGTCATT CATTGGTGTA ACTGCTCACT GGATCAACCC 2581 TGGAAGTCTT GAAAGACATT CCGCTGCACT TGCCTGCAAA AGATTAATGG GCTCTCATAC 2641 TTTTGAGGTA CTGGCCAGTG CCATGAATGA TATCCACTCA GAGTATGAAA TACGTGACAA 2701 GGTTGTTTGC ACAACCACAG ACAGTGGTTC CAACTTTATG AAGGCTTTCA GAGTTTTTGG 2761 TGTGGAAAAC AATGATATCG AGACTGAGGC AAGAAGGTGT GAAAGTGATG ACACTGATTC 2821 TGAAGGCTGT GGTGAGGGAA GTGATGGTGT GGAATTCCAA GATGCCTCAC GAGTCCTGGA 2881 CCAAGACGAT GGCTTCGAAT TCCAGCTACC AAAACATCAA AAGTGTGCCT GTCACTTACT 2941 TAACCTAGTC TCAAGCGTTG ATGCCCAAAA AGCTCTCTCA AATGAACACT ACAAGAAACT 3001 CTACAGATCT GTCTTTGGCA AATGCCAAGC TTTATGGAAT AAAAGCAGCC GATCGGCTCT 3061 AGCAGCTGAA GCTGTTGAAT CAGAAAGCCG GCTTCAGCTT TTAAGGCCAA ACCAAACGCG 3121 GTGGAATTCA ACTTTTATGG CTGTTGACAG AATTCTTCAA ATTTGCAAAG AAGCAGGAGA 3181 AGGCGCACTT CGGAATATAT GCACCTCTCT TGAGGTTCCA ATGTAAGTGT TTTTCCCCTC 3241 TATCGATGTA AACAAATGTG GGTTGTTTTT GTTTAATACT CTTTGATTAT GCTGATTTCT 3301 CCTGTAGGTT TAATCCAGCA GAAATGCTGT TCTTGACAGA GTGGGCCAAC ACAATGCGTC 3361 CAGTTGCAAA AGTACTCGAC ATCTTGCAAG CGGAAACGAA TACACAGCTG GGGTGGCTGC 3421 TGCCTAGTGT CCATCAGTTA AGCTTGAAAC TTCAGCGACT CCACCATTCT CTCAGGTACT 3481 GTGACCCACT TGTGGATGCC CTACAACAAG GAATCCAAAC ACGATTCAAG CATATGTTTG 3541 AAGATCCTGA GATCATAGCA GCTGCCATCC TTCTCCCTAA ATTTCGGACC TCTTGGACAA 3601 ATGATGAAAC CATCATAAAA CGAGGTAAAT GAATGCAAGC AACATACACT TGACGAATTC 3661 TAATCTGGGC AACCTTTGAG CCATACCAAA ATTATTCTTT TATTTATTTA TTTTTGCACT 3721 TTTTAGGAAT GTTATATCCC ATCTTTGGCT GTGATCTCAA TATGAATATT GATGTAAAGT 3781 ATTCTTGCAG CAGGTTGTAG TTATCCCTCA GTGTTTCTTG AAACCAAACT CATATGTATC 3841 ATATGTGGTT TGGAAATGCA GTTAGATTTT ATGCTAAAAT AAGGGATTTG CATGATTTTA 3901 GATGTAGATG ACTGCACGTA AATGTAGTTA ATGACAAAAT CCATAAAATT TGTTCCCAGT 3961 CAGAAGCCCC TCAACCAAAC TTTTCTTTGT GTCTGCTCAC TGTGCTTGTA GGCATGGACT 4021 ACATCAGAGT GCATCTGGAG CCTTTGGACC ACAAGAAGGA ATTGGCCAAC AGTTCATCTG 4081 ATGATGAAGA TTTTTTCGCT TCTTTGAAAC CGACAACACA TGAAGCCAGC AAAGAGTTGG 4141 ATGGATATCT GGCCTGTGTT TCAGACACCA GGGAGTCTCT GCTCACGTTT CCTGCTATTT 4201 GCAGCCTCTC TATCAAGACT AATACACCTC TTCCCGCATC GGCTGCCTGT GAGAGGCTTT 4261 TCAGCACTGC AGGATTGCTT TTCAGCCCCA AAAGAGCTAG GCTTGACACT AACAATTTTG 4321 AGAATCAGCT TCTACTGAAG TTAAATCTGA GGTTTTACAA CTTTGAGTAG CGTGTACTGG 4381 CATTAGATTG TCTGTCTTAT AGTTTGATAA TTAAATACAA ACAGTTCTAA AGCAGGATAA 4441 AACCTTGTAT GCATTTCATT TAATGTTTTT TGAGATTAAA AGCTTAAACA AGAATCTCTA 4501 GTTTTCTTTC TTGCTTTTAC TTTTACTTCC TTAATACTCA AGTACAATTT TAATGGAGTA 4561 CTTTTTTACT TTTACTCAAG TAAGATTCTA GCCAGATACT TTTACTTTTA ATTGAGTAAA 4621 ATTTTCCCTA AGTACTTGTA CTTTCACTTG AGTAAAATTT TTGAGTACTT TTTACACCTC 4681 TG.

    Homologous Recombination

    [0227] In certain embodiments of the methods of the disclosure, a modified CAR-T.sub.SCM or CAR-T.sub.CM of the disclosure is produced by introducing an antigen receptor into a primary human T cell of the disclosure by homologous recombination. In certain embodiments of the disclosure, the homologous recombination is induced by a single or double strand break induced by a genomic editing composition or construct of the disclosure. Homologous recombination methods of the disclosure comprise contacting a genomic editing composition or construct of the disclosure to a genomic sequence to induce at least one break in the sequence and to provide an entry point in the genomic sequence for an exogenous donor sequence composition. Donor sequence compositions of the disclosure are integrated into the genomic sequence at the induced entry point by the cell's native DNA repair machinery.

    [0228] In certain embodiments of the methods of the disclosure, homologous recombination introduces a sequence encoding an antigen receptor and/or a donor sequence composition of the disclosure into a genomic safe harbor site. In certain embodiments, a mammalian genomic sequence comprises the genomic safe harbor site. In certain embodiments, a primate genomic sequence comprises the genomic safe harbor site. In certain embodiments, a human genomic sequence comprises the genomic safe harbor site.

    [0229] Genomic safe harbor sites are able to accommodate the integration of new genetic material in a manner that ensures that the newly inserted genetic elements function reliably (for example, are expressed at a therapeutically effective level of expression) and do not cause deleterious alterations to the host genome that cause a risk to the host organism. Potential genomic safe harbors include, but are not limited to, intronic sequences of the human albumin gene, the adeno-associated virus site 1 (AAVS1), a naturally occurring site of integration of AAV virus on chromosome 19, the site of the chemokine (C-C motif) receptor 5 (CCR5) gene and the site of the human ortholog of the mouse Rosa26 locus.

    [0230] In certain embodiments of the methods of the disclosure, homologous recombination introduces a sequence encoding an antigen receptor and/or a donor sequence composition of the disclosure into a sequence encoding one or more components of an endogenous T-cell receptor or a major histocompatibility complex (MHC). In certain embodiments, inducing homologous recombination within a genomic sequence encoding the endogenous T-cell receptor or the MHC disrupts the endogenous gene, and optionally, replaces part of the coding sequence of the endogenous gene with a donor sequence composition of the disclosure. In certain embodiments, inducing homologous recombination within a genomic sequence encoding the endogenous T-cell receptor or the MHC disrupts the endogenous gene, and optionally, replaces the entire coding sequence of the endogenous gene with a donor sequence composition of the disclosure. In certain embodiments of the methods of the disclosure, introduction of a sequence encoding an antigen receptor or a donor sequence composition of the disclosure by homologous recombination operably links the antigen receptor to an endogenous T cell promoter. In certain embodiments of the methods of the disclosure, introduction of a sequence encoding an antigen receptor or a donor sequence composition of the disclosure by homologous recombination operably links the antigen receptor or the therapeutic protein to a transcriptional or translational regulatory element. In certain embodiments of the methods of the disclosure, introduction of a sequence encoding an antigen receptor or a donor sequence composition of the disclosure by homologous recombination operably links the antigen receptor or the therapeutic protein to a transcriptional regulatory element. In certain embodiments, the transcriptional regulatory element comprises an endogenous T cell 5 UTR.

    [0231] In certain embodiments of the introduction step comprising a homologous recombination, a genomic editing composition contacts a genomic sequence of at least one primary T cell of the plurality of T cells. In certain embodiments of the introduction step comprising a homologous recombination, a genomic editing composition contacts a genomic sequence of a portion of primary T cells of the plurality of T cells. In certain embodiments, the portion of primary T cells is at least 1%, 2%, 5%, 7%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or any percentage in between of the total number of primary T cells in the plurality of T cells. In certain embodiments of the introduction step comprising a homologous recombination, a genomic editing composition contacts a genomic sequence of each primary T cell of the plurality of T cells. In certain embodiments of the introduction step comprising a homologous recombination, a genomic editing composition induces a single strand break. In certain embodiments of the introduction step comprising a homologous recombination, a genomic editing composition induces a double strand break. In certain embodiments of the introduction step comprising a homologous recombination, the introduction step further comprises a donor sequence composition. In certain embodiments, the donor sequence composition comprises a sequence encoding the antigen receptor. In certain embodiments, the donor sequence composition comprises a sequence encoding the antigen receptor, a 5 genomic sequence and a 3 genomic sequence, wherein the 5 genomic sequence is homologous or identical to a genomic sequence of the primary T cell that is 5 to the break point induced by the genomic editing composition and the 3 genomic sequence is homologous or identical to a genomic sequence of the primary T cell that is 3 to the break point induced by the genomic editing composition. In certain embodiments, the 5 genomic sequence and/or the 3 genomic sequence comprises at least 50 bp, 100 bp, at least 200 bp, at least 300 bp, at least 400 bp, at least 500 bp, at least 600 bp, at least 700 bp, at least 800 bp, at least 900 bp, at least 1000 bp, at least 1100 bp, at least 1200 bp, at least 1300 bp, at least 1400, or at least 1500 bp, at least 1600 bp, at least 1700 bp, at least 1800 bp, at least 1900 bp, at least 2000 bp in length or any length of base pairs (bp) in between, inclusive of the end points. In certain embodiments of the introduction step comprising a homologous recombination, the genomic editing composition and donor sequence composition are contacted with the genomic sequence simultaneously or sequentially. In certain embodiments of the introduction step comprising a homologous recombination, the genomic editing composition and donor sequence composition are contacted with the genomic sequence sequentially, and the genomic editing composition is provided first. In certain embodiments of the introduction step comprising a homologous recombination, the genomic editing composition comprises a sequence encoding a DNA binding domain and a sequence encoding a nuclease domain. In certain embodiments of the introduction step comprising a homologous recombination, the genomic editing composition comprises a DNA binding domain and a nuclease domain. In certain embodiments of the genomic editing composition, the DNA binding domain comprises a guide RNA (gRNA). In certain embodiments of the genomic editing composition, the DNA binding domain comprises a DNA-binding domain of a TALEN. In certain embodiments of the genomic editing composition, the DNA binding domain comprises a DNA-binding domain of a ZFN. In certain embodiments of the genomic editing composition, the nuclease domain comprises a Cas9 nuclease or a sequence thereof. In certain embodiments of the genomic editing composition, the nuclease domain comprises an inactive Cas9 (SEQ ID NO: 33, comprising a substitution of a Alanine (A) for Aspartic Acid (D) at position 10 (D10A) and a substitution of Alanine (A) for Histidine (H) at position 840 (H840A)). In certain embodiments of the genomic editing composition, the nuclease domain comprises a short and inactive Cas9 (SEQ ID NO: 32, comprising a substitution of an Alanine (A) for an Aspartic Acid (D) at position 10 (D10A) and a substitution of an Alanine (A) for an Asparagine (N) at position 540 (N540A)). In certain embodiments of the genomic editing composition, the nuclease domain comprises or further comprises a type IIS endonuclease. In certain embodiments of the genomic editing composition, the type IIS endonuclease comprises AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments, the type IIS endonuclease comprises Clo051. In certain embodiments of the genomic editing composition, the nuclease domain comprises or further comprises a TALEN or a nuclease domain thereof. In certain embodiments of the genomic editing composition, the nuclease domain comprises or further comprises a ZFN or a nuclease domain thereof. In certain embodiments of the introduction step comprising a homologous recombination, the genomic editing composition induces a break in a genomic sequence and the donor sequence composition is inserted using the endogenous DNA repair mechanisms of the primary T cell. In certain embodiments of the introduction step comprising a homologous recombination, the insertion of the donor sequence composition eliminates a DNA binding site of the genomic editing composition, thereby preventing further activity of the genomic editing composition.

    [0232] In certain embodiments of the methods of homologous recombination of the disclosure, the nuclease domain of a genomic editing composition or construct is capable of introducing a break at a defined location in a genomic sequence of the primary human T cell, and, furthermore, may comprise, consist essentially of or consist of, a homodimer or a heterodimer. In certain embodiments, the nuclease is an endonuclease. Effector molecules, including those effector molecules comprising a homodimer or a heterodimer, may comprise, consist essentially of or consist of, a Cas9, a Cas9 nuclease domain or a fragment thereof. In certain embodiments, the Cas9 is a catalytically inactive or inactivated Cas9 (dCas9). In certain embodiments, the Cas9 is a catalytically inactive or inactivated nuclease domain of Cas9. In certain embodiments, the dCas9 is encoded by a shorter sequence that is derived from a full length, catalytically inactivated, Cas9, referred to herein as a small dCas9 or dSaCas9.

    [0233] In certain embodiments, the inactivated, small, Cas9 (dSaCas9) operatively-linked to an active nuclease. In certain embodiments, the disclosure provides a fusion protein comprising, consisting essentially of or consisting of a DNA binding domain and molecule nuclease, wherein the nuclease comprises a small, inactivated Cas9 (dSaCas9). In certain embodiments, the dSaCas9 of the disclosure comprises the mutations D10A and N580A (underlined and bolded) which inactivate the catalytic site. In certain embodiments, the dSaCas9 of the disclosure comprises the amino acid sequence of:

    TABLE-US-00021 (SEQ ID NO: 32) 1 MKRNYILGLAIGITSVGYGI IDYETRDVID AGVRLFKEAN VENNEGRRSK RGARRLKRRR 61 RHRIQRVKKL LFDYNLLTDH SELSGINPYE ARVKGLSQKL SEEEFSAALL HLAKRRGVHN 121 VNEVEEDTGN ELSTKEQISR NSKALEEKYV AELQLERLKK DGEVRGSINR FKTSDYVKEA 181 KQLLKVQKAY HQLDQSFIDT YIDLLETRRT YYEGPGEGSP FGWKDIKEWY EMLMGHCTYF 241 PEELRSVKYA YNADLYNALN DLNNLVITRD ENEKLEYYEK FQIIENVFKQ KKKPTLKQIA 301 KEILVNEEDI KGYRVTSTGK PEFTNLKVYH DIKDITARKE IIENAELLDQ IAKILTIYQS 361 SEDIQEELTN LNSELTQEEI EQISNLKGYT GTHNLSLKAI NLILDELWHT NDNQIAIFNR 421 LKLVPKKVDL SQQKEIPTTL VDDFILSPVV KRSFIQSIKV INAIIKKYGL PNDIIIELAR 481 EKNSKDAQKM INEMQKRNRQ TNERIEEIIR TTGKENAKYL IEKIKLHDMQ EGKCLYSLEA 541 IPLEDLLNNP FNYEVDHIIP RSVSFDNSFN NKVLVKQEEASKKGNRTPFQ YLSSSDSKIS 601 YETFKKHILN LAKGKGRISK TKKEYLLEER DINRFSVQKD FINRNLVDTR YATRGLMNLL 661 RSYFRVNNLD VKVKSINGGF TSFLRRKWKF KKERNKGYKH HAEDALIIAN ADFIFKEWKK 721 LDKAKKVMEN QMFEEKQAES MPEIETEQEY KEIFITPHQI KHIKDFKDYK YSHRVDKKPN 781 RELINDTLYS TRKDDKGNTL IVNNLNGLYD KDNDKLKKLI NKSPEKLLMY HHDPQTYQKL 841 KLIMEQYGDE KNPLYKYYEE TGNYLTKYSK KDNGPVIKKI KYYGNKLNAH LDITDDYPNS 901 RNKVVKLSLK PYRFDVYLDN GVYKFVTVKN LDVIKKENYY EVNSKCYEEA KKLKKISNQA 961 EFIASFYNND LIKINGELYR VIGVNNDLLN RIEVNMIDIT YREYLENMND KRPPRIIKTI 1021 ASKTQSIKKY STDILGNLYE VKSKKHPQII KKG.

    [0234] In certain embodiments, the dCas9 of the disclosure comprises a dCas9 isolated or derived from Staphyloccocus pyogenes. In certain embodiments, the dCas9 comprises a dCas9 with substitutions at positions 10 and 840 of the amino acid sequence of the dCas9 which inactivate the catalytic site. In certain embodiments, these substitutions are D10A and H840A. In certain embodiments, the amino acid sequence of the dCas9 comprises the sequence of:

    TABLE-US-00022 (SEQ ID NO: 33) 1 XDKKYSIGLAIGTNSVGWAV ITDEYKVPSK KFKVLGNTDR HSIKKNLIGA LLFDSGETAE 61 ATRLKRTARR RYTRRKNRIC YLQEIFSNEM AKVDDSFFHR LEESFLVEED KKHERHPIFG 121 NIVDEVAYHE KYPTIYHLRK KLVDSTDKAD LRLIYLALAH MIKFRGHFLI EGDLNPDNSD 181 VDKLFIQLVQ TYNQLFEENP INASGVDAKA ILSARLSKSR RLENLIAQLP GEKKNGLFGN 241 LIALSLGLTP NFKSNFDLAE DAKLQLSKDT YDDDLDNLLA QIGDQYADLF LAAKNLSDAI 301 LLSDILRVNT EITKAPLSAS MIKRYDEHHQ DLTLLKALVR QQLPEKYKEI FFDQSKNGYA 361 GYIDGGASQE EFYKFIKPIL EKMDGTEELL VKLNREDLLR KQRTFDNGSI PHQIHLGELH 421 AILRRQEDFY PFLKDNREKI EKILTFRIPY YVGPLARGNS RFAWMTRKSE ETITPWNFEE 481 VVDKGASAQS FIERMTNFDK NLPNEKVLPK HSLLYEYFTV YNELTKVKYV TEGMRKPAFL 541 SGEQKKAIVD LLFKTNRKVT VKQLKEDYFK KIECFDSVEI SGVEDRFNAS LGTYHDLLKI 601 IKDKDFLDNE ENEDILEDIV LTLTLFEDRE MIEERLKTYA HLFDDKVMKQ LKRRRYTGWG 661 RLSRKLINGI RDKQSGKTIL DFLKSDGFAN RNFMQLIHDD SLTFKEDIQK AQVSGQGDSL 721 HEHIANLAGS PAIKKGILQT VKVVDELVKV MGRHKPENIV IEMARENQTT QKGQKNSRER 781 MKRIEEGIKE LGSQILKEHP VENTQLQNEK LYLYYLQNGR DMYVDQELDI NRLSDYDVDA 841 IVPQSFLKDD SIDNKVLTRS DKNRGKSDNV PSEEVVKKMK NYWRQLLNAK LITQRKFDNL 901 TKAERGGLSE LDKAGFIKRQ LVETRQITKH VAQILDSRMN TKYDENDKLI REVKVITLKS 961 KLVSDFRKDF QFYKVREINN YHHAHDAYLN AVVGTALIKK YPKLESEFVY GDYKVYDVRK 1021 MIAKSEQEIG KATAKYFFYS NIMNFFKTEI TLANGEIRKR PLIETNGETG EIVWDKGRDF 1081 ATVRKVLSMP QVNIVKKTEV QTGGFSKESI LPKRNSDKLI ARKKDWDPKK YGGFDSPTVA 1141 YSVLVVAKVE KGKSKKLKSV KELLGITIME RSSFEKNPID FLEAKGYKEV KKDLIIKLPK 1201 YSLFELENGR KRMLASAGEL QKGNELALPS KYVNFLYLAS HYEKLKGSPE DNEQKQLFVE 1261 QHKHYLDEII EQISEFSKRV ILADANLDKV LSAYNKHRDK PIREQAENII HLFTLTNLGA 1321 PAAFKYFDTT IDRKRYTSTK EVLDATLIHQ SITGLYETRI DLSQLGGD.

    [0235] In certain embodiments of the disclosure, the nuclease domain may comprise, consist essentially of or consist of a dCas9 or a dSaCas9 and a type IIS endonuclease. In certain embodiments of the disclosure, the nuclease domain may comprise, consist essentially of or consist of a dSaCas9 and a type IIS endonuclease, including, but not limited to, AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments of the disclosure, the nuclease domain may comprise, consist essentially of or consist of a dSaCas9 and Clo051. An exemplary Clo051 nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence of:

    TABLE-US-00023 (SEQ ID NO: 34) EGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLFEMKVLELLV NEYGFKGRHLGGSRKPDGIVYSTTLEDNFGIIVDTKAYSEGYSLPISQAD EMERYVRENSNRDEEVNPNKWWENFSEEVKKYYFVFISGSFKGKFEEQLR RLSMTTGVNGSAVNVVNLLLGAEKIRSGEMTIEELERAMFNNSEFILKY.

    [0236] An exemplary dCas9-Clo051 nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence of (Clo051 sequence underlined, linker bold italics, dCas9 sequence in italics):

    TABLE-US-00024 (SEQ ID NO: 40) MAPKKKRKVEGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLF EMKVLELLVNEYGFKGRHLGGSRKPDGIVYSTTLEDNFGIIVDTKAYSEG YSLPISQADEMERYVRENSNRDEEVNPNKWWENFSEEVKKYYFVFISGSF KGKFEEQLRRLSMTTGVNGSAVNVVNLLLGAEKIRSGEMTIEELERAMFN NSEFILKYcustom-character DKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGN TDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFS NEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYH LRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQ LVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGL FGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYA DLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKA LVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTE ELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNR EKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGAS AQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKP AFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRF NASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLK TYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDG FANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGI LQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEG IKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYD VDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLL NAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDS RMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDA YLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYF FYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVL SMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSP TVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGY KEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLY LASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANL DKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYT STKEVLDATLIHQSITGLYETRIDLSQLGGDGSPKKKRKVSS.

    [0237] In certain embodiments, the nuclease capable of introducing a break at a defined location in the genomic DNA of the primary human T cell may comprise, consist essentially of or consist of, a homodimer or a heterodimer. Nuclease domains of the genomic editing compositions or constructs of the disclosure may comprise, consist essentially of or consist of a nuclease domain isolated, derived or recombined from a transcription-activator-like effector nuclease (TALEN). TALENs are transcription factors with programmable DNA binding domains that provide a means to create designer proteins that bind to pre-determined DNA sequences or individual nucleic acids. Modular DNA binding domains have been identified in transcriptional activator-like (TAL) proteins, or, more specifically, transcriptional activator-like effector nucleases (TALENs), thereby allowing for the de novo creation of synthetic transcription factors that bind to DNA sequences of interest and, if desirable, also allowing a second domain present on the protein or polypeptide to perform an activity related to DNA. TAL proteins have been derived from the organisms Xanthomonas and Ralstonia.

    [0238] In certain embodiments of the disclosure, the nuclease domain of the genomic editing composition or construct may comprise, consist essentially of or consist of a nuclease domain isolated, derived or recombined from a TALEN and a type IIS endonuclease. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of Clo051 (SEQ ID NO: 34).

    [0239] In certain embodiments of the disclosure, the nuclease domain of the genomic editing composition or construct may comprise, consist essentially of or consist of a nuclease domain isolated, derived or recombined from a zinc finger nuclease (ZFN) and a type IIS endonuclease. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I, FokI or Clo051. In certain embodiments of the disclosure, the type IIS endonuclease may comprise, consist essentially of or consist of Clo051 (SEQ ID NO: 34).

    [0240] In certain embodiments of the genomic editing compositions or constructs of the disclosure, the DNA binding domain and the nuclease domain may be covalently linked. For example, a fusion protein may comprise the DNA binding domain and the nuclease domain. In certain embodiments of the genomic editing compositions or constructs of the disclosure, the DNA binding domain and the nuclease domain may be operably linked through a non-covalent linkage.

    Secreted Proteins from Modified T Cells

    [0241] In certain embodiments of the composition and methods of the disclosure, modified T-cells express therapeutic proteins. Therapeutic proteins of the disclosure include secreted proteins. Preferably, in a therapeutic context, the therapeutic protein is a human protein, including a secreted human protein. When expressed or secreted by CAR-T cells of the disclosure, the combination comprising the CAR-T cell and the therapeutic protein secreted therefrom may be considered a monotherapy. However, the CAR-T cells of the disclosure may be administered as a combination therapy with a second agent. A database of human secreted proteins that may be expressed or secreted by modified T-cell of the disclosure can be found at proteinatlas.org/search/protein_class:Predicted %20secreted %20proteins, the contents of which are incorporated herein by reference. Exemplary human secreted proteins are provided, but are not limited to the human secreted proteins, in Table 1.

    TABLE-US-00025 TABLE 1 Exemplary Human Secreted Proteins Gene Ensembl ID Gene description A1BG ENSG00000121410 Alpha-1-B glycoprotein A2M ENSG00000175899 Alpha-2-macroglobulin A2ML1 ENSG00000166535 Alpha-2-macroglobulin-like 1 A4GNT ENSG00000118017 Alpha-1,4-N-acetylglucosaminyltransferase AADACL2 ENSG00000197953 Arylacetamide deacetylase-like 2 AANAT ENSG00000129673 Aralkylamine N-acetyltransferase ABCG1 ENSG00000160179 ATP-binding cassette, sub-family G (WHITE), member 1 ABHD1 ENSG00000143994 Abhydrolase domain containing 1 ABHD10 ENSG00000144827 Abhydrolase domain containing 10 ABHD14A ENSG00000248487 Abhydrolase domain containing 14A ABHD15 ENSG00000168792 Abhydrolase domain containing 15 ABI3BP ENSG00000154175 ABI family, member 3 (NESH) binding protein AC008641.1 ENSG00000279109 AC009133.22 ENSG00000277669 AC009491.2 ENSG00000279664 AC011513.3 ENSG00000267881 AC136352.5 ENSG00000277666 AC145212.4 ENSG00000277400 MaFF-interacting protein AC233755.1 ENSG00000275063 ACACB ENSG00000076555 Acetyl-CoA carboxylase beta ACAN ENSG00000157766 Aggrecan ACE ENSG00000159640 Angiotensin I converting enzyme ACHE ENSG00000087085 Acetylcholinesterase (Yt blood group) ACP2 ENSG00000134575 Acid phosphatase 2, lysosomal ACP5 ENSG00000102575 Acid phosphatase 5, tartrate resistant ACP6 ENSG00000162836 Acid phosphatase 6, lysophosphatidic ACPP ENSG00000014257 Acid phosphatase, prostate ACR ENSG00000100312 Acrosin ACRBP ENSG00000111644 Acrosin binding protein ACRV1 ENSG00000134940 Acrosomal vesicle protein 1 ACSF2 ENSG00000167107 Acyl-CoA synthetase family member 2 ACTL10 ENSG00000182584 Actin-like 10 ACVR1 ENSG00000115170 Activin A receptor, type I ACVR1C ENSG00000123612 Activin A receptor, type IC ACVRL1 ENSG00000139567 Activin A receptor type II-like 1 ACYP1 ENSG00000119640 Acylphosphatase 1, erythrocyte (common) type ACYP2 ENSG00000170634 Acylphosphatase 2, muscle type ADAM10 ENSG00000137845 ADAM metallopeptidase domain 10 ADAM12 ENSG00000148848 ADAM metallopeptidase domain 12 ADAM15 ENSG00000143537 ADAM metallopeptidase domain 15 ADAM17 ENSG00000151694 ADAM metallopeptidase domain 17 ADAM18 ENSG00000168619 ADAM metallopeptidase domain 18 ADAM22 ENSG00000008277 ADAM metallopeptidase domain 22 ADAM28 ENSG00000042980 ADAM metallopeptidase domain 28 ADAM29 ENSG00000168594 ADAM metallopeptidase domain 29 ADAM32 ENSG00000197140 ADAM metallopeptidase domain 32 ADAM33 ENSG00000149451 ADAM metallopeptidase domain 33 ADAM7 ENSG00000069206 ADAM metallopeptidase domain 7 ADAM8 ENSG00000151651 ADAM metallopeptidase domain 8 ADAM9 ENSG00000168615 ADAM metallopeptidase domain 9 ADAMDEC1 ENSG00000134028 ADAM-like, decysin 1 ADAMTS1 ENSG00000154734 ADAM metallopeptidase with thrombospondin type 1 motif, 1 ADAMTS10 ENSG00000142303 ADAM metallopeptidase with thrombospondin type 1 motif, 10 ADAMTS12 ENSG00000151388 ADAM metallopeptidase with thrombospondin type 1 motif, 12 ADAMTS13 ENSG00000160323 ADAM metallopeptidase with thrombospondin type 1 motif, 13 ADAMTS14 ENSG00000138316 ADAM metallopeptidase with thrombospondin type 1 motif, 14 ADAMTS15 ENSG00000166106 ADAM metallopeptidase with thrombospondin type 1 motif, 15 ADAMTS16 ENSG00000145536 ADAM metallopeptidase with thrombospondin type 1 motif, 16 ADAMTS17 ENSG00000140470 ADAM metallopeptidase with thrombospondin type 1 motif, 17 ADAMTS18 ENSG00000140873 ADAM metallopeptidase with thrombospondin type 1 motif, 18 ADAMTS19 ENSG00000145808 ADAM metallopeptidase with thrombospondin type 1 motif, 19 ADAMTS2 ENSG00000087116 ADAM metallopeptidase with thrombospondin type 1 motif, 2 ADAMTS20 ENSG00000173157 ADAM metallopeptidase with thrombospondin type 1 motif, 20 ADAMTS3 ENSG00000156140 ADAM metallopeptidase with thrombospondin type 1 motif, 3 ADAMTS5 ENSG00000154736 ADAM metallopeptidase with thrombospondin type 1 motif, 5 ADAMTS6 ENSG00000049192 ADAM metallopeptidase with thrombospondin type 1 motif, 6 ADAMTS7 ENSG00000136378 ADAM metallopeptidase with thrombospondin type 1 motif, 7 ADAMTS8 ENSG00000134917 ADAM metallopeptidase with thrombospondin type 1 motif, 8 ADAMTS9 ENSG00000163638 ADAM metallopeptidase with thrombospondin type 1 motif, 9 ADAMTSL1 ENSG00000178031 ADAMTS-like 1 ADAMTSL2 ENSG00000197859 ADAMTS-like 2 ADAMTSL3 ENSG00000156218 ADAMTS-like 3 ADAMTSL4 ENSG00000143382 ADAMTS-like 4 ADAMTSL5 ENSG00000185761 ADAMTS-like 5 ADCK1 ENSG00000063761 AarF domain containing kinase 1 ADCYAP1 ENSG00000141433 Adenylate cyclase activating polypeptide 1 (pituitary) ADCYAP1R1 ENSG00000078549 Adenylate cyclase activating polypeptide 1 (pituitary) receptor type I ADGRA3 ENSG00000152990 Adhesion G protein-coupled receptor A3 ADGRB2 ENSG00000121753 Adhesion G protein-coupled receptor B2 ADGRD1 ENSG00000111452 Adhesion G protein-coupled receptor D1 ADGRE3 ENSG00000131355 Adhesion G protein-coupled receptor E3 ADGRE5 ENSG00000123146 Adhesion G protein-coupled receptor E5 ADGRF1 ENSG00000153292 Adhesion G protein-coupled receptor F1 ADGRG1 ENSG00000205336 Adhesion G protein-coupled receptor G1 ADGRG5 ENSG00000159618 Adhesion G protein-coupled receptor G5 ADGRG6 ENSG00000112414 Adhesion G protein-coupled receptor G6 ADGRV1 ENSG00000164199 Adhesion G protein-coupled receptor V1 ADI1 ENSG00000182551 Acireductone dioxygenase 1 ADIG ENSG00000182035 Adipogenin ADIPOQ ENSG00000181092 Adiponectin, C1Q and collagen domain containing ADM ENSG00000148926 Adrenomedullin ADM2 ENSG00000128165 Adrenomedullin 2 ADM5 ENSG00000224420 Adrenomedullin 5 (putative) ADPGK ENSG00000159322 ADP-dependent glucokinase ADPRHL2 ENSG00000116863 ADP-ribosylhydrolase like 2 AEBP1 ENSG00000106624 AE binding protein 1 AFM ENSG00000079557 Afamin AFP ENSG00000081051 Alpha-fetoprotein AGA ENSG00000038002 Aspartylglucosaminidase AGER ENSG00000204305 Advanced glycosylation end product-specific receptor AGK ENSG00000006530 Acylglycerol kinase AGPS ENSG00000018510 Alkylglycerone phosphate synthase AGR2 ENSG00000106541 Anterior gradient 2, protein disulphide isomerase family member AGR3 ENSG00000173467 Anterior gradient 3, protein disulphide isomerase family member AGRN ENSG00000188157 Agrin AGRP ENSG00000159723 Agouti related neuropeptide AGT ENSG00000135744 Angiotensinogen (serpin peptidase inhibitor, clade A, member 8) AGTPBP1 ENSG00000135049 ATP/GTP binding protein 1 AGTRAP ENSG00000177674 Angiotensin II receptor-associated protein AHCYL2 ENSG00000158467 Adenosylhomocysteinase-like 2 AHSG ENSG00000145192 Alpha-2-HS-glycoprotein AIG1 ENSG00000146416 Androgen-induced 1 AK4 ENSG00000162433 Adenylate kinase 4 AKAP10 ENSG00000108599 A kinase (PRKA) anchor protein 10 AKR1C1 ENSG00000187134 Aldo-keto reductase family 1, member C1 AL356289.1 ENSG00000279096 AL589743.1 ENSG00000279508 ALAS2 ENSG00000158578 5-aminolevulinate synthase 2 ALB ENSG00000163631 Albumin ALDH9A1 ENSG00000143149 Aldehyde dehydrogenase 9 family, member A1 ALDOA ENSG00000149925 Aldolase A, fructose-bisphosphate ALG1 ENSG00000033011 ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase ALG5 ENSG00000120697 ALG5, dolichyl-phosphate beta-glucosyltransferase ALG9 ENSG00000086848 ALG9, alpha-1,2-mannosyltransferase ALKBH1 ENSG00000100601 AlkB homolog 1, histone H2A dioxygenase ALKBH5 ENSG00000091542 AlkB homolog 5, RNA demethylase ALPI ENSG00000163295 Alkaline phosphatase, intestinal ALPL ENSG00000162551 Alkaline phosphatase, liver/bone/kidney ALPP ENSG00000163283 Alkaline phosphatase, placental ALPPL2 ENSG00000163286 Alkaline phosphatase, placental-like 2 AMBN ENSG00000178522 Ameloblastin (enamel matrix protein) AMBP ENSG00000106927 Alpha-1-microglobulin/bikunin precursor AMELX ENSG00000125363 Amelogenin, X-linked AMELY ENSG00000099721 Amelogenin, Y-linked AMH ENSG00000104899 Anti-Mullerian hormone AMICA1 ENSG00000160593 Adhesion molecule, interacts with CXADR antigen 1 AMPD1 ENSG00000116748 Adenosine monophosphate deaminase 1 AMTN ENSG00000187689 Amelotin AMY1A ENSG00000237763 Amylase, alpha 1A (salivary) AMY1B ENSG00000174876 Amylase, alpha 1B (salivary) AMY1C ENSG00000187733 Amylase, alpha 1C (salivary) AMY2A ENSG00000243480 Amylase, alpha 2A (pancreatic) AMY2B ENSG00000240038 Amylase, alpha 2B (pancreatic) ANG ENSG00000214274 Angiogenin, ribonuclease, RNase A family, 5 ANGEL1 ENSG00000013523 Angel homolog 1 (Drosophila) ANGPT1 ENSG00000154188 Angiopoietin 1 ANGPT2 ENSG00000091879 Angiopoietin 2 ANGPT4 ENSG00000101280 Angiopoietin 4 ANGPTL1 ENSG00000116194 Angiopoietin-like 1 ANGPTL2 ENSG00000136859 Angiopoietin-like 2 ANGPTL3 ENSG00000132855 Angiopoietin-like 3 ANGPTL4 ENSG00000167772 Angiopoietin-like 4 ANGPTL5 ENSG00000187151 Angiopoietin-like 5 ANGPTL6 ENSG00000130812 Angiopoietin-like 6 ANGPTL7 ENSG00000171819 Angiopoietin-like 7 ANK1 ENSG00000029534 Ankyrin 1, erythrocytic ANKDD1A ENSG00000166839 Ankyrin repeat and death domain containing 1A ANKRD54 ENSG00000100124 Ankyrin repeat domain 54 ANKRD60 ENSG00000124227 Ankyrin repeat domain 60 ANO7 ENSG00000146205 Anoctamin 7 ANOS1 ENSG00000011201 Anosmin 1 ANTXR1 ENSG00000169604 Anthrax toxin receptor 1 AOAH ENSG00000136250 Acyloxyacyl hydrolase (neutrophil) AOC1 ENSG00000002726 Amine oxidase, copper containing 1 AOC2 ENSG00000131480 Amine oxidase, copper containing 2 (retina-specific) AOC3 ENSG00000131471 Amine oxidase, copper containing 3 AP000721.4 ENSG00000256100 AP000866.1 ENSG00000279342 APBB1 ENSG00000166313 Amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) APCDD1 ENSG00000154856 Adenomatosis polyposis coli down-regulated 1 APCS ENSG00000132703 Amyloid P component, serum APELA ENSG00000248329 Apelin receptor early endogenous ligand APLN ENSG00000171388 Apelin APLP2 ENSG00000084234 Amyloid beta (A4) precursor-like protein 2 APOA1 ENSG00000118137 Apolipoprotein A-I APOA1BP ENSG00000163382 Apolipoprotein A-I binding protein APOA2 ENSG00000158874 Apolipoprotein A-II APOA4 ENSG00000110244 Apolipoprotein A-IV APOA5 ENSG00000110243 Apolipoprotein A-V APOB ENSG00000084674 Apolipoprotein B APOC1 ENSG00000130208 Apolipoprotein C-I APOC2 ENSG00000234906 Apolipoprotein C-II APOC3 ENSG00000110245 Apolipoprotein C-III APOC4 ENSG00000267467 Apolipoprotein C-IV APOC4-APOC2 ENSG00000224916 APOC4-APOC2 readthrough (NMD candidate) APOD ENSG00000189058 Apolipoprotein D APOE ENSG00000130203 Apolipoprotein E APOF ENSG00000175336 Apolipoprotein F APOH ENSG00000091583 Apolipoprotein H (beta-2-glycoprotein I) APOL1 ENSG00000100342 Apolipoprotein L, 1 APOL3 ENSG00000128284 Apolipoprotein L, 3 APOM ENSG00000204444 Apolipoprotein M APOOL ENSG00000155008 Apolipoprotein O-like ARCN1 ENSG00000095139 Archain 1 ARFIP2 ENSG00000132254 ADP-ribosylation factor interacting protein 2 ARHGAP36 ENSG00000147256 Rho GTPase activating protein 36 ARHGAP6 ENSG00000047648 Rho GTPase activating protein 6 ARHGEF4 ENSG00000136002 Rho guanine nucleotide exchange factor (GEF) 4 ARL16 ENSG00000214087 ADP-ribosylation factor-like 16 ARMC5 ENSG00000140691 Armadillo repeat containing 5 ARNTL ENSG00000133794 Aryl hydrocarbon receptor nuclear translocator-like ARSA ENSG00000100299 Arylsulfatase A ARSB ENSG00000113273 Arylsulfatase B ARSE ENSG00000157399 Arylsulfatase E (chondrodysplasia punctata 1) ARSG ENSG00000141337 Arylsulfatase G ARSI ENSG00000183876 Arylsulfatase family, member I ARSK ENSG00000164291 Arylsulfatase family, member K ART3 ENSG00000156219 ADP-ribosyltransferase 3 ART4 ENSG00000111339 ADP-ribosyltransferase 4 (Dombrock blood group) ART5 ENSG00000167311 ADP-ribosyltransferase 5 ARTN ENSG00000117407 Artemin ASAH1 ENSG00000104763 N-acylsphingosine amidohydrolase (acid ceramidase) 1 ASAH2 ENSG00000188611 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2 ASCL1 ENSG00000139352 Achaete-scute family bHLH transcription factor 1 ASIP ENSG00000101440 Agouti signaling protein ASPN ENSG00000106819 Asporin ASTL ENSG00000188886 Astacin-like metallo-endopeptidase (M12 family) ATAD5 ENSG00000176208 ATPase family, AAA domain containing 5 ATAT1 ENSG00000137343 Alpha tubulin acetyltransferase 1 ATG2A ENSG00000110046 Autophagy related 2A ATG5 ENSG00000057663 Autophagy related 5 ATMIN ENSG00000166454 ATM interactor ATP13A1 ENSG00000105726 ATPase type 13A1 ATP5F1 ENSG00000116459 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 ATP6AP1 ENSG00000071553 ATPase, H+ transporting, lysosomal accessory protein 1 ATP6AP2 ENSG00000182220 ATPase, H+ transporting, lysosomal accessory protein 2 ATPAF1 ENSG00000123472 ATP synthase mitochondrial F1 complex assembly factor 1 AUH ENSG00000148090 AU RNA binding protein/enoyl-CoA hydratase AVP ENSG00000101200 Arginine vasopressin AXIN2 ENSG00000168646 Axin 2 AZGP1 ENSG00000160862 Alpha-2-glycoprotein 1, zinc-binding AZU1 ENSG00000172232 Azurocidin 1 B2M ENSG00000166710 Beta-2-microglobulin B3GALNT1 ENSG00000169255 Beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group) B3GALNT2 ENSG00000162885 Beta-1,3-N-acetylgalactosaminyltransferase 2 B3GALT1 ENSG00000172318 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 B3GALT4 ENSG00000235863 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 B3GALT5 ENSG00000183778 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 B3GALT6 ENSG00000176022 UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 B3GAT3 ENSG00000149541 Beta-1,3-glucuronyltransferase 3 B3GLCT ENSG00000187676 Beta 3-glucosyltransferase B3GNT3 ENSG00000179913 UDP-GlcNAc:betaGal beta-1,3-N- acetylglucosaminyltransferase 3 B3GNT4 ENSG00000176383 UDP-GlcNAc:betaGal beta-1,3-N- acetylglucosaminyltransferase 4 B3GNT6 ENSG00000198488 UDP-GlcNAc:betaGal beta-1,3-N- acetylglucosaminyltransferase 6 B3GNT7 ENSG00000156966 UDP-GlcNAc:betaGal beta-1,3-N- acetylglucosaminyltransferase 7 B3GNT8 ENSG00000177191 UDP-GlcNAc:betaGal beta-1,3-N- acetylglucosaminyltransferase 8 B3GNT9 ENSG00000237172 UDP-GlcNAc:betaGal beta-1,3-N- acetylglucosaminyltransferase 9 B4GALNT1 ENSG00000135454 Beta-1,4-N-acetyl-galactosaminyl transferase 1 B4GALNT3 ENSG00000139044 Beta-1,4-N-acetyl-galactosaminyl transferase 3 B4GALNT4 ENSG00000182272 Beta-1,4-N-acetyl-galactosaminyl transferase 4 B4GALT4 ENSG00000121578 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 B4GALT5 ENSG00000158470 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5 B4GALT6 ENSG00000118276 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6 B4GAT1 ENSG00000174684 Beta-1,4-glucuronyltransferase 1 B9D1 ENSG00000108641 B9 protein domain 1 BACE2 ENSG00000182240 Beta-site APP-cleaving enzyme 2 BAGE5 ENSG00000279973 B melanoma antigen family, member 5 BCAM ENSG00000187244 Basal cell adhesion molecule (Lutheran blood group) BCAN ENSG00000132692 Brevican BCAP29 ENSG00000075790 B-cell receptor-associated protein 29 BCAR1 ENSG00000050820 Breast cancer anti-estrogen resistance 1 BCHE ENSG00000114200 Butyrylcholinesterase BCKDHB ENSG00000083123 Branched chain keto acid dehydrogenase E1, beta polypeptide BDNF ENSG00000176697 Brain-derived neurotrophic factor BGLAP ENSG00000242252 Bone gamma-carboxyglutamate (gla) protein BGN ENSG00000182492 Biglycan BLVRB ENSG00000090013 Biliverdin reductase B BMP1 ENSG00000168487 Bone morphogenetic protein 1 BMP10 ENSG00000163217 Bone morphogenetic protein 10 BMP15 ENSG00000130385 Bone morphogenetic protein 15 BMP2 ENSG00000125845 Bone morphogenetic protein 2 BMP3 ENSG00000152785 Bone morphogenetic protein 3 BMP4 ENSG00000125378 Bone morphogenetic protein 4 BMP6 ENSG00000153162 Bone morphogenetic protein 6 BMP7 ENSG00000101144 Bone morphogenetic protein 7 BMP8A ENSG00000183682 Bone morphogenetic protein 8a BMP8B ENSG00000116985 Bone morphogenetic protein 8b BMPER ENSG00000164619 BMP binding endothelial regulator BNC1 ENSG00000169594 Basonuclin 1 BOC ENSG00000144857 BOC cell adhesion associated, oncogene regulated BOD1 ENSG00000145919 Biorientation of chromosomes in cell division 1 BOLA1 ENSG00000178096 BolA family member 1 BPI ENSG00000101425 Bactericidal/permeability-increasing protein BPIFA1 ENSG00000198183 BPI fold containing family A, member 1 BPIFA2 ENSG00000131050 BPI fold containing family A, member 2 BPIFA3 ENSG00000131059 BPI fold containing family A, member 3 BPIFB1 ENSG00000125999 BPI fold containing family B, member 1 BPIFB2 ENSG00000078898 BPI fold containing family B, member 2 BPIFB3 ENSG00000186190 BPI fold containing family B, member 3 BPIFB4 ENSG00000186191 BPI fold containing family B, member 4 BPIFB6 ENSG00000167104 BPI fold containing family B, member 6 BPIFC ENSG00000184459 BPI fold containing family C BRF1 ENSG00000185024 BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit BRINP1 ENSG00000078725 Bone morphogenetic protein/retinoic acid inducible neural- specific 1 BRINP2 ENSG00000198797 Bone morphogenetic protein/retinoic acid inducible neural- specific 2 BRINP3 ENSG00000162670 Bone morphogenetic protein/retinoic acid inducible neural- specific 3 BSG ENSG00000172270 Basigin (Ok blood group) BSPH1 ENSG00000188334 Binder of sperm protein homolog 1 BST1 ENSG00000109743 Bone marrow stromal cell antigen 1 BTBD17 ENSG00000204347 BTB (POZ) domain containing 17 BTD ENSG00000169814 Biotinidase BTN2A2 ENSG00000124508 Butyrophilin, subfamily 2, member A2 BTN3A1 ENSG00000026950 Butyrophilin, subfamily 3, member A1 BTN3A2 ENSG00000186470 Butyrophilin, subfamily 3, member A2 BTN3A3 ENSG00000111801 Butyrophilin, subfamily 3, member A3 C10orf10 ENSG00000165507 Chromosome 10 open reading frame 10 C10orf99 ENSG00000188373 Chromosome 10 open reading frame 99 C11orf1 ENSG00000137720 Chromosome 11 open reading frame 1 C11orf24 ENSG00000171067 Chromosome 11 open reading frame 24 C11orf45 ENSG00000174370 Chromosome 11 open reading frame 45 C11orf94 ENSG00000234776 Chromosome 11 open reading frame 94 C12orf10 ENSG00000139637 Chromosome 12 open reading frame 10 C12orf49 ENSG00000111412 Chromosome 12 open reading frame 49 C12orf73 ENSG00000204954 Chromosome 12 open reading frame 73 C12orf76 ENSG00000174456 Chromosome 12 open reading frame 76 C14orf80 ENSG00000185347 Chromosome 14 open reading frame 80 C14orf93 ENSG00000100802 Chromosome 14 open reading frame 93 C16orf89 ENSG00000153446 Chromosome 16 open reading frame 89 C16orf90 ENSG00000215131 Chromosome 16 open reading frame 90 C17orf67 ENSG00000214226 Chromosome 17 open reading frame 67 C17orf75 ENSG00000108666 Chromosome 17 open reading frame 75 C17orf99 ENSG00000187997 Chromosome 17 open reading frame 99 C18orf54 ENSG00000166845 Chromosome 18 open reading frame 54 C19orf47 ENSG00000160392 Chromosome 19 open reading frame 47 C19orf70 ENSG00000174917 Chromosome 19 open reading frame 70 C19orf80 ENSG00000130173 Chromosome 19 open reading frame 80 C1GALT1 ENSG00000106392 Core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta- galactosyltransferase 1 C1orf127 ENSG00000175262 Chromosome 1 open reading frame 127 C1orf159 ENSG00000131591 Chromosome 1 open reading frame 159 C1orf198 ENSG00000119280 Chromosome 1 open reading frame 198 C1orf234 ENSG00000227868 Chromosome 1 open reading frame 234 C1orf54 ENSG00000118292 Chromosome 1 open reading frame 54 C1orf56 ENSG00000143443 Chromosome 1 open reading frame 56 C1QA ENSG00000173372 Complement component 1, q subcomponent, A chain C1QB ENSG00000173369 Complement component 1, q subcomponent, B chain C1QC ENSG00000159189 Complement component 1, q subcomponent, C chain C1QL1 ENSG00000131094 Complement component 1, q subcomponent-like 1 C1QL2 ENSG00000144119 Complement component 1, q subcomponent-like 2 C1QL3 ENSG00000165985 Complement component 1, q subcomponent-like 3 C1QL4 ENSG00000186897 Complement component 1, q subcomponent-like 4 C1QTNF1 ENSG00000173918 C1q and tumor necrosis factor related protein 1 C1QTNF2 ENSG00000145861 C1q and tumor necrosis factor related protein 2 C1QTNF3 ENSG00000082196 C1q and tumor necrosis factor related protein 3 C1QTNF4 ENSG00000172247 C1q and tumor necrosis factor related protein 4 C1QTNF5 ENSG00000223953 C1q and tumor necrosis factor related protein 5 C1QTNF7 ENSG00000163145 C1q and tumor necrosis factor related protein 7 C1QTNF8 ENSG00000184471 C1q and tumor necrosis factor related protein 8 C1QTNF9 ENSG00000240654 C1q and tumor necrosis factor related protein 9 C1QTNF9B ENSG00000205863 C1q and tumor necrosis factor related protein 9B C1R ENSG00000159403 Complement component 1, r subcomponent C1RL ENSG00000139178 Complement component 1, r subcomponent-like C1S ENSG00000182326 Complement component 1, s subcomponent C2 ENSG00000166278 Complement component 2 C21orf33 ENSG00000160221 Chromosome 21 open reading frame 33 C21orf62 ENSG00000205929 Chromosome 21 open reading frame 62 C22orf15 ENSG00000169314 Chromosome 22 open reading frame 15 C22orf46 ENSG00000184208 Chromosome 22 open reading frame 46 C2CD2 ENSG00000157617 C2 calcium-dependent domain containing 2 C2orf40 ENSG00000119147 Chromosome 2 open reading frame 40 C2orf66 ENSG00000187944 Chromosome 2 open reading frame 66 C2orf69 ENSG00000178074 Chromosome 2 open reading frame 69 C2orf78 ENSG00000187833 Chromosome 2 open reading frame 78 C3 ENSG00000125730 Complement component 3 C3orf33 ENSG00000174928 Chromosome 3 open reading frame 33 C3orf58 ENSG00000181744 Chromosome 3 open reading frame 58 C4A ENSG00000244731 Complement component 4A (Rodgers blood group) C4B ENSG00000224389 Complement component 4B (Chido blood group) C4BPA ENSG00000123838 Complement component 4 binding protein, alpha C4BPB ENSG00000123843 Complement component 4 binding protein, beta C4orf26 ENSG00000174792 Chromosome 4 open reading frame 26 C4orf48 ENSG00000243449 Chromosome 4 open reading frame 48 C5 ENSG00000106804 Complement component 5 C5orf46 ENSG00000178776 Chromosome 5 open reading frame 46 C6 ENSG00000039537 Complement component 6 C6orf120 ENSG00000185127 Chromosome 6 open reading frame 120 C6orf15 ENSG00000204542 Chromosome 6 open reading frame 15 C6orf25 ENSG00000204420 Chromosome 6 open reading frame 25 C6orf58 ENSG00000184530 Chromosome 6 open reading frame 58 C7 ENSG00000112936 Complement component 7 C7orf57 ENSG00000164746 Chromosome 7 open reading frame 57 C7orf73 ENSG00000243317 Chromosome 7 open reading frame 73 C8A ENSG00000157131 Complement component 8, alpha polypeptide C8B ENSG00000021852 Complement component 8, beta polypeptide C8G ENSG00000176919 Complement component 8, gamma polypeptide C9 ENSG00000113600 Complement component 9 C9orf47 ENSG00000186354 Chromosome 9 open reading frame 47 CA10 ENSG00000154975 Carbonic anhydrase X CA11 ENSG00000063180 Carbonic anhydrase XI CA6 ENSG00000131686 Carbonic anhydrase VI CA9 ENSG00000107159 Carbonic anhydrase IX CABLES1 ENSG00000134508 Cdk5 and Abl enzyme substrate 1 CABP1 ENSG00000157782 Calcium binding protein 1 CACNA2D1 ENSG00000153956 Calcium channel, voltage-dependent, alpha 2/delta subunit 1 CACNA2D4 ENSG00000151062 Calcium channel, voltage-dependent, alpha 2/delta subunit 4 CADM3 ENSG00000162706 Cell adhesion molecule 3 CALCA ENSG00000110680 Calcitonin-related polypeptide alpha CALCB ENSG00000175868 Calcitonin-related polypeptide beta CALCR ENSG00000004948 Calcitonin receptor CALCRL ENSG00000064989 Calcitonin receptor-like CALR ENSG00000179218 Calreticulin CALR3 ENSG00000269058 Calreticulin 3 CALU ENSG00000128595 Calumenin CAMK2D ENSG00000145349 Calcium/calmodulin-dependent protein kinase II delta CAMP ENSG00000164047 Cathelicidin antimicrobial peptide CANX ENSG00000127022 Calnexin CARKD ENSG00000213995 Carbohydrate kinase domain containing CARM1 ENSG00000142453 Coactivator-associated arginine methyltransferase 1 CARNS1 ENSG00000172508 Carnosine synthase 1 CARTPT ENSG00000164326 CART prepropeptide CASQ1 ENSG00000143318 Calsequestrin 1 (fast-twitch, skeletal muscle) CASQ2 ENSG00000118729 Calsequestrin 2 (cardiac muscle) CATSPERG ENSG00000099338 Catsper channel auxiliary subunit gamma CBLN1 ENSG00000102924 Cerebellin 1 precursor CBLN2 ENSG00000141668 Cerebellin 2 precursor CBLN3 ENSG00000139899 Cerebellin 3 precursor CBLN4 ENSG00000054803 Cerebellin 4 precursor CCBE1 ENSG00000183287 Collagen and calcium binding EGF domains 1 CCDC108 ENSG00000181378 Coiled-coil domain containing 108 CCDC112 ENSG00000164221 Coiled-coil domain containing 112 CCDC129 ENSG00000180347 Coiled-coil domain containing 129 CCDC134 ENSG00000100147 Coiled-coil domain containing 134 CCDC149 ENSG00000181982 Coiled-coil domain containing 149 CCDC3 ENSG00000151468 Coiled-coil domain containing 3 CCDC80 ENSG00000091986 Coiled-coil domain containing 80 CCDC85A ENSG00000055813 Coiled-coil domain containing 85A CCDC88B ENSG00000168071 Coiled-coil domain containing 88B CCER2 ENSG00000262484 Coiled-coil glutamate-rich protein 2 CCK ENSG00000187094 Cholecystokinin CCL1 ENSG00000108702 Chemokine (C-C motif) ligand 1 CCL11 ENSG00000172156 Chemokine (C-C motif) ligand 11 CCL13 ENSG00000181374 Chemokine (C-C motif) ligand 13 CCL14 ENSG00000276409 Chemokine (C-C motif) ligand 14 CCL15 ENSG00000275718 Chemokine (C-C motif) ligand 15 CCL16 ENSG00000275152 Chemokine (C-C motif) ligand 16 CCL17 ENSG00000102970 Chemokine (C-C motif) ligand 17 CCL18 ENSG00000275385 Chemokine (C-C motif) ligand 18 (pulmonary and activation- regulated) CCL19 ENSG00000172724 Chemokine (C-C motif) ligand 19 CCL2 ENSG00000108691 Chemokine (C-C motif) ligand 2 CCL20 ENSG00000115009 Chemokine (C-C motif) ligand 20 CCL21 ENSG00000137077 Chemokine (C-C motif) ligand 21 CCL22 ENSG00000102962 Chemokine (C-C motif) ligand 22 CCL23 ENSG00000274736 Chemokine (C-C motif) ligand 23 CCL24 ENSG00000106178 Chemokine (C-C motif) ligand 24 CCL25 ENSG00000131142 Chemokine (C-C motif) ligand 25 CCL26 ENSG00000006606 Chemokine (C-C motif) ligand 26 CCL27 ENSG00000213927 Chemokine (C-C motif) ligand 27 CCL28 ENSG00000151882 Chemokine (C-C motif) ligand 28 CCL3 ENSG00000277632 Chemokine (C-C motif) ligand 3 CCL3L3 ENSG00000276085 Chemokine (C-C motif) ligand 3-like 3 CCL4 ENSG00000275302 Chemokine (C-C motif) ligand 4 CCL4L2 ENSG00000276070 Chemokine (C-C motif) ligand 4-like 2 CCL5 ENSG00000271503 Chemokine (C-C motif) ligand 5 CCL7 ENSG00000108688 Chemokine (C-C motif) ligand 7 CCL8 ENSG00000108700 Chemokine (C-C motif) ligand 8 CCNB1IP1 ENSG00000100814 Cyclin B1 interacting protein 1, E3 ubiquitin protein ligase CCNL1 ENSG00000163660 Cyclin L1 CCNL2 ENSG00000221978 Cyclin L2 CD14 ENSG00000170458 CD14 molecule CD160 ENSG00000117281 CD160 molecule CD164 ENSG00000135535 CD164 molecule, sialomucin CD177 ENSG00000204936 CD177 molecule CD1E ENSG00000158488 CD1e molecule CD2 ENSG00000116824 CD2 molecule CD200 ENSG00000091972 CD200 molecule CD200R1 ENSG00000163606 CD200 receptor 1 CD22 ENSG00000012124 CD22 molecule CD226 ENSG00000150637 CD226 molecule CD24 ENSG00000272398 CD24 molecule CD276 ENSG00000103855 CD276 molecule CD300A ENSG00000167851 CD300a molecule CD300LB ENSG00000178789 CD300 molecule-like family member b CD300LF ENSG00000186074 CD300 molecule-like family member f CD300LG ENSG00000161649 CD300 molecule-like family member g CD3D ENSG00000167286 CD3d molecule, delta (CD3-TCR complex) CD4 ENSG00000010610 CD4 molecule CD40 ENSG00000101017 CD40 molecule, TNF receptor superfamily member 5 CD44 ENSG00000026508 CD44 molecule (Indian blood group) CD48 ENSG00000117091 CD48 molecule CD5 ENSG00000110448 CD5 molecule CD55 ENSG00000196352 CD55 molecule, decay accelerating factor for complement (Cromer blood group) CD59 ENSG00000085063 CD59 molecule, complement regulatory protein CD5L ENSG00000073754 CD5 molecule-like CD6 ENSG00000013725 CD6 molecule CD68 ENSG00000129226 CD68 molecule CD7 ENSG00000173762 CD7 molecule CD79A ENSG00000105369 CD79a molecule, immunoglobulin-associated alpha CD80 ENSG00000121594 CD80 molecule CD86 ENSG00000114013 CD86 molecule CD8A ENSG00000153563 CD8a molecule CD8B ENSG00000172116 CD8b molecule CD99 ENSG00000002586 CD99 molecule CDC23 ENSG00000094880 Cell division cycle 23 CDC40 ENSG00000168438 Cell division cycle 40 CDC45 ENSG00000093009 Cell division cycle 45 CDCP1 ENSG00000163814 CUB domain containing protein 1 CDCP2 ENSG00000157211 CUB domain containing protein 2 CDH1 ENSG00000039068 Cadherin 1, type 1 CDH11 ENSG00000140937 Cadherin 11, type 2, OB-cadherin (osteoblast) CDH13 ENSG00000140945 Cadherin 13 CDH17 ENSG00000079112 Cadherin 17, LI cadherin (liver-intestine) CDH18 ENSG00000145526 Cadherin 18, type 2 CDH19 ENSG00000071991 Cadherin 19, type 2 CDH23 ENSG00000107736 Cadherin-related 23 CDH5 ENSG00000179776 Cadherin 5, type 2 (vascular endothelium) CDHR1 ENSG00000148600 Cadherin-related family member 1 CDHR4 ENSG00000187492 Cadherin-related family member 4 CDHR5 ENSG00000099834 Cadherin-related family member 5 CDKN2A ENSG00000147889 Cyclin-dependent kinase inhibitor 2A CDNF ENSG00000185267 Cerebral dopamine neurotrophic factor CDON ENSG00000064309 Cell adhesion associated, oncogene regulated CDSN ENSG00000204539 Corneodesmosin CEACAM16 ENSG00000213892 Carcinoembryonic antigen-related cell adhesion molecule 16 CEACAM18 ENSG00000213822 Carcinoembryonic antigen-related cell adhesion molecule 18 CEACAM19 ENSG00000186567 Carcinoembryonic antigen-related cell adhesion molecule 19 CEACAM5 ENSG00000105388 Carcinoembryonic antigen-related cell adhesion molecule 5 CEACAM7 ENSG00000007306 Carcinoembryonic antigen-related cell adhesion molecule 7 CEACAM8 ENSG00000124469 Carcinoembryonic antigen-related cell adhesion molecule 8 CECR1 ENSG00000093072 Cat eye syndrome chromosome region, candidate 1 CECR5 ENSG00000069998 Cat eye syndrome chromosome region, candidate 5 CEL ENSG00000170835 Carboxyl ester lipase CELA2A ENSG00000142615 Chymotrypsin-like elastase family, member 2A CELA2B ENSG00000215704 Chymotrypsin-like elastase family, member 2B CELA3A ENSG00000142789 Chymotrypsin-like elastase family, member 3A CELA3B ENSG00000219073 Chymotrypsin-like elastase family, member 3B CEMIP ENSG00000103888 Cell migration inducing protein, hyaluronan binding CEP89 ENSG00000121289 Centrosomal protein 89 kDa CER1 ENSG00000147869 Cerberus 1, DAN family BMP antagonist CERCAM ENSG00000167123 Cerebral endothelial cell adhesion molecule CERS1 ENSG00000223802 Ceramide synthase 1 CES1 ENSG00000198848 Carboxylesterase 1 CES3 ENSG00000172828 Carboxylesterase 3 CES4A ENSG00000172824 Carboxylesterase 4A CES5A ENSG00000159398 Carboxylesterase 5A CETP ENSG00000087237 Cholesteryl ester transfer protein, plasma CFB ENSG00000243649 Complement factor B CFC1 ENSG00000136698 Cripto, FRL-1, cryptic family 1 CFC1B ENSG00000152093 Cripto, FRL-1, cryptic family 1B CFD ENSG00000197766 Complement factor D (adipsin) CFDP1 ENSG00000153774 Craniofacial development protein 1 CFH ENSG00000000971 Complement factor H CFHR1 ENSG00000244414 Complement factor H-related 1 CFHR2 ENSG00000080910 Complement factor H-related 2 CFHR3 ENSG00000116785 Complement factor H-related 3 CFHR4 ENSG00000134365 Complement factor H-related 4 CFHR5 ENSG00000134389 Complement factor H-related 5 CFI ENSG00000205403 Complement factor I CFP ENSG00000126759 Complement factor properdin CGA ENSG00000135346 Glycoprotein hormones, alpha polypeptide CGB ENSG00000104827 Chorionic gonadotropin, beta polypeptide CGB1 ENSG00000267631 Chorionic gonadotropin, beta polypeptide 1 CGB2 ENSG00000104818 Chorionic gonadotropin, beta polypeptide 2 CGB5 ENSG00000189052 Chorionic gonadotropin, beta polypeptide 5 CGB7 ENSG00000196337 Chorionic gonadotropin, beta polypeptide 7 CGB8 ENSG00000213030 Chorionic gonadotropin, beta polypeptide 8 CGREF1 ENSG00000138028 Cell growth regulator with EF-hand domain 1 CH507-9B2.3 ENSG00000280071 CHAD ENSG00000136457 Chondroadherin CHADL ENSG00000100399 Chondroadherin-like CHEK2 ENSG00000183765 Checkpoint kinase 2 CHGA ENSG00000100604 Chromogranin A CHGB ENSG00000089199 Chromogranin B CHI3L1 ENSG00000133048 Chitinase 3-like 1 (cartilage glycoprotein-39) CHI3L2 ENSG00000064886 Chitinase 3-like 2 CHIA ENSG00000134216 Chitinase, acidic CHID1 ENSG00000177830 Chitinase domain containing 1 CHIT1 ENSG00000133063 Chitinase 1 (chitotriosidase) CHL1 ENSG00000134121 Cell adhesion molecule L1-like CHN1 ENSG00000128656 Chimerin 1 CHPF ENSG00000123989 Chondroitin polymerizing factor CHPF2 ENSG00000033100 Chondroitin polymerizing factor 2 CHRD ENSG00000090539 Chordin CHRDL1 ENSG00000101938 Chordin-like 1 CHRDL2 ENSG00000054938 Chordin-like 2 CHRNA2 ENSG00000120903 Cholinergic receptor, nicotinic, alpha 2 (neuronal) CHRNA5 ENSG00000169684 Cholinergic receptor, nicotinic, alpha 5 (neuronal) CHRNB1 ENSG00000170175 Cholinergic receptor, nicotinic, beta 1 (muscle) CHRND ENSG00000135902 Cholinergic receptor, nicotinic, delta (muscle) CHST1 ENSG00000175264 Carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 CHST10 ENSG00000115526 Carbohydrate sulfotransferase 10 CHST11 ENSG00000171310 Carbohydrate (chondroitin 4) sulfotransferase 11 CHST13 ENSG00000180767 Carbohydrate (chondroitin 4) sulfotransferase 13 CHST4 ENSG00000140835 Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 CHST5 ENSG00000135702 Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 CHST6 ENSG00000183196 Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 CHST7 ENSG00000147119 Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 CHST8 ENSG00000124302 Carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8 CHSY1 ENSG00000131873 Chondroitin sulfate synthase 1 CHSY3 ENSG00000198108 Chondroitin sulfate synthase 3 CHTF8 ENSG00000168802 Chromosome transmission fidelity factor 8 CILP ENSG00000138615 Cartilage intermediate layer protein, nucleotide pyrophosphohydrolase CILP2 ENSG00000160161 Cartilage intermediate layer protein 2 CIRH1A ENSG00000141076 Cirrhosis, autosomal recessive 1A (cirhin) CKLF ENSG00000217555 Chemokine-like factor CKMT1A ENSG00000223572 Creatine kinase, mitochondrial 1A CKMT1B ENSG00000237289 Creatine kinase, mitochondrial 1B CLCA1 ENSG00000016490 Chloride channel accessory 1 CLCF1 ENSG00000175505 Cardiotrophin-like cytokine factor 1 CLDN15 ENSG00000106404 Claudin 15 CLDN7 ENSG00000181885 Claudin 7 CLDND1 ENSG00000080822 Claudin domain containing 1 CLEC11A ENSG00000105472 C-type lectin domain family 11, member A CLEC16A ENSG00000038532 C-type lectin domain family 16, member A CLEC18A ENSG00000157322 C-type lectin domain family 18, member A CLEC18B ENSG00000140839 C-type lectin domain family 18, member B CLEC18C ENSG00000157335 C-type lectin domain family 18, member C CLEC19A ENSG00000261210 C-type lectin domain family 19, member A CLEC2B ENSG00000110852 C-type lectin domain family 2, member B CLEC3A ENSG00000166509 C-type lectin domain family 3, member A CLEC3B ENSG00000163815 C-type lectin domain family 3, member B CLGN ENSG00000153132 Calmegin CLN5 ENSG00000102805 Ceroid-lipofuscinosis, neuronal 5 CLPS ENSG00000137392 Colipase, pancreatic CLPSL1 ENSG00000204140 Colipase-like 1 CLPSL2 ENSG00000196748 Colipase-like 2 CLPX ENSG00000166855 Caseinolytic mitochondrial matrix peptidase chaperone subunit CLSTN3 ENSG00000139182 Calsyntenin 3 CLU ENSG00000120885 Clusterin CLUL1 ENSG00000079101 Clusterin-like 1 (retinal) CMA1 ENSG00000092009 Chymase 1, mast cell CMPK1 ENSG00000162368 Cytidine monophosphate (UMP-CMP) kinase 1, cytosolic CNBD1 ENSG00000176571 Cyclic nucleotide binding domain containing 1 CNDP1 ENSG00000150656 Carnosine dipeptidase 1 (metallopeptidase M20 family) CNPY2 ENSG00000257727 Canopy FGF signaling regulator 2 CNPY3 ENSG00000137161 Canopy FGF signaling regulator 3 CNPY4 ENSG00000166997 Canopy FGF signaling regulator 4 CNTFR ENSG00000122756 Ciliary neurotrophic factor receptor CNTN1 ENSG00000018236 Contactin 1 CNTN2 ENSG00000184144 Contactin 2 (axonal) CNTN3 ENSG00000113805 Contactin 3 (plasmacytoma associated) CNTN4 ENSG00000144619 Contactin 4 CNTN5 ENSG00000149972 Contactin 5 CNTNAP2 ENSG00000174469 Contactin associated protein-like 2 CNTNAP3 ENSG00000106714 Contactin associated protein-like 3 CNTNAP3B ENSG00000154529 Contactin associated protein-like 3B COASY ENSG00000068120 CoA synthase COCH ENSG00000100473 Cochlin COG3 ENSG00000136152 Component of oligomeric golgi complex 3 COL10A1 ENSG00000123500 Collagen, type X, alpha 1 COL11A1 ENSG00000060718 Collagen, type XI, alpha 1 COL11A2 ENSG00000204248 Collagen, type XI, alpha 2 COL12A1 ENSG00000111799 Collagen, type XII, alpha 1 COL14A1 ENSG00000187955 Collagen, type XIV, alpha 1 COL15A1 ENSG00000204291 Collagen, type XV, alpha 1 COL16A1 ENSG00000084636 Collagen, type XVI, alpha 1 COL18A1 ENSG00000182871 Collagen, type XVIII, alpha 1 COL19A1 ENSG00000082293 Collagen, type XIX, alpha 1 COL1A1 ENSG00000108821 Collagen, type I, alpha 1 COL1A2 ENSG00000164692 Collagen, type I, alpha 2 COL20A1 ENSG00000101203 Collagen, type XX, alpha 1 COL21A1 ENSG00000124749 Collagen, type XXI, alpha 1 COL22A1 ENSG00000169436 Collagen, type XXII, alpha 1 COL24A1 ENSG00000171502 Collagen, type XXIV, alpha 1 COL26A1 ENSG00000160963 Collagen, type XXVI, alpha 1 COL27A1 ENSG00000196739 Collagen, type XXVII, alpha 1 COL28A1 ENSG00000215018 Collagen, type XXVIII, alpha 1 COL2A1 ENSG00000139219 Collagen, type II, alpha 1 COL3A1 ENSG00000168542 Collagen, type III, alpha 1 COL4A1 ENSG00000187498 Collagen, type IV, alpha 1 COL4A2 ENSG00000134871 Collagen, type IV, alpha 2 COL4A3 ENSG00000169031 Collagen, type IV, alpha 3 (Goodpasture antigen) COL4A4 ENSG00000081052 Collagen, type IV, alpha 4 COL4A5 ENSG00000188153 Collagen, type IV, alpha 5 COL4A6 ENSG00000197565 Collagen, type IV, alpha 6 COL5A1 ENSG00000130635 Collagen, type V, alpha 1 COL5A2 ENSG00000204262 Collagen, type V, alpha 2 COL5A3 ENSG00000080573 Collagen, type V, alpha 3 COL6A1 ENSG00000142156 Collagen, type VI, alpha 1 COL6A2 ENSG00000142173 Collagen, type VI, alpha 2 COL6A3 ENSG00000163359 Collagen, type VI, alpha 3 COL6A5 ENSG00000172752 Collagen, type VI, alpha 5 COL6A6 ENSG00000206384 Collagen, type VI, alpha 6 COL7A1 ENSG00000114270 Collagen, type VII, alpha 1 COL8A1 ENSG00000144810 Collagen, type VIII, alpha 1 COL8A2 ENSG00000171812 Collagen, type VIII, alpha 2 COL9A1 ENSG00000112280 Collagen, type IX, alpha 1 COL9A2 ENSG00000049089 Collagen, type IX, alpha 2 COL9A3 ENSG00000092758 Collagen, type IX, alpha 3 COLEC10 ENSG00000184374 Collectin sub-family member 10 (C-type lectin) COLEC11 ENSG00000118004 Collectin sub-family member 11 COLGALT1 ENSG00000130309 Collagen beta(1-O)galactosyltransferase 1 COLGALT2 ENSG00000198756 Collagen beta(1-O)galactosyltransferase 2 COLQ ENSG00000206561 Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase COMP ENSG00000105664 Cartilage oligomeric matrix protein COPS6 ENSG00000168090 COP9 signalosome subunit 6 COQ6 ENSG00000119723 Coenzyme Q6 monooxygenase CORT ENSG00000241563 Cortistatin CP ENSG00000047457 Ceruloplasmin (ferroxidase) CPA1 ENSG00000091704 Carboxypeptidase A1 (pancreatic) CPA2 ENSG00000158516 Carboxypeptidase A2 (pancreatic) CPA3 ENSG00000163751 Carboxypeptidase A3 (mast cell) CPA4 ENSG00000128510 Carboxypeptidase A4 CPA6 ENSG00000165078 Carboxypeptidase A6 CPAMD8 ENSG00000160111 C3 and PZP-like, alpha-2-macroglobulin domain containing 8 CPB1 ENSG00000153002 Carboxypeptidase B1 (tissue) CPB2 ENSG00000080618 Carboxypeptidase B2 (plasma) CPE ENSG00000109472 Carboxypeptidase E CPM ENSG00000135678 Carboxypeptidase M CPN1 ENSG00000120054 Carboxypeptidase N, polypeptide 1 CPN2 ENSG00000178772 Carboxypeptidase N, polypeptide 2 CPO ENSG00000144410 Carboxypeptidase O CPQ ENSG00000104324 Carboxypeptidase Q CPVL ENSG00000106066 Carboxypeptidase, vitellogenic-like CPXM1 ENSG00000088882 Carboxypeptidase X (M14 family), member 1 CPXM2 ENSG00000121898 Carboxypeptidase X (M14 family), member 2 CPZ ENSG00000109625 Carboxypeptidase Z CR1L ENSG00000197721 Complement component (3b/4b) receptor 1-like CRB2 ENSG00000148204 Crumbs family member 2 CREG1 ENSG00000143162 Cellular repressor of E1A-stimulated genes 1 CREG2 ENSG00000175874 Cellular repressor of E1A-stimulated genes 2 CRELD1 ENSG00000163703 Cysteine-rich with EGF-like domains 1 CRELD2 ENSG00000184164 Cysteine-rich with EGF-like domains 2 CRH ENSG00000147571 Corticotropin releasing hormone CRHBP ENSG00000145708 Corticotropin releasing hormone binding protein CRHR1 ENSG00000120088 Corticotropin releasing hormone receptor 1 CRHR2 ENSG00000106113 Corticotropin releasing hormone receptor 2 CRISP1 ENSG00000124812 Cysteine-rich secretory protein 1 CRISP2 ENSG00000124490 Cysteine-rich secretory protein 2 CRISP3 ENSG00000096006 Cysteine-rich secretory protein 3 CRISPLD2 ENSG00000103196 Cysteine-rich secretory protein LCCL domain containing 2 CRLF1 ENSG00000006016 Cytokine receptor-like factor 1 CRP ENSG00000132693 C-reactive protein, pentraxin-related CRTAC1 ENSG00000095713 Cartilage acidic protein 1 CRTAP ENSG00000170275 Cartilage associated protein CRY2 ENSG00000121671 Cryptochrome circadian clock 2 CSAD ENSG00000139631 Cysteine sulfinic acid decarboxylase CSF1 ENSG00000184371 Colony stimulating factor 1 (macrophage) CSF1R ENSG00000182578 Colony stimulating factor 1 receptor CSF2 ENSG00000164400 Colony stimulating factor 2 (granulocyte-macrophage) CSF2RA ENSG00000198223 Colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) CSF3 ENSG00000108342 Colony stimulating factor 3 (granulocyte) CSGALNACT1 ENSG00000147408 Chondroitin sulfate N-acetylgalactosaminyltransferase 1 CSH1 ENSG00000136488 Chorionic somatomammotropin hormone 1 (placental lactogen) CSH2 ENSG00000213218 Chorionic somatomammotropin hormone 2 CSHL1 ENSG00000204414 Chorionic somatomammotropin hormone-like 1 CSN1S1 ENSG00000126545 Casein alpha s1 CSN2 ENSG00000135222 Casein beta CSN3 ENSG00000171209 Casein kappa CST1 ENSG00000170373 Cystatin SN CST11 ENSG00000125831 Cystatin 11 CST2 ENSG00000170369 Cystatin SA CST3 ENSG00000101439 Cystatin C CST4 ENSG00000101441 Cystatin S CST5 ENSG00000170367 Cystatin D CST6 ENSG00000175315 Cystatin E/M CST7 ENSG00000077984 Cystatin F (leukocystatin) CST8 ENSG00000125815 Cystatin 8 (cystatin-related epididymal specific) CST9 ENSG00000173335 Cystatin 9 (testatin) CST9L ENSG00000101435 Cystatin 9-like CSTL1 ENSG00000125823 Cystatin-like 1 CT55 ENSG00000169551 Cancer/testis antigen 55 CTB-60B18.6 ENSG00000267335 CTBS ENSG00000117151 Chitobiase, di-N-acetyl- CTD-2313N18.7 ENSG00000225805 CTD-2370N5.3 ENSG00000265118 CTGF ENSG00000118523 Connective tissue growth factor CTHRC1 ENSG00000164932 Collagen triple helix repeat containing 1 CTLA4 ENSG00000163599 Cytotoxic T-lymphocyte-associated protein 4 CTNS ENSG00000040531 Cystinosin, lysosomal cystine transporter CTRB1 ENSG00000168925 Chymotrypsinogen B1 CTRB2 ENSG00000168928 Chymotrypsinogen B2 CTRC ENSG00000162438 Chymotrypsin C (caldecrin) CTRL ENSG00000141086 Chymotrypsin-like CTSA ENSG00000064601 Cathepsin A CTSB ENSG00000164733 Cathepsin B CTSC ENSG00000109861 Cathepsin C CTSD ENSG00000117984 Cathepsin D CTSE ENSG00000196188 Cathepsin E CTSF ENSG00000174080 Cathepsin F CTSG ENSG00000100448 Cathepsin G CTSH ENSG00000103811 Cathepsin H CTSK ENSG00000143387 Cathepsin K CTSL ENSG00000135047 Cathepsin L CTSO ENSG00000256043 Cathepsin O CTSS ENSG00000163131 Cathepsin S CTSV ENSG00000136943 Cathepsin V CTSW ENSG00000172543 Cathepsin W CTSZ ENSG00000101160 Cathepsin Z CUBN ENSG00000107611 Cubilin (intrinsic factor-cobalamin receptor) CUTA ENSG00000112514 CutA divalent cation tolerance homolog (E. coli) CX3CL1 ENSG00000006210 Chemokine (CX3C motif) ligand 1 CXADR ENSG00000154639 Coxsackie virus and adenovirus receptor CXCL1 ENSG00000163739 Chemokine (CXC motif) ligand 1 (melanoma growth stimulating activity, alpha) CXCL10 ENSG00000169245 Chemokine (CXC motif) ligand 10 CXCL11 ENSG00000169248 Chemokine (CXC motif) ligand 11 CXCL12 ENSG00000107562 Chemokine (CXC motif) ligand 12 CXCL13 ENSG00000156234 Chemokine (CXC motif) ligand 13 CXCL14 ENSG00000145824 Chemokine (CXC motif) ligand 14 CXCL17 ENSG00000189377 Chemokine (CXC motif) ligand 17 CXCL2 ENSG00000081041 Chemokine (CXC motif) ligand 2 CXCL3 ENSG00000163734 Chemokine (CXC motif) ligand 3 CXCL5 ENSG00000163735 Chemokine (CXC motif) ligand 5 CXCL6 ENSG00000124875 Chemokine (CXC motif) ligand 6 CXCL8 ENSG00000169429 Chemokine (CXC motif) ligand 8 CXCL9 ENSG00000138755 Chemokine (CXC motif) ligand 9 CXorf36 ENSG00000147113 Chromosome X open reading frame 36 CYB5D2 ENSG00000167740 Cytochrome b5 domain containing 2 CYHR1 ENSG00000187954 Cysteine/histidine-rich 1 CYP17A1 ENSG00000148795 Cytochrome P450, family 17, subfamily A, polypeptide 1 CYP20A1 ENSG00000119004 Cytochrome P450, family 20, subfamily A, polypeptide 1 CYP21A2 ENSG00000231852 Cytochrome P450, family 21, subfamily A, polypeptide 2 CYP26B1 ENSG00000003137 Cytochrome P450, family 26, subfamily B, polypeptide 1 CYP2A6 ENSG00000255974 Cytochrome P450, family 2, subfamily A, polypeptide 6 CYP2A7 ENSG00000198077 Cytochrome P450, family 2, subfamily A, polypeptide 7 CYP2B6 ENSG00000197408 Cytochrome P450, family 2, subfamily B, polypeptide 6 CYP2C18 ENSG00000108242 Cytochrome P450, family 2, subfamily C, polypeptide 18 CYP2C19 ENSG00000165841 Cytochrome P450, family 2, subfamily C, polypeptide 19 CYP2C8 ENSG00000138115 Cytochrome P450, family 2, subfamily C, polypeptide 8 CYP2C9 ENSG00000138109 Cytochrome P450, family 2, subfamily C, polypeptide 9 CYP2E1 ENSG00000130649 Cytochrome P450, family 2, subfamily E, polypeptide 1 CYP2F1 ENSG00000197446 Cytochrome P450, family 2, subfamily F, polypeptide 1 CYP2J2 ENSG00000134716 Cytochrome P450, family 2, subfamily J, polypeptide 2 CYP2R1 ENSG00000186104 Cytochrome P450, family 2, subfamily R, polypeptide 1 CYP2S1 ENSG00000167600 Cytochrome P450, family 2, subfamily S, polypeptide 1 CYP2W1 ENSG00000073067 Cytochrome P450, family 2, subfamily W, polypeptide 1 CYP46A1 ENSG00000036530 Cytochrome P450, family 46, subfamily A, polypeptide 1 CYP4F11 ENSG00000171903 Cytochrome P450, family 4, subfamily F, polypeptide 11 CYP4F2 ENSG00000186115 Cytochrome P450, family 4, subfamily F, polypeptide 2 CYR61 ENSG00000142871 Cysteine-rich, angiogenic inducer, 61 CYTL1 ENSG00000170891 Cytokine-like 1 D2HGDH ENSG00000180902 D-2-hydroxyglutarate dehydrogenase DAG1 ENSG00000173402 Dystroglycan 1 (dystrophin-associated glycoprotein 1) DAND5 ENSG00000179284 DAN domain family member 5, BMP antagonist DAO ENSG00000110887 D-amino-acid oxidase DAZAP2 ENSG00000183283 DAZ associated protein 2 DBH ENSG00000123454 Dopamine beta-hydroxylase (dopamine beta-monooxygenase) DBNL ENSG00000136279 Drebrin-like DCD ENSG00000161634 Dermcidin DCN ENSG00000011465 Decorin DDIAS ENSG00000165490 DNA damage-induced apoptosis suppressor DDOST ENSG00000244038 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) DDR1 ENSG00000204580 Discoidin domain receptor tyrosine kinase 1 DDR2 ENSG00000162733 Discoidin domain receptor tyrosine kinase 2 DDT ENSG00000099977 D-dopachrome tautomerase DDX17 ENSG00000100201 DEAD (Asp-Glu-Ala-Asp) box helicase 17 DDX20 ENSG00000064703 DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 DDX25 ENSG00000109832 DEAD (Asp-Glu-Ala-Asp) box helicase 25 DDX28 ENSG00000182810 DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 DEAF1 ENSG00000177030 DEAF1 transcription factor DEF8 ENSG00000140995 Differentially expressed in FDCP 8 homolog (mouse) DEFA1 ENSG00000206047 Defensin, alpha 1 DEFA1B ENSG00000240247 Defensin, alpha 1B DEFA3 ENSG00000239839 Defensin, alpha 3, neutrophil-specific DEFA4 ENSG00000164821 Defensin, alpha 4, corticostatin DEFA5 ENSG00000164816 Defensin, alpha 5, Paneth cell-specific DEFA6 ENSG00000164822 Defensin, alpha 6, Paneth cell-specific DEFB1 ENSG00000164825 Defensin, beta 1 DEFB103A ENSG00000176797 Defensin, beta 103A DEFB103B ENSG00000177243 Defensin, beta 103B DEFB104A ENSG00000176782 Defensin, beta 104A DEFB104B ENSG00000177023 Defensin, beta 104B DEFB105A ENSG00000186562 Defensin, beta 105A DEFB105B ENSG00000186599 Defensin, beta 105B DEFB106A ENSG00000186579 Defensin, beta 106A DEFB106B ENSG00000187082 Defensin, beta 106B DEFB107A ENSG00000186572 Defensin, beta 107A DEFB107B ENSG00000198129 Defensin, beta 107B DEFB108B ENSG00000184276 Defensin, beta 108B DEFB110 ENSG00000203970 Defensin, beta 110 DEFB113 ENSG00000214642 Defensin, beta 113 DEFB114 ENSG00000177684 Defensin, beta 114 DEFB115 ENSG00000215547 Defensin, beta 115 DEFB116 ENSG00000215545 Defensin, beta 116 DEFB118 ENSG00000131068 Defensin, beta 118 DEFB119 ENSG00000180483 Defensin, beta 119 DEFB121 ENSG00000204548 Defensin, beta 121 DEFB123 ENSG00000180424 Defensin, beta 123 DEFB124 ENSG00000180383 Defensin, beta 124 DEFB125 ENSG00000178591 Defensin, beta 125 DEFB126 ENSG00000125788 Defensin, beta 126 DEFB127 ENSG00000088782 Defensin, beta 127 DEFB128 ENSG00000185982 Defensin, beta 128 DEFB129 ENSG00000125903 Defensin, beta 129 DEFB130 ENSG00000232948 Defensin, beta 130 DEFB131 ENSG00000186146 Defensin, beta 131 DEFB132 ENSG00000186458 Defensin, beta 132 DEFB133 ENSG00000214643 Defensin, beta 133 DEFB134 ENSG00000205882 Defensin, beta 134 DEFB135 ENSG00000205883 Defensin, beta 135 DEFB136 ENSG00000205884 Defensin, beta 136 DEFB4A ENSG00000171711 Defensin, beta 4A DEFB4B ENSG00000177257 Defensin, beta 4B DFNA5 ENSG00000105928 Deafness, autosomal dominant 5 DFNB31 ENSG00000095397 Deafness, autosomal recessive 31 DGCR2 ENSG00000070413 DiGeorge syndrome critical region gene 2 DHH ENSG00000139549 Desert hedgehog DHRS4 ENSG00000157326 Dehydrogenase/reductase (SDR family) member 4 DHRS4L2 ENSG00000187630 Dehydrogenase/reductase (SDR family) member 4 like 2 DHRS7 ENSG00000100612 Dehydrogenase/reductase (SDR family) member 7 DHRS7C ENSG00000184544 Dehydrogenase/reductase (SDR family) member 7C DHRS9 ENSG00000073737 Dehydrogenase/reductase (SDR family) member 9 DHRSX ENSG00000169084 Dehydrogenase/reductase (SDR family) X-linked DHX29 ENSG00000067248 DEAH (Asp-Glu-Ala-His) box polypeptide 29 DHX30 ENSG00000132153 DEAH (Asp-Glu-Ala-His) box helicase 30 DHX8 ENSG00000067596 DEAH (Asp-Glu-Ala-His) box polypeptide 8 DIO2 ENSG00000211448 Deiodinase, iodothyronine, type II DIXDC1 ENSG00000150764 DIX domain containing 1 DKK1 ENSG00000107984 Dickkopf WNT signaling pathway inhibitor 1 DKK2 ENSG00000155011 Dickkopf WNT signaling pathway inhibitor 2 DKK3 ENSG00000050165 Dickkopf WNT signaling pathway inhibitor 3 DKK4 ENSG00000104371 Dickkopf WNT signaling pathway inhibitor 4 DKKL1 ENSG00000104901 Dickkopf-like 1 DLG4 ENSG00000132535 Discs, large homolog 4 (Drosophila) DLK1 ENSG00000185559 Delta-like 1 homolog (Drosophila) DLL1 ENSG00000198719 Delta-like 1 (Drosophila) DLL3 ENSG00000090932 Delta-like 3 (Drosophila) DMBT1 ENSG00000187908 Deleted in malignant brain tumors 1 DMKN ENSG00000161249 Dermokine DMP1 ENSG00000152592 Dentin matrix acidic phosphoprotein 1 DMRTA2 ENSG00000142700 DMRT-like family A2 DNAAF5 ENSG00000164818 Dynein, axonemal, assembly factor 5 DNAH14 ENSG00000185842 Dynein, axonemal, heavy chain 14 DNAJB11 ENSG00000090520 DnaJ (Hsp40) homolog, subfamily B, member 11 DNAJB9 ENSG00000128590 DnaJ (Hsp40) homolog, subfamily B, member 9 DNAJC25-GNG10 ENSG00000244115 DNAJC25-GNG10 readthrough DNAJC3 ENSG00000102580 DnaJ (Hsp40) homolog, subfamily C, member 3 DNASE1 ENSG00000213918 Deoxyribonuclease I DNASE1L1 ENSG00000013563 Deoxyribonuclease I-like 1 DNASE1L2 ENSG00000167968 Deoxyribonuclease I-like 2 DNASE1L3 ENSG00000163687 Deoxyribonuclease I-like 3 DNASE2 ENSG00000105612 Deoxyribonuclease II, lysosomal DNASE2B ENSG00000137976 Deoxyribonuclease II beta DPEP1 ENSG00000015413 Dipeptidase 1 (renal) DPEP2 ENSG00000167261 Dipeptidase 2 DPEP3 ENSG00000141096 Dipeptidase 3 DPF3 ENSG00000205683 D4, zinc and double PHD fingers, family 3 DPP4 ENSG00000197635 Dipeptidyl-peptidase 4 DPP7 ENSG00000176978 Dipeptidyl-peptidase 7 DPT ENSG00000143196 Dermatopontin DRAXIN ENSG00000162490 Dorsal inhibitory axon guidance protein DSE ENSG00000111817 Dermatan sulfate epimerase DSG2 ENSG00000046604 Desmoglein 2 DSPP ENSG00000152591 Dentin sialophosphoprotein DST ENSG00000151914 Dystonin DUOX1 ENSG00000137857 Dual oxidase 1 DYNLT3 ENSG00000165169 Dynein, light chain, Tctex-type 3 E2F5 ENSG00000133740 E2F transcription factor 5, p130-binding EBAG9 ENSG00000147654 Estrogen receptor binding site associated, antigen, 9 EBI3 ENSG00000105246 Epstein-Barr virus induced 3 ECHDC1 ENSG00000093144 Ethylmalonyl-CoA decarboxylase 1 ECM1 ENSG00000143369 Extracellular matrix protein 1 ECM2 ENSG00000106823 Extracellular matrix protein 2, female organ and adipocyte specific ECSIT ENSG00000130159 ECSIT signalling integrator EDDM3A ENSG00000181562 Epididymal protein 3A EDDM3B ENSG00000181552 Epididymal protein 3B EDEM2 ENSG00000088298 ER degradation enhancer, mannosidase alpha-like 2 EDEM3 ENSG00000116406 ER degradation enhancer, mannosidase alpha-like 3 EDIL3 ENSG00000164176 EGF-like repeats and discoidin I-like domains 3 EDN1 ENSG00000078401 Endothelin 1 EDN2 ENSG00000127129 Endothelin 2 EDN3 ENSG00000124205 Endothelin 3 EDNRB ENSG00000136160 Endothelin receptor type B EFEMP1 ENSG00000115380 EGF containing fibulin-like extracellular matrix protein 1 EFEMP2 ENSG00000172638 EGF containing fibulin-like extracellular matrix protein 2 EFNA1 ENSG00000169242 Ephrin-A1 EFNA2 ENSG00000099617 Ephrin-A2 EFNA4 ENSG00000243364 Ephrin-A4 EGFL6 ENSG00000198759 EGF-like-domain, multiple 6 EGFL7 ENSG00000172889 EGF-like-domain, multiple 7 EGFL8 ENSG00000241404 EGF-like-domain, multiple 8 EGFLAM ENSG00000164318 EGF-like, fibronectin type III and laminin G domains EGFR ENSG00000146648 Epidermal growth factor receptor EHBP1 ENSG00000115504 EH domain binding protein 1 EHF ENSG00000135373 Ets homologous factor EHMT1 ENSG00000181090 Euchromatic histone-lysine N-methyltransferase 1 EHMT2 ENSG00000204371 Euchromatic histone-lysine N-methyltransferase 2 EIF2AK1 ENSG00000086232 Eukaryotic translation initiation factor 2-alpha kinase 1 ELANE ENSG00000197561 Elastase, neutrophil expressed ELN ENSG00000049540 Elastin ELP2 ENSG00000134759 Elongator acetyltransferase complex subunit 2 ELSPBP1 ENSG00000169393 Epididymal sperm binding protein 1 EMC1 ENSG00000127463 ER membrane protein complex subunit 1 EMC10 ENSG00000161671 ER membrane protein complex subunit 10 EMC9 ENSG00000100908 ER membrane protein complex subunit 9 EMCN ENSG00000164035 Endomucin EMID1 ENSG00000186998 EMI domain containing 1 EMILIN1 ENSG00000138080 Elastin microfibril interfacer 1 EMILIN2 ENSG00000132205 Elastin microfibril interfacer 2 EMILIN3 ENSG00000183798 Elastin microfibril interfacer 3 ENAM ENSG00000132464 Enamelin ENDOG ENSG00000167136 Endonuclease G ENDOU ENSG00000111405 Endonuclease, polyU-specific ENHO ENSG00000168913 Energy homeostasis associated ENO4 ENSG00000188316 Enolase family member 4 ENPP6 ENSG00000164303 Ectonucleotide pyrophosphatase/phosphodiesterase 6 ENPP7 ENSG00000182156 Ectonucleotide pyrophosphatase/phosphodiesterase 7 ENTPD5 ENSG00000187097 Ectonucleoside triphosphate diphosphohydrolase 5 ENTPD8 ENSG00000188833 Ectonucleoside triphosphate diphosphohydrolase 8 EOGT ENSG00000163378 EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase EPCAM ENSG00000119888 Epithelial cell adhesion molecule EPDR1 ENSG00000086289 Ependymin related 1 EPGN ENSG00000182585 Epithelial mitogen EPHA10 ENSG00000183317 EPH receptor A10 EPHA3 ENSG00000044524 EPH receptor A3 EPHA4 ENSG00000116106 EPH receptor A4 EPHA7 ENSG00000135333 EPH receptor A7 EPHA8 ENSG00000070886 EPH receptor A8 EPHB2 ENSG00000133216 EPH receptor B2 EPHB4 ENSG00000196411 EPH receptor B4 EPHX3 ENSG00000105131 Epoxide hydrolase 3 EPO ENSG00000130427 Erythropoietin EPPIN ENSG00000101448 Epididymal peptidase inhibitor EPPIN-WFDC6 ENSG00000249139 EPPIN-WFDC6 readthrough EPS15 ENSG00000085832 Epidermal growth factor receptor pathway substrate 15 EPS8L1 ENSG00000131037 EPS8-like 1 EPX ENSG00000121053 Eosinophil peroxidase EPYC ENSG00000083782 Epiphycan EQTN ENSG00000120160 Equatorin, sperm acrosome associated ERAP1 ENSG00000164307 Endoplasmic reticulum aminopeptidase 1 ERAP2 ENSG00000164308 Endoplasmic reticulum aminopeptidase 2 ERBB3 ENSG00000065361 Erb-b2 receptor tyrosine kinase 3 ERLIN1 ENSG00000107566 ER lipid raft associated 1 ERLIN2 ENSG00000147475 ER lipid raft associated 2 ERN1 ENSG00000178607 Endoplasmic reticulum to nucleus signaling 1 ERN2 ENSG00000134398 Endoplasmic reticulum to nucleus signaling 2 ERO1A ENSG00000197930 Endoplasmic reticulum oxidoreductase alpha ERO1B ENSG00000086619 Endoplasmic reticulum oxidoreductase beta ERP27 ENSG00000139055 Endoplasmic reticulum protein 27 ERP29 ENSG00000089248 Endoplasmic reticulum protein 29 ERP44 ENSG00000023318 Endoplasmic reticulum protein 44 ERV3-1 ENSG00000213462 Endogenous retrovirus group 3, member 1 ESM1 ENSG00000164283 Endothelial cell-specific molecule 1 ESRP1 ENSG00000104413 Epithelial splicing regulatory protein 1 EXOG ENSG00000157036 Endo/exonuclease (5-3), endonuclease G-like EXTL1 ENSG00000158008 Exostosin-like glycosyltransferase 1 EXTL2 ENSG00000162694 Exostosin-like glycosyltransferase 2 F10 ENSG00000126218 Coagulation factor X F11 ENSG00000088926 Coagulation factor XI F12 ENSG00000131187 Coagulation factor XII (Hageman factor) F13B ENSG00000143278 Coagulation factor XIII, B polypeptide F2 ENSG00000180210 Coagulation factor II (thrombin) F2R ENSG00000181104 Coagulation factor II (thrombin) receptor F2RL3 ENSG00000127533 Coagulation factor II (thrombin) receptor-like 3 F5 ENSG00000198734 Coagulation factor V (proaccelerin, labile factor) F7 ENSG00000057593 Coagulation factor VII (serum prothrombin conversion accelerator) F8 ENSG00000185010 Coagulation factor VIII, procoagulant component F9 ENSG00000101981 Coagulation factor IX FABP6 ENSG00000170231 Fatty acid binding protein 6, ileal FAM107B ENSG00000065809 Family with sequence similarity 107, member B FAM131A ENSG00000175182 Family with sequence similarity 131, member A FAM132A ENSG00000184163 Family with sequence similarity 132, member A FAM132B ENSG00000178752 Family with sequence similarity 132, member B FAM150A ENSG00000196711 Family with sequence similarity 150, member A FAM150B ENSG00000189292 Family with sequence similarity 150, member B FAM171A1 ENSG00000148468 Family with sequence similarity 171, member A1 FAM171B ENSG00000144369 Family with sequence similarity 171, member B FAM172A ENSG00000113391 Family with sequence similarity 172, member A FAM175A ENSG00000163322 Family with sequence similarity 175, member A FAM177A1 ENSG00000151327 Family with sequence similarity 177, member A1 FAM179B ENSG00000198718 Family with sequence similarity 179, member B FAM180A ENSG00000189320 Family with sequence similarity 180, member A FAM189A1 ENSG00000104059 Family with sequence similarity 189, member A1 FAM198A ENSG00000144649 Family with sequence similarity 198, member A FAM19A1 ENSG00000183662 Family with sequence similarity 19 (chemokine (C-C motif)- like), member A1 FAM19A2 ENSG00000198673 Family with sequence similarity 19 (chemokine (C-C motif)- like), member A2 FAM19A3 ENSG00000184599 Family with sequence similarity 19 (chemokine (C-C motif)- like), member A3 FAM19A4 ENSG00000163377 Family with sequence similarity 19 (chemokine (C-C motif)- like), member A4 FAM19A5 ENSG00000219438 Family with sequence similarity 19 (chemokine (C-C motif)- like), member A5 FAM20A ENSG00000108950 Family with sequence similarity 20, member A FAM20C ENSG00000177706 Family with sequence similarity 20, member C FAM213A ENSG00000122378 Family with sequence similarity 213, member A FAM26D ENSG00000164451 Family with sequence similarity 26, member D FAM46B ENSG00000158246 Family with sequence similarity 46, member B FAM57A ENSG00000167695 Family with sequence similarity 57, member A FAM78A ENSG00000126882 Family with sequence similarity 78, member A FAM96A ENSG00000166797 Family with sequence similarity 96, member A FAM9B ENSG00000177138 Family with sequence similarity 9, member B FAP ENSG00000078098 Fibroblast activation protein, alpha FAS ENSG00000026103 Fas cell surface death receptor FAT1 ENSG00000083857 FAT atypical cadherin 1 FBLN1 ENSG00000077942 Fibulin 1 FBLN2 ENSG00000163520 Fibulin 2 FBLN5 ENSG00000140092 Fibulin 5 FBLN7 ENSG00000144152 Fibulin 7 FBN1 ENSG00000166147 Fibrillin 1 FBN2 ENSG00000138829 Fibrillin 2 FBN3 ENSG00000142449 Fibrillin 3 FBXW7 ENSG00000109670 F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase FCAR ENSG00000186431 Fc fragment of IgA receptor FCGBP ENSG00000275395 Fc fragment of IgG binding protein FCGR1B ENSG00000198019 Fc fragment of IgG, high affinity Ib, receptor (CD64) FCGR3A ENSG00000203747 Fc fragment of IgG, low affinity IIIa, receptor (CD16a) FCGRT ENSG00000104870 Fc fragment of IgG, receptor, transporter, alpha FCMR ENSG00000162894 Fc fragment of IgM receptor FCN1 ENSG00000085265 Ficolin (collagen/fibrinogen domain containing) 1 FCN2 ENSG00000160339 Ficolin (collagen/fibrinogen domain containing lectin) 2 FCN3 ENSG00000142748 Ficolin (collagen/fibrinogen domain containing) 3 FCRL1 ENSG00000163534 Fc receptor-like 1 FCRL3 ENSG00000160856 Fc receptor-like 3 FCRL5 ENSG00000143297 Fc receptor-like 5 FCRLA ENSG00000132185 Fc receptor-like A FCRLB ENSG00000162746 Fc receptor-like B FDCSP ENSG00000181617 Follicular dendritic cell secreted protein FETUB ENSG00000090512 Fetuin B FGA ENSG00000171560 Fibrinogen alpha chain FGB ENSG00000171564 Fibrinogen beta chain FGF10 ENSG00000070193 Fibroblast growth factor 10 FGF17 ENSG00000158815 Fibroblast growth factor 17 FGF18 ENSG00000156427 Fibroblast growth factor 18 FGF19 ENSG00000162344 Fibroblast growth factor 19 FGF21 ENSG00000105550 Fibroblast growth factor 21 FGF22 ENSG00000070388 Fibroblast growth factor 22 FGF23 ENSG00000118972 Fibroblast growth factor 23 FGF3 ENSG00000186895 Fibroblast growth factor 3 FGF4 ENSG00000075388 Fibroblast growth factor 4 FGF5 ENSG00000138675 Fibroblast growth factor 5 FGF7 ENSG00000140285 Fibroblast growth factor 7 FGF8 ENSG00000107831 Fibroblast growth factor 8 (androgen-induced) FGFBP1 ENSG00000137440 Fibroblast growth factor binding protein 1 FGFBP2 ENSG00000137441 Fibroblast growth factor binding protein 2 FGFBP3 ENSG00000174721 Fibroblast growth factor binding protein 3 FGFR1 ENSG00000077782 Fibroblast growth factor receptor 1 FGFR2 ENSG00000066468 Fibroblast growth factor receptor 2 FGFR3 ENSG00000068078 Fibroblast growth factor receptor 3 FGFR4 ENSG00000160867 Fibroblast growth factor receptor 4 FGFRL1 ENSG00000127418 Fibroblast growth factor receptor-like 1 FGG ENSG00000171557 Fibrinogen gamma chain FGL1 ENSG00000104760 Fibrinogen-like 1 FGL2 ENSG00000127951 Fibrinogen-like 2 FHL1 ENSG00000022267 Four and a half LIM domains 1 FHOD3 ENSG00000134775 Formin homology 2 domain containing 3 FIBIN ENSG00000176971 Fin bud initiation factor homolog (zebrafish) FICD ENSG00000198855 FIC domain containing FIGF ENSG00000165197 C-fos induced growth factor (vascular endothelial growth factor D) FJX1 ENSG00000179431 Four jointed box 1 FKBP10 ENSG00000141756 FK506 binding protein 10, 65 kDa FKBP11 ENSG00000134285 FK506 binding protein 11, 19 kDa FKBP14 ENSG00000106080 FK506 binding protein 14, 22 kDa FKBP2 ENSG00000173486 FK506 binding protein 2, 13 kDa FKBP7 ENSG00000079150 FK506 binding protein 7 FKBP9 ENSG00000122642 FK506 binding protein 9, 63 kDa FLT1 ENSG00000102755 Fms-related tyrosine kinase 1 FLT4 ENSG00000037280 Fms-related tyrosine kinase 4 FMO1 ENSG00000010932 Flavin containing monooxygenase 1 FMO2 ENSG00000094963 Flavin containing monooxygenase 2 (non-functional) FMO3 ENSG00000007933 Flavin containing monooxygenase 3 FMO5 ENSG00000131781 Flavin containing monooxygenase 5 FMOD ENSG00000122176 Fibromodulin FN1 ENSG00000115414 Fibronectin 1 FNDC1 ENSG00000164694 Fibronectin type III domain containing 1 FNDC7 ENSG00000143107 Fibronectin type III domain containing 7 FOCAD ENSG00000188352 Focadhesin FOLR2 ENSG00000165457 Folate receptor 2 (fetal) FOLR3 ENSG00000110203 Folate receptor 3 (gamma) FOXRED2 ENSG00000100350 FAD-dependent oxidoreductase domain containing 2 FP325331.1 ENSG00000278881 Uncharacterized protein UNQ6126/PRO20091 FPGS ENSG00000136877 Folylpolyglutamate synthase FRAS1 ENSG00000138759 Fraser extracellular matrix complex subunit 1 FREM1 ENSG00000164946 FRAS1 related extracellular matrix 1 FREM3 ENSG00000183090 FRAS1 related extracellular matrix 3 FRMPD2 ENSG00000170324 FERM and PDZ domain containing 2 FRZB ENSG00000162998 Frizzled-related protein FSHB ENSG00000131808 Follicle stimulating hormone, beta polypeptide FSHR ENSG00000170820 Follicle stimulating hormone receptor FST ENSG00000134363 Follistatin FSTL1 ENSG00000163430 Follistatin-like 1 FSTL3 ENSG00000070404 Follistatin-like 3 (secreted glycoprotein) FSTL4 ENSG00000053108 Follistatin-like 4 FSTL5 ENSG00000168843 Follistatin-like 5 FTCDNL1 ENSG00000226124 Formiminotransferase cyclodeaminase N-terminal like FUCA1 ENSG00000179163 Fucosidase, alpha-L-1, tissue FUCA2 ENSG00000001036 Fucosidase, alpha-L-2, plasma FURIN ENSG00000140564 Furin (paired basic amino acid cleaving enzyme) FUT10 ENSG00000172728 Fucosyltransferase 10 (alpha (1,3) fucosyltransferase) FUT11 ENSG00000196968 Fucosyltransferase 11 (alpha (1,3) fucosyltransferase) FXN ENSG00000165060 Frataxin FXR1 ENSG00000114416 Fragile X mental retardation, autosomal homolog 1 FXYD3 ENSG00000089356 FXYD domain containing ion transport regulator 3 GABBR1 ENSG00000204681 Gamma-aminobutyric acid (GABA) B receptor, 1 GABRA1 ENSG00000022355 Gamma-aminobutyric acid (GABA) A receptor, alpha 1 GABRA2 ENSG00000151834 Gamma-aminobutyric acid (GABA) A receptor, alpha 2 GABRA5 ENSG00000186297 Gamma-aminobutyric acid (GABA) A receptor, alpha 5 GABRG3 ENSG00000182256 Gamma-aminobutyric acid (GABA) A receptor, gamma 3 GABRP ENSG00000094755 Gamma-aminobutyric acid (GABA) A receptor, pi GAL ENSG00000069482 Galanin/GMAP prepropeptide GAL3ST1 ENSG00000128242 Galactose-3-O-sulfotransferase 1 GAL3ST2 ENSG00000154252 Galactose-3-O-sulfotransferase 2 GAL3ST3 ENSG00000175229 Galactose-3-O-sulfotransferase 3 GALC ENSG00000054983 Galactosylceramidase GALNS ENSG00000141012 Galactosamine (N-acetyl)-6-sulfatase GALNT10 ENSG00000164574 Polypeptide N-acetylgalactosaminyltransferase 10 GALNT12 ENSG00000119514 Polypeptide N-acetylgalactosaminyltransferase 12 GALNT15 ENSG00000131386 Polypeptide N-acetylgalactosaminyltransferase 15 GALNT2 ENSG00000143641 Polypeptide N-acetylgalactosaminyltransferase 2 GALNT6 ENSG00000139629 Polypeptide N-acetylgalactosaminyltransferase 6 GALNT8 ENSG00000130035 Polypeptide N-acetylgalactosaminyltransferase 8 GALNTL6 ENSG00000174473 Polypeptide N-acetylgalactosaminyltransferase-like 6 GALP ENSG00000197487 Galanin-like peptide GANAB ENSG00000089597 Glucosidase, alpha; neutral AB GARS ENSG00000106105 Glycyl-tRNA synthetase GAS1 ENSG00000180447 Growth arrest-specific 1 GAS6 ENSG00000183087 Growth arrest-specific 6 GAST ENSG00000184502 Gastrin GBA ENSG00000177628 Glucosidase, beta, acid GBGT1 ENSG00000148288 Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 GC ENSG00000145321 Group-specific component (vitamin D binding protein) GCG ENSG00000115263 Glucagon GCGR ENSG00000215644 Glucagon receptor GCNT7 ENSG00000124091 Glucosaminyl (N-acetyl) transferase family member 7 GCSH ENSG00000140905 Glycine cleavage system protein H (aminomethyl carrier) GDF1 ENSG00000130283 Growth differentiation factor 1 GDF10 ENSG00000266524 Growth differentiation factor 10 GDF11 ENSG00000135414 Growth differentiation factor 11 GDF15 ENSG00000130513 Growth differentiation factor 15 GDF2 ENSG00000263761 Growth differentiation factor 2 GDF3 ENSG00000184344 Growth differentiation factor 3 GDF5 ENSG00000125965 Growth differentiation factor 5 GDF6 ENSG00000156466 Growth differentiation factor 6 GDF7 ENSG00000143869 Growth differentiation factor 7 GDF9 ENSG00000164404 Growth differentiation factor 9 GDNF ENSG00000168621 Glial cell derived neurotrophic factor GFOD2 ENSG00000141098 Glucose-fructose oxidoreductase domain containing 2 GFPT2 ENSG00000131459 Glutamine-fructose-6-phosphate transaminase 2 GFRA2 ENSG00000168546 GDNF family receptor alpha 2 GFRA4 ENSG00000125861 GDNF family receptor alpha 4 GGA2 ENSG00000103365 Golgi-associated, gamma adaptin ear containing, ARF binding protein 2 GGH ENSG00000137563 Gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) GGT1 ENSG00000100031 Gamma-glutamyltransferase 1 GGT5 ENSG00000099998 Gamma-glutamyltransferase 5 GH1 ENSG00000259384 Growth hormone 1 GH2 ENSG00000136487 Growth hormone 2 GHDC ENSG00000167925 GH3 domain containing GHRH ENSG00000118702 Growth hormone releasing hormone GHRHR ENSG00000106128 Growth hormone releasing hormone receptor GHRL ENSG00000157017 Ghrelin/obestatin prepropeptide GIF ENSG00000134812 Gastric intrinsic factor (vitamin B synthesis) GIP ENSG00000159224 Gastric inhibitory polypeptide GKN1 ENSG00000169605 Gastrokine 1 GKN2 ENSG00000183607 Gastrokine 2 GLA ENSG00000102393 Galactosidase, alpha GLB1 ENSG00000170266 Galactosidase, beta 1 GLB1L ENSG00000163521 Galactosidase, beta 1-like GLB1L2 ENSG00000149328 Galactosidase, beta 1-like 2 GLCE ENSG00000138604 Glucuronic acid epimerase GLG1 ENSG00000090863 Golgi glycoprotein 1 GLIPR1 ENSG00000139278 GLI pathogenesis-related 1 GLIPR1L1 ENSG00000173401 GLI pathogenesis-related 1 like 1 GLIS3 ENSG00000107249 GLIS family zinc finger 3 GLMP ENSG00000198715 Glycosylated lysosomal membrane protein GLRB ENSG00000109738 Glycine receptor, beta GLS ENSG00000115419 Glutaminase GLT6D1 ENSG00000204007 Glycosyltransferase 6 domain containing 1 GLTPD2 ENSG00000182327 Glycolipid transfer protein domain containing 2 GLUD1 ENSG00000148672 Glutamate dehydrogenase 1 GM2A ENSG00000196743 GM2 ganglioside activator GML ENSG00000104499 Glycosylphosphatidylinositol anchored molecule like GNAS ENSG00000087460 GNAS complex locus GNLY ENSG00000115523 Granulysin GNPTG ENSG00000090581 N-acetylglucosamine-1-phosphate transferase, gamma subunit GNRH1 ENSG00000147437 Gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) GNRH2 ENSG00000125787 Gonadotropin-releasing hormone 2 GNS ENSG00000135677 Glucosamine (N-acetyl)-6-sulfatase GOLM1 ENSG00000135052 Golgi membrane protein 1 GORAB ENSG00000120370 Golgin, RAB6-interacting GOT2 ENSG00000125166 Glutamic-oxaloacetic transaminase 2, mitochondrial GP2 ENSG00000169347 Glycoprotein 2 (zymogen granule membrane) GP6 ENSG00000088053 Glycoprotein VI (platelet) GPC2 ENSG00000213420 Glypican 2 GPC5 ENSG00000179399 Glypican 5 GPC6 ENSG00000183098 Glypican 6 GPD2 ENSG00000115159 Glycerol-3-phosphate dehydrogenase 2 (mitochondrial) GPER1 ENSG00000164850 G protein-coupled estrogen receptor 1 GPHA2 ENSG00000149735 Glycoprotein hormone alpha 2 GPHB5 ENSG00000179600 Glycoprotein hormone beta 5 GPIHBP1 ENSG00000277494 Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 GPLD1 ENSG00000112293 Glycosylphosphatidylinositol specific phospholipase D1 GPNMB ENSG00000136235 Glycoprotein (transmembrane) nmb GPR162 ENSG00000250510 G protein-coupled receptor 162 GPX3 ENSG00000211445 Glutathione peroxidase 3 GPX4 ENSG00000167468 Glutathione peroxidase 4 GPX5 ENSG00000224586 Glutathione peroxidase 5 GPX6 ENSG00000198704 Glutathione peroxidase 6 GPX7 ENSG00000116157 Glutathione peroxidase 7 GREM1 ENSG00000166923 Gremlin 1, DAN family BMP antagonist GREM2 ENSG00000180875 Gremlin 2, DAN family BMP antagonist GRHL3 ENSG00000158055 Grainyhead-like transcription factor 3 GRIA2 ENSG00000120251 Glutamate receptor, ionotropic, AMPA 2 GRIA3 ENSG00000125675 Glutamate receptor, ionotropic, AMPA 3 GRIA4 ENSG00000152578 Glutamate receptor, ionotropic, AMPA 4 GRIK2 ENSG00000164418 Glutamate receptor, ionotropic, kainate 2 GRIN2B ENSG00000273079 Glutamate receptor, ionotropic, N-methyl D-aspartate 2B GRM2 ENSG00000164082 Glutamate receptor, metabotropic 2 GRM3 ENSG00000198822 Glutamate receptor, metabotropic 3 GRM5 ENSG00000168959 Glutamate receptor, metabotropic 5 GRN ENSG00000030582 Granulin GRP ENSG00000134443 Gastrin-releasing peptide GSG1 ENSG00000111305 Germ cell associated 1 GSN ENSG00000148180 Gelsolin GTDC1 ENSG00000121964 Glycosyltransferase-like domain containing 1 GTPBP10 ENSG00000105793 GTP-binding protein 10 (putative) GUCA2A ENSG00000197273 Guanylate cyclase activator 2A (guanylin) GUCA2B ENSG00000044012 Guanylate cyclase activator 2B (uroguanylin) GUSB ENSG00000169919 Glucuronidase, beta GVQW1 ENSG00000241043 GVQW motif containing 1 GXYLT1 ENSG00000151233 Glucoside xylosyltransferase 1 GXYLT2 ENSG00000172986 Glucoside xylosyltransferase 2 GYLTL1B ENSG00000165905 Glycosyltransferase-like 1B GYPB ENSG00000250361 Glycophorin B (MNS blood group) GZMA ENSG00000145649 Granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) GZMB ENSG00000100453 Granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) GZMH ENSG00000100450 Granzyme H (cathepsin G-like 2, protein h-CCPX) GZMK ENSG00000113088 Granzyme K (granzyme 3; tryptase II) GZMM ENSG00000197540 Granzyme M (lymphocyte met-ase 1) H6PD ENSG00000049239 Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) HABP2 ENSG00000148702 Hyaluronan binding protein 2 HADHB ENSG00000138029 Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit HAMP ENSG00000105697 Hepcidin antimicrobial peptide HAPLN1 ENSG00000145681 Hyaluronan and proteoglycan link protein 1 HAPLN2 ENSG00000132702 Hyaluronan and proteoglycan link protein 2 HAPLN3 ENSG00000140511 Hyaluronan and proteoglycan link protein 3 HAPLN4 ENSG00000187664 Hyaluronan and proteoglycan link protein 4 HARS2 ENSG00000112855 Histidyl-tRNA synthetase 2, mitochondrial HAVCR1 ENSG00000113249 Hepatitis A virus cellular receptor 1 HCCS ENSG00000004961 Holocytochrome c synthase HCRT ENSG00000161610 Hypocretin (orexin) neuropeptide precursor HEATR5A ENSG00000129493 HEAT repeat containing 5A HEPH ENSG00000089472 Hephaestin HEXA ENSG00000213614 Hexosaminidase A (alpha polypeptide) HEXB ENSG00000049860 Hexosaminidase B (beta polypeptide) HFE2 ENSG00000168509 Hemochromatosis type 2 (juvenile) HGF ENSG00000019991 Hepatocyte growth factor (hepapoietin A; scatter factor) HGFAC ENSG00000109758 HGF activator HHIP ENSG00000164161 Hedgehog interacting protein HHIPL1 ENSG00000182218 HHIP-like 1 HHIPL2 ENSG00000143512 HHIP-like 2 HHLA1 ENSG00000132297 HERV-H LTR-associating 1 HHLA2 ENSG00000114455 HERV-H LTR-associating 2 HIBADH ENSG00000106049 3-hydroxyisobutyrate dehydrogenase HINT2 ENSG00000137133 Histidine triad nucleotide binding protein 2 HLA-A ENSG00000206503 Major histocompatibility complex, class I, A HLA-C ENSG00000204525 Major histocompatibility complex, class I, C HLA-DOA ENSG00000204252 Major histocompatibility complex, class II, DO alpha HLA-DPA1 ENSG00000231389 Major histocompatibility complex, class II, DP alpha 1 HLA-DQA1 ENSG00000196735 Major histocompatibility complex, class II, DQ alpha 1 HLA-DQB1 ENSG00000179344 Major histocompatibility complex, class II, DQ beta 1 HLA-DQB2 ENSG00000232629 Major histocompatibility complex, class II, DQ beta 2 HMCN1 ENSG00000143341 Hemicentin 1 HMCN2 ENSG00000148357 Hemicentin 2 HMGCL ENSG00000117305 3-hydroxymethyl-3-methylglutaryl-CoA lyase HMHA1 ENSG00000180448 Histocompatibility (minor) HA-1 HMSD ENSG00000221887 Histocompatibility (minor) serpin domain containing HP ENSG00000257017 Haptoglobin HPR ENSG00000261701 Haptoglobin-related protein HPSE ENSG00000173083 Heparanase HPSE2 ENSG00000172987 Heparanase 2 (inactive) HPX ENSG00000110169 Hemopexin HRC ENSG00000130528 Histidine rich calcium binding protein HRG ENSG00000113905 Histidine-rich glycoprotein HRSP12 ENSG00000132541 Heat-responsive protein 12 HS2ST1 ENSG00000153936 Heparan sulfate 2-O-sulfotransferase 1 HS3ST1 ENSG00000002587 Heparan sulfate (glucosamine) 3-O-sulfotransferase 1 HS6ST1 ENSG00000136720 Heparan sulfate 6-O-sulfotransferase 1 HS6ST3 ENSG00000185352 Heparan sulfate 6-O-sulfotransferase 3 HSD11B1L ENSG00000167733 Hydroxysteroid (11-beta) dehydrogenase 1-like HSD17B11 ENSG00000198189 Hydroxysteroid (17-beta) dehydrogenase 11 HSD17B7 ENSG00000132196 Hydroxysteroid (17-beta) dehydrogenase 7 HSP90B1 ENSG00000166598 Heat shock protein 90 kDa beta (Grp94), member 1 HSPA13 ENSG00000155304 Heat shock protein 70 kDa family, member 13 HSPA5 ENSG00000044574 Heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa) HSPG2 ENSG00000142798 Heparan sulfate proteoglycan 2 HTATIP2 ENSG00000109854 HIV-1 Tat interactive protein 2, 30 kDa HTN1 ENSG00000126550 Histatin 1 HTN3 ENSG00000205649 Histatin 3 HTRA1 ENSG00000166033 HtrA serine peptidase 1 HTRA3 ENSG00000170801 HtrA serine peptidase 3 HTRA4 ENSG00000169495 HtrA serine peptidase 4 HYAL1 ENSG00000114378 Hyaluronoglucosaminidase 1 HYAL2 ENSG00000068001 Hyaluronoglucosaminidase 2 HYAL3 ENSG00000186792 Hyaluronoglucosaminidase 3 HYOU1 ENSG00000149428 Hypoxia up-regulated 1 IAPP ENSG00000121351 Islet amyloid polypeptide IBSP ENSG00000029559 Integrin-binding sialoprotein ICAM1 ENSG00000090339 Intercellular adhesion molecule 1 ICAM2 ENSG00000108622 Intercellular adhesion molecule 2 ICAM4 ENSG00000105371 Intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) ID1 ENSG00000125968 Inhibitor of DNA binding 1, dominant negative helix-loop-helix protein IDE ENSG00000119912 Insulin-degrading enzyme IDNK ENSG00000148057 IdnK, gluconokinase homolog (E. coli) IDS ENSG00000010404 Iduronate 2-sulfatase IDUA ENSG00000127415 Iduronidase, alpha-L- IFI27L2 ENSG00000119632 Interferon, alpha-inducible protein 27-like 2 IFI30 ENSG00000216490 Interferon, gamma-inducible protein 30 IFNA1 ENSG00000197919 Interferon, alpha 1 IFNA10 ENSG00000186803 Interferon, alpha 10 IFNA13 ENSG00000233816 Interferon, alpha 13 IFNA14 ENSG00000228083 Interferon, alpha 14 IFNA16 ENSG00000147885 Interferon, alpha 16 IFNA17 ENSG00000234829 Interferon, alpha 17 IFNA2 ENSG00000188379 Interferon, alpha 2 IFNA21 ENSG00000137080 Interferon, alpha 21 IFNA4 ENSG00000236637 Interferon, alpha 4 IFNA5 ENSG00000147873 Interferon, alpha 5 IFNA6 ENSG00000120235 Interferon, alpha 6 IFNA7 ENSG00000214042 Interferon, alpha 7 IFNA8 ENSG00000120242 Interferon, alpha 8 IFNAR1 ENSG00000142166 Interferon (alpha, beta and omega) receptor 1 IFNB1 ENSG00000171855 Interferon, beta 1, fibroblast IFNE ENSG00000184995 Interferon, epsilon IFNG ENSG00000111537 Interferon, gamma IFNGR1 ENSG00000027697 Interferon gamma receptor 1 IFNL1 ENSG00000182393 Interferon, lambda 1 IFNL2 ENSG00000183709 Interferon, lambda 2 IFNL3 ENSG00000197110 Interferon, lambda 3 IFNLR1 ENSG00000185436 Interferon, lambda receptor 1 IFNW1 ENSG00000177047 Interferon, omega 1 IGF1 ENSG00000017427 Insulin-like growth factor 1 (somatomedin C) IGF2 ENSG00000167244 Insulin-like growth factor 2 IGFALS ENSG00000099769 Insulin-like growth factor binding protein, acid labile subunit IGFBP1 ENSG00000146678 Insulin-like growth factor binding protein 1 IGFBP2 ENSG00000115457 Insulin-like growth factor binding protein 2, 36 kDa IGFBP3 ENSG00000146674 Insulin-like growth factor binding protein 3 IGFBP4 ENSG00000141753 Insulin-like growth factor binding protein 4 IGFBP5 ENSG00000115461 Insulin-like growth factor binding protein 5 IGFBP6 ENSG00000167779 Insulin-like growth factor binding protein 6 IGFBP7 ENSG00000163453 Insulin-like growth factor binding protein 7 IGFBPL1 ENSG00000137142 Insulin-like growth factor binding protein-like 1 IGFL1 ENSG00000188293 IGF-like family member 1 IGFL2 ENSG00000204866 IGF-like family member 2 IGFL3 ENSG00000188624 IGF-like family member 3 IGFLR1 ENSG00000126246 IGF-like family receptor 1 IGIP ENSG00000182700 IgA-inducing protein IGLON5 ENSG00000142549 IgLON family member 5 IGSF1 ENSG00000147255 Immunoglobulin superfamily, member 1 IGSF10 ENSG00000152580 Immunoglobulin superfamily, member 10 IGSF11 ENSG00000144847 Immunoglobulin superfamily, member 11 IGSF21 ENSG00000117154 Immunoglobin superfamily, member 21 IGSF8 ENSG00000162729 Immunoglobulin superfamily, member 8 IGSF9 ENSG00000085552 Immunoglobulin superfamily, member 9 IHH ENSG00000163501 Indian hedgehog IL10 ENSG00000136634 Interleukin 10 IL11 ENSG00000095752 Interleukin 11 IL11RA ENSG00000137070 Interleukin 11 receptor, alpha IL12B ENSG00000113302 Interleukin 12B IL12RB1 ENSG00000096996 Interleukin 12 receptor, beta 1 IL12RB2 ENSG00000081985 Interleukin 12 receptor, beta 2 IL13 ENSG00000169194 Interleukin 13 IL13RA1 ENSG00000131724 Interleukin 13 receptor, alpha 1 IL15RA ENSG00000134470 Interleukin 15 receptor, alpha IL17A ENSG00000112115 Interleukin 17A IL17B ENSG00000127743 Interleukin 17B IL17C ENSG00000124391 Interleukin 17C IL17D ENSG00000172458 Interleukin 17D IL17F ENSG00000112116 Interleukin 17F IL17RA ENSG00000177663 Interleukin 17 receptor A IL17RC ENSG00000163702 Interleukin 17 receptor C IL17RE ENSG00000163701 Interleukin 17 receptor E IL18BP ENSG00000137496 Interleukin 18 binding protein IL18R1 ENSG00000115604 Interleukin 18 receptor 1 IL18RAP ENSG00000115607 Interleukin 18 receptor accessory protein IL19 ENSG00000142224 Interleukin 19 IL1R1 ENSG00000115594 Interleukin 1 receptor, type I IL1R2 ENSG00000115590 Interleukin 1 receptor, type II IL1RAP ENSG00000196083 Interleukin 1 receptor accessory protein IL1RL1 ENSG00000115602 Interleukin 1 receptor-like 1 IL1RL2 ENSG00000115598 Interleukin 1 receptor-like 2 IL1RN ENSG00000136689 Interleukin 1 receptor antagonist IL2 ENSG00000109471 Interleukin 2 IL20 ENSG00000162891 Interleukin 20 IL20RA ENSG00000016402 Interleukin 20 receptor, alpha IL21 ENSG00000138684 Interleukin 21 IL22 ENSG00000127318 Interleukin 22 IL22RA2 ENSG00000164485 Interleukin 22 receptor, alpha 2 IL23A ENSG00000110944 Interleukin 23, alpha subunit p19 IL24 ENSG00000162892 Interleukin 24 IL25 ENSG00000166090 Interleukin 25 IL26 ENSG00000111536 Interleukin 26 IL27 ENSG00000197272 Interleukin 27 IL2RB ENSG00000100385 Interleukin 2 receptor, beta IL3 ENSG00000164399 Interleukin 3 IL31 ENSG00000204671 Interleukin 31 IL31RA ENSG00000164509 Interleukin 31 receptor A IL32 ENSG00000008517 Interleukin 32 IL34 ENSG00000157368 Interleukin 34 IL3RA ENSG00000185291 Interleukin 3 receptor, alpha (low affinity) IL4 ENSG00000113520 Interleukin 4 IL4I1 ENSG00000104951 Interleukin 4 induced 1 IL4R ENSG00000077238 Interleukin 4 receptor IL5 ENSG00000113525 Interleukin 5 IL5RA ENSG00000091181 Interleukin 5 receptor, alpha IL6 ENSG00000136244 Interleukin 6 IL6R ENSG00000160712 Interleukin 6 receptor IL6ST ENSG00000134352 Interleukin 6 signal transducer IL7 ENSG00000104432 Interleukin 7 IL7R ENSG00000168685 Interleukin 7 receptor IL9 ENSG00000145839 Interleukin 9 ILDR1 ENSG00000145103 Immunoglobulin-like domain containing receptor 1 ILDR2 ENSG00000143195 Immunoglobulin-like domain containing receptor 2 IMP4 ENSG00000136718 IMP4, U3 small nucleolar ribonucleoprotein IMPG1 ENSG00000112706 Interphotoreceptor matrix proteoglycan 1 INHA ENSG00000123999 Inhibin, alpha INHBA ENSG00000122641 Inhibin, beta A INHBB ENSG00000163083 Inhibin, beta B INHBC ENSG00000175189 Inhibin, beta C INHBE ENSG00000139269 Inhibin, beta E INPP5A ENSG00000068383 Inositol polyphosphate-5-phosphatase A INS ENSG00000254647 Insulin INS-IGF2 ENSG00000129965 INS-IGF2 readthrough INSL3 ENSG00000248099 Insulin-like 3 (Leydig cell) INSL4 ENSG00000120211 Insulin-like 4 (placenta) INSL5 ENSG00000172410 Insulin-like 5 INSL6 ENSG00000120210 Insulin-like 6 INTS3 ENSG00000143624 Integrator complex subunit 3 IPO11 ENSG00000086200 Importin 11 IPO9 ENSG00000198700 Importin 9 IQCF6 ENSG00000214686 IQ motif containing F6 IRAK3 ENSG00000090376 Interleukin-1 receptor-associated kinase 3 IRS4 ENSG00000133124 Insulin receptor substrate 4 ISLR ENSG00000129009 Immunoglobulin superfamily containing leucine-rich repeat ISLR2 ENSG00000167178 Immunoglobulin superfamily containing leucine-rich repeat 2 ISM1 ENSG00000101230 Isthmin 1, angiogenesis inhibitor ISM2 ENSG00000100593 Isthmin 2 ITGA4 ENSG00000115232 Integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) ITGA9 ENSG00000144668 Integrin, alpha 9 ITGAL ENSG00000005844 Integrin, alpha L (antigen CD11A (p180), lymphocyte function- associated antigen 1; alpha polypeptide) ITGAX ENSG00000140678 Integrin, alpha X (complement component 3 receptor 4 subunit) ITGB1 ENSG00000150093 Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) ITGB2 ENSG00000160255 Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) ITGB3 ENSG00000259207 Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) ITGB7 ENSG00000139626 Integrin, beta 7 ITGBL1 ENSG00000198542 Integrin, beta-like 1 (with EGF-like repeat domains) ITIH1 ENSG00000055957 Inter-alpha-trypsin inhibitor heavy chain 1 ITIH2 ENSG00000151655 Inter-alpha-trypsin inhibitor heavy chain 2 ITIH3 ENSG00000162267 Inter-alpha-trypsin inhibitor heavy chain 3 ITIH4 ENSG00000055955 Inter-alpha-trypsin inhibitor heavy chain family, member 4 ITIH5 ENSG00000123243 Inter-alpha-trypsin inhibitor heavy chain family, member 5 ITIH6 ENSG00000102313 Inter-alpha-trypsin inhibitor heavy chain family, member 6 ITLN1 ENSG00000179914 Intelectin 1 (galactofuranose binding) ITLN2 ENSG00000158764 Intelectin 2 IZUMO1R ENSG00000183560 IZUMO1 receptor, JUNO IZUMO4 ENSG00000099840 IZUMO family member 4 JCHAIN ENSG00000132465 Joining chain of multimeric IgA and IgM JMJD8 ENSG00000161999 Jumonji domain containing 8 JSRP1 ENSG00000167476 Junctional sarcoplasmic reticulum protein 1 KANSL2 ENSG00000139620 KAT8 regulatory NSL complex subunit 2 KAZALD1 ENSG00000107821 Kazal-type serine peptidase inhibitor domain 1 KCNIP3 ENSG00000115041 Kv channel interacting protein 3, calsenilin KCNK7 ENSG00000173338 Potassium channel, two pore domain subfamily K, member 7 KCNN4 ENSG00000104783 Potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 4 KCNU1 ENSG00000215262 Potassium channel, subfamily U, member 1 KCP ENSG00000135253 Kielin/chordin-like protein KDELC1 ENSG00000134901 KDEL (Lys-Asp-Glu-Leu) containing 1 KDELC2 ENSG00000178202 KDEL (Lys-Asp-Glu-Leu) containing 2 KDM1A ENSG00000004487 Lysine (K)-specific demethylase 1A KDM3B ENSG00000120733 Lysine (K)-specific demethylase 3B KDM6A ENSG00000147050 Lysine (K)-specific demethylase 6A KDM7A ENSG00000006459 Lysine (K)-specific demethylase 7A KDSR ENSG00000119537 3-ketodihydrosphingosine reductase KERA ENSG00000139330 Keratocan KIAA0100 ENSG00000007202 KIAA0100 KIAA0319 ENSG00000137261 KIAA0319 KIAA1324 ENSG00000116299 KIAA1324 KIFC2 ENSG00000167702 Kinesin family member C2 KIR2DL4 ENSG00000189013 Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 KIR3DX1 ENSG00000104970 Killer cell immunoglobulin-like receptor, three domains, X1 KIRREL2 ENSG00000126259 Kin of IRRE like 2 (Drosophila) KISS1 ENSG00000170498 KiSS-1 metastasis-suppressor KLHL11 ENSG00000178502 Kelch-like family member 11 KLHL22 ENSG00000099910 Kelch-like family member 22 KLK1 ENSG00000167748 Kallikrein 1 KLK10 ENSG00000129451 Kallikrein-related peptidase 10 KLK11 ENSG00000167757 Kallikrein-related peptidase 11 KLK12 ENSG00000186474 Kallikrein-related peptidase 12 KLK13 ENSG00000167759 Kallikrein-related peptidase 13 KLK14 ENSG00000129437 Kallikrein-related peptidase 14 KLK15 ENSG00000174562 Kallikrein-related peptidase 15 KLK2 ENSG00000167751 Kallikrein-related peptidase 2 KLK3 ENSG00000142515 Kallikrein-related peptidase 3 KLK4 ENSG00000167749 Kallikrein-related peptidase 4 KLK5 ENSG00000167754 Kallikrein-related peptidase 5 KLK6 ENSG00000167755 Kallikrein-related peptidase 6 KLK7 ENSG00000169035 Kallikrein-related peptidase 7 KLK8 ENSG00000129455 Kallikrein-related peptidase 8 KLK9 ENSG00000213022 Kallikrein-related peptidase 9 KLKB1 ENSG00000164344 Kallikrein B, plasma (Fletcher factor) 1 KNDC1 ENSG00000171798 Kinase non-catalytic C-lobe domain (KIND) containing 1 KNG1 ENSG00000113889 Kininogen 1 KRBA2 ENSG00000184619 KRAB-A domain containing 2 KREMEN2 ENSG00000131650 Kringle containing transmembrane protein 2 KRTDAP ENSG00000188508 Keratinocyte differentiation-associated protein L1CAM ENSG00000198910 L1 cell adhesion molecule L3MBTL2 ENSG00000100395 L(3)mbt-like 2 (Drosophila) LA16c-380H5.3 ENSG00000270168 LACE1 ENSG00000135537 Lactation elevated 1 LACRT ENSG00000135413 Lacritin LACTB ENSG00000103642 Lactamase, beta LAG3 ENSG00000089692 Lymphocyte-activation gene 3 LAIR2 ENSG00000167618 Leukocyte-associated immunoglobulin-like receptor 2 LALBA ENSG00000167531 Lactalbumin, alpha- LAMA1 ENSG00000101680 Laminin, alpha 1 LAMA2 ENSG00000196569 Laminin, alpha 2 LAMA3 ENSG00000053747 Laminin, alpha 3 LAMA4 ENSG00000112769 Laminin, alpha 4 LAMA5 ENSG00000130702 Laminin, alpha 5 LAMB1 ENSG00000091136 Laminin, beta 1 LAMB2 ENSG00000172037 Laminin, beta 2 (laminin S) LAMB3 ENSG00000196878 Laminin, beta 3 LAMB4 ENSG00000091128 Laminin, beta 4 LAMC1 ENSG00000135862 Laminin, gamma 1 (formerly LAMB2) LAMC2 ENSG00000058085 Laminin, gamma 2 LAMC3 ENSG00000050555 Laminin, gamma 3 LAMP3 ENSG00000078081 Lysosomal-associated membrane protein 3 LAT ENSG00000213658 Linker for activation of T cells LAT2 ENSG00000086730 Linker for activation of T cells family, member 2 LBP ENSG00000129988 Lipopolysaccharide binding protein LCAT ENSG00000213398 Lecithin-cholesterol acyltransferase LCN1 ENSG00000160349 Lipocalin 1 LCN10 ENSG00000187922 Lipocalin 10 LCN12 ENSG00000184925 Lipocalin 12 LCN15 ENSG00000177984 Lipocalin 15 LCN2 ENSG00000148346 Lipocalin 2 LCN6 ENSG00000267206 Lipocalin 6 LCN8 ENSG00000204001 Lipocalin 8 LCN9 ENSG00000148386 Lipocalin 9 LCORL ENSG00000178177 Ligand dependent nuclear receptor corepressor-like LDLR ENSG00000130164 Low density lipoprotein receptor LDLRAD2 ENSG00000187942 Low density lipoprotein receptor class A domain containing 2 LEAP2 ENSG00000164406 Liver expressed antimicrobial peptide 2 LECT2 ENSG00000145826 Leukocyte cell-derived chemotaxin 2 LEFTY1 ENSG00000243709 Left-right determination factor 1 LEFTY2 ENSG00000143768 Left-right determination factor 2 LEP ENSG00000174697 Leptin LFNG ENSG00000106003 LFNG O-fucosylpeptide 3-beta-N- acetylglucosaminyltransferase LGALS3BP ENSG00000108679 Lectin, galactoside-binding, soluble, 3 binding protein LGI1 ENSG00000108231 Leucine-rich, glioma inactivated 1 LGI2 ENSG00000153012 Leucine-rich repeat LGI family, member 2 LGI3 ENSG00000168481 Leucine-rich repeat LGI family, member 3 LGI4 ENSG00000153902 Leucine-rich repeat LGI family, member 4 LGMN ENSG00000100600 Legumain LGR4 ENSG00000205213 Leucine-rich repeat containing G protein-coupled receptor 4 LHB ENSG00000104826 Luteinizing hormone beta polypeptide LHCGR ENSG00000138039 Luteinizing hormone/choriogonadotropin receptor LIF ENSG00000128342 Leukemia inhibitory factor LIFR ENSG00000113594 Leukemia inhibitory factor receptor alpha LILRA1 ENSG00000104974 Leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1 LILRA2 ENSG00000239998 Leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 LILRB3 ENSG00000204577 Leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 LIME1 ENSG00000203896 Lck interacting transmembrane adaptor 1 LINGO1 ENSG00000169783 Leucine rich repeat and Ig domain containing 1 LIPA ENSG00000107798 Lipase A, lysosomal acid, cholesterol esterase LIPC ENSG00000166035 Lipase, hepatic LIPF ENSG00000182333 Lipase, gastric LIPG ENSG00000101670 Lipase, endothelial LIPH ENSG00000163898 Lipase, member H LIPK ENSG00000204021 Lipase, family member K LIPM ENSG00000173239 Lipase, family member M LIPN ENSG00000204020 Lipase, family member N LMAN2 ENSG00000169223 Lectin, mannose-binding 2 LMNTD1 ENSG00000152936 Lamin tail domain containing 1 LNX1 ENSG00000072201 Ligand of numb-protein X 1, E3 ubiquitin protein ligase LOX ENSG00000113083 Lysyl oxidase LOXL1 ENSG00000129038 Lysyl oxidase-like 1 LOXL2 ENSG00000134013 Lysyl oxidase-like 2 LOXL3 ENSG00000115318 Lysyl oxidase-like 3 LOXL4 ENSG00000138131 Lysyl oxidase-like 4 LPA ENSG00000198670 Lipoprotein, Lp(a) LPL ENSG00000175445 Lipoprotein lipase LPO ENSG00000167419 Lactoperoxidase LRAT ENSG00000121207 Lecithin retinol acyltransferase (phosphatidylcholine--retinol O- acyltransferase) LRCH3 ENSG00000186001 Leucine-rich repeats and calponin homology (CH) domain containing 3 LRCOL1 ENSG00000204583 Leucine rich colipase-like 1 LRFN4 ENSG00000173621 Leucine rich repeat and fibronectin type III domain containing 4 LRFN5 ENSG00000165379 Leucine rich repeat and fibronectin type III domain containing 5 LRG1 ENSG00000171236 Leucine-rich alpha-2-glycoprotein 1 LRP1 ENSG00000123384 Low density lipoprotein receptor-related protein 1 LRP11 ENSG00000120256 Low density lipoprotein receptor-related protein 11 LRP1B ENSG00000168702 Low density lipoprotein receptor-related protein 1B LRP2 ENSG00000081479 Low density lipoprotein receptor-related protein 2 LRP4 ENSG00000134569 Low density lipoprotein receptor-related protein 4 LRPAP1 ENSG00000163956 Low density lipoprotein receptor-related protein associated protein 1 LRRC17 ENSG00000128606 Leucine rich repeat containing 17 LRRC32 ENSG00000137507 Leucine rich repeat containing 32 LRRC3B ENSG00000179796 Leucine rich repeat containing 3B LRRC4B ENSG00000131409 Leucine rich repeat containing 4B LRRC70 ENSG00000186105 Leucine rich repeat containing 70 LRRN3 ENSG00000173114 Leucine rich repeat neuronal 3 LRRTM1 ENSG00000162951 Leucine rich repeat transmembrane neuronal 1 LRRTM2 ENSG00000146006 Leucine rich repeat transmembrane neuronal 2 LRRTM4 ENSG00000176204 Leucine rich repeat transmembrane neuronal 4 LRTM2 ENSG00000166159 Leucine-rich repeats and transmembrane domains 2 LSR ENSG00000105699 Lipolysis stimulated lipoprotein receptor LST1 ENSG00000204482 Leukocyte specific transcript 1 LTA ENSG00000226979 Lymphotoxin alpha LTBP1 ENSG00000049323 Latent transforming growth factor beta binding protein 1 LTBP2 ENSG00000119681 Latent transforming growth factor beta binding protein 2 LTBP3 ENSG00000168056 Latent transforming growth factor beta binding protein 3 LTBP4 ENSG00000090006 Latent transforming growth factor beta binding protein 4 LTBR ENSG00000111321 Lymphotoxin beta receptor (TNFR superfamily, member 3) LTF ENSG00000012223 Lactotransferrin LTK ENSG00000062524 Leukocyte receptor tyrosine kinase LUM ENSG00000139329 Lumican LUZP2 ENSG00000187398 Leucine zipper protein 2 LVRN ENSG00000172901 Laeverin LY6E ENSG00000160932 Lymphocyte antigen 6 complex, locus E LY6G5B ENSG00000240053 Lymphocyte antigen 6 complex, locus G5B LY6G6D ENSG00000244355 Lymphocyte antigen 6 complex, locus G6D LY6G6E ENSG00000255552 Lymphocyte antigen 6 complex, locus G6E (pseudogene) LY6H ENSG00000176956 Lymphocyte antigen 6 complex, locus H LY6K ENSG00000160886 Lymphocyte antigen 6 complex, locus K LY86 ENSG00000112799 Lymphocyte antigen 86 LY96 ENSG00000154589 Lymphocyte antigen 96 LYG1 ENSG00000144214 Lysozyme G-like 1 LYG2 ENSG00000185674 Lysozyme G-like 2 LYNX1 ENSG00000180155 Ly6/neurotoxin 1 LYPD1 ENSG00000150551 LY6/PLAUR domain containing 1 LYPD2 ENSG00000197353 LY6/PLAUR domain containing 2 LYPD4 ENSG00000273111 LY6/PLAUR domain containing 4 LYPD6 ENSG00000187123 LY6/PLAUR domain containing 6 LYPD6B ENSG00000150556 LY6/PLAUR domain containing 6B LYPD8 ENSG00000259823 LY6/PLAUR domain containing 8 LYZ ENSG00000090382 Lysozyme LYZL4 ENSG00000157093 Lysozyme-like 4 LYZL6 ENSG00000275722 Lysozyme-like 6 M6PR ENSG00000003056 Mannose-6-phosphate receptor (cation dependent) MAD1L1 ENSG00000002822 MAD1 mitotic arrest deficient-like 1 (yeast) MAG ENSG00000105695 Myelin associated glycoprotein MAGT1 ENSG00000102158 Magnesium transporter 1 MALSU1 ENSG00000156928 Mitochondrial assembly of ribosomal large subunit 1 MAMDC2 ENSG00000165072 MAM domain containing 2 MAN2B1 ENSG00000104774 Mannosidase, alpha, class 2B, member 1 MAN2B2 ENSG00000013288 Mannosidase, alpha, class 2B, member 2 MANBA ENSG00000109323 Mannosidase, beta A, lysosomal MANEAL ENSG00000185090 Mannosidase, endo-alpha-like MANF ENSG00000145050 Mesencephalic astrocyte-derived neurotrophic factor MANSC1 ENSG00000111261 MANSC domain containing 1 MAP3K9 ENSG00000006432 Mitogen-activated protein kinase 9 MASP1 ENSG00000127241 Mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) MASP2 ENSG00000009724 Mannan-binding lectin serine peptidase 2 MATN1 ENSG00000162510 Matrilin 1, cartilage matrix protein MATN2 ENSG00000132561 Matrilin 2 MATN3 ENSG00000132031 Matrilin 3 MATN4 ENSG00000124159 Matrilin 4 MATR3 ENSG00000015479 Matrin 3 MATR3 ENSG00000280987 Matrin 3 MAU2 ENSG00000129933 MAU2 sister chromatid cohesion factor MAZ ENSG00000103495 MYC-associated zinc finger protein (purine-binding transcription factor) MBD6 ENSG00000166987 Methyl-CpG binding domain protein 6 MBL2 ENSG00000165471 Mannose-binding lectin (protein C) 2, soluble MBNL1 ENSG00000152601 Muscleblind-like splicing regulator 1 MCCC1 ENSG00000078070 Methylcrotonoyl-CoA carboxylase 1 (alpha) MCCD1 ENSG00000204511 Mitochondrial coiled-coil domain 1 MCEE ENSG00000124370 Methylmalonyl CoA epimerase MCF2L ENSG00000126217 MCF.2 cell line derived transforming sequence-like MCFD2 ENSG00000180398 Multiple coagulation factor deficiency 2 MDFIC ENSG00000135272 MyoD family inhibitor domain containing MDGA1 ENSG00000112139 MAM domain containing glycosylphosphatidylinositol anchor 1 MDK ENSG00000110492 Midkine (neurite growth-promoting factor 2) MED20 ENSG00000124641 Mediator complex subunit 20 MEGF10 ENSG00000145794 Multiple EGF-like-domains 10 MEGF6 ENSG00000162591 Multiple EGF-like-domains 6 MEI1 ENSG00000167077 Meiotic double-stranded break formation protein 1 MEI4 ENSG00000269964 Meiotic double-stranded break formation protein 4 MEIS1 ENSG00000143995 Meis homeobox 1 MEIS3 ENSG00000105419 Meis homeobox 3 MEPE ENSG00000152595 Matrix extracellular phosphoglycoprotein MESDC2 ENSG00000117899 Mesoderm development candidate 2 MEST ENSG00000106484 Mesoderm specific transcript MET ENSG00000105976 MET proto-oncogene, receptor tyrosine kinase METRN ENSG00000103260 Meteorin, glial cell differentiation regulator METRNL ENSG00000176845 Meteorin, glial cell differentiation regulator-like METTL17 ENSG00000165792 Methyltransferase like 17 METTL24 ENSG00000053328 Methyltransferase like 24 METTL7B ENSG00000170439 Methyltransferase like 7B METTL9 ENSG00000197006 Methyltransferase like 9 MEX3C ENSG00000176624 Mex-3 RNA binding family member C MFAP2 ENSG00000117122 Microfibrillar-associated protein 2 MFAP3 ENSG00000037749 Microfibrillar-associated protein 3 MFAP3L ENSG00000198948 Microfibrillar-associated protein 3-like MFAP4 ENSG00000166482 Microfibrillar-associated protein 4 MFAP5 ENSG00000197614 Microfibrillar associated protein 5 MFGE8 ENSG00000140545 Milk fat globule-EGF factor 8 protein MFI2 ENSG00000163975 Antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 MFNG ENSG00000100060 MFNG O-fucosylpeptide 3-beta-N- acetylglucosaminyltransferase MGA ENSG00000174197 MGA, MAX dimerization protein MGAT2 ENSG00000168282 Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N- acetylglucosaminyltransferase MGAT3 ENSG00000128268 Mannosyl (beta-1,4-)-glycoprotein beta-1,4-N- acetylglucosaminyltransferase MGAT4A ENSG00000071073 Mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N- acetylglucosaminyltransferase, isozyme A MGAT4B ENSG00000161013 Mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N- acetylglucosaminyltransferase, isozyme B MGAT4D ENSG00000205301 MGAT4 family, member D MGLL ENSG00000074416 Monoglyceride lipase MGP ENSG00000111341 Matrix Gla protein MGST2 ENSG00000085871 Microsomal glutathione S-transferase 2 MIA ENSG00000261857 Melanoma inhibitory activity MIA2 ENSG00000150526 Melanoma inhibitory activity 2 MIA3 ENSG00000154305 Melanoma inhibitory activity family, member 3 MICU1 ENSG00000107745 Mitochondrial calcium uptake 1 MIER1 ENSG00000198160 Mesoderm induction early response 1, transcriptional regulator MINOS1-NBL1 ENSG00000270136 MINOS1-NBL1 readthrough MINPP1 ENSG00000107789 Multiple inositol-polyphosphate phosphatase 1 MLEC ENSG00000110917 Malectin MLN ENSG00000096395 Motilin MLXIP ENSG00000175727 MLX interacting protein MLXIPL ENSG00000009950 MLX interacting protein-like MMP1 ENSG00000196611 Matrix metallopeptidase 1 MMP10 ENSG00000166670 Matrix metallopeptidase 10 MMP11 ENSG00000099953 Matrix metallopeptidase 11 MMP12 ENSG00000262406 Matrix metallopeptidase 12 MMP13 ENSG00000137745 Matrix metallopeptidase 13 MMP14 ENSG00000157227 Matrix metallopeptidase 14 (membrane-inserted) MMP17 ENSG00000198598 Matrix metallopeptidase 17 (membrane-inserted) MMP19 ENSG00000123342 Matrix metallopeptidase 19 MMP2 ENSG00000087245 Matrix metallopeptidase 2 MMP20 ENSG00000137674 Matrix metallopeptidase 20 MMP21 ENSG00000154485 Matrix metallopeptidase 21 MMP25 ENSG00000008516 Matrix metallopeptidase 25 MMP26 ENSG00000167346 Matrix metallopeptidase 26 MMP27 ENSG00000137675 Matrix metallopeptidase 27 MMP28 ENSG00000271447 Matrix metallopeptidase 28 MMP3 ENSG00000149968 Matrix metallopeptidase 3 MMP7 ENSG00000137673 Matrix metallopeptidase 7 MMP8 ENSG00000118113 Matrix metallopeptidase 8 MMP9 ENSG00000100985 Matrix metallopeptidase 9 MMRN1 ENSG00000138722 Multimerin 1 MMRN2 ENSG00000173269 Multimerin 2 MOXD1 ENSG00000079931 Monooxygenase, DBH-like 1 MPO ENSG00000005381 Myeloperoxidase MPPED1 ENSG00000186732 Metallophosphoesterase domain containing 1 MPZL1 ENSG00000197965 Myelin protein zero-like 1 MR1 ENSG00000153029 Major histocompatibility complex, class I-related MRPL2 ENSG00000112651 Mitochondrial ribosomal protein L2 MRPL21 ENSG00000197345 Mitochondrial ribosomal protein L21 MRPL22 ENSG00000082515 Mitochondrial ribosomal protein L22 MRPL24 ENSG00000143314 Mitochondrial ribosomal protein L24 MRPL27 ENSG00000108826 Mitochondrial ribosomal protein L27 MRPL32 ENSG00000106591 Mitochondrial ribosomal protein L32 MRPL34 ENSG00000130312 Mitochondrial ribosomal protein L34 MRPL35 ENSG00000132313 Mitochondrial ribosomal protein L35 MRPL52 ENSG00000172590 Mitochondrial ribosomal protein L52 MRPL55 ENSG00000162910 Mitochondrial ribosomal protein L55 MRPS14 ENSG00000120333 Mitochondrial ribosomal protein S14 MRPS22 ENSG00000175110 Mitochondrial ribosomal protein S22 MRPS28 ENSG00000147586 Mitochondrial ribosomal protein S28 MS4A14 ENSG00000166928 Membrane-spanning 4-domains, subfamily A, member 14 MS4A3 ENSG00000149516 Membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) MSH3 ENSG00000113318 MutS homolog 3 MSH5 ENSG00000204410 MutS homolog 5 MSLN ENSG00000102854 Mesothelin MSMB ENSG00000263639 Microseminoprotein, beta- MSRA ENSG00000175806 Methionine sulfoxide reductase A MSRB2 ENSG00000148450 Methionine sulfoxide reductase B2 MSRB3 ENSG00000174099 Methionine sulfoxide reductase B3 MST1 ENSG00000173531 Macrophage stimulating 1 MSTN ENSG00000138379 Myostatin MT1G ENSG00000125144 Metallothionein 1G MTHFD2 ENSG00000065911 Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase MTMR14 ENSG00000163719 Myotubularin related protein 14 MTRNR2L11 ENSG00000270188 MT-RNR2-like 11 (pseudogene) MTRR ENSG00000124275 5-methyltetrahydrofolate-homocysteine methyltransferase reductase MTTP ENSG00000138823 Microsomal triglyceride transfer protein MTX2 ENSG00000128654 Metaxin 2 MUC1 ENSG00000185499 Mucin 1, cell surface associated MUC13 ENSG00000173702 Mucin 13, cell surface associated MUC20 ENSG00000176945 Mucin 20, cell surface associated MUC3A ENSG00000169894 Mucin 3A, cell surface associated MUC5AC ENSG00000215182 Mucin 5AC, oligomeric mucus/gel-forming MUC5B ENSG00000117983 Mucin 5B, oligomeric mucus/gel-forming MUC6 ENSG00000184956 Mucin 6, oligomeric mucus/gel-forming MUC7 ENSG00000171195 Mucin 7, secreted MUCL1 ENSG00000172551 Mucin-like 1 MXRA5 ENSG00000101825 Matrix-remodelling associated 5 MXRA7 ENSG00000182534 Matrix-remodelling associated 7 MYDGF ENSG00000074842 Myeloid-derived growth factor MYL1 ENSG00000168530 Myosin, light chain 1, alkali; skeletal, fast MYOC ENSG00000034971 Myocilin, trabecular meshwork inducible glucocorticoid response MYRFL ENSG00000166268 Myelin regulatory factor-like MZB1 ENSG00000170476 Marginal zone B and B1 cell-specific protein N4BP2L2 ENSG00000244754 NEDD4 binding protein 2-like 2 NAA38 ENSG00000183011 N(alpha)-acetyltransferase 38, NatC auxiliary subunit NAAA ENSG00000138744 N-acylethanolamine acid amidase NAGA ENSG00000198951 N-acetylgalactosaminidase, alpha- NAGLU ENSG00000108784 N-acetylglucosaminidase, alpha NAGS ENSG00000161653 N-acetylglutamate synthase NAPSA ENSG00000131400 Napsin A aspartic peptidase NBL1 ENSG00000158747 Neuroblastoma 1, DAN family BMP antagonist NCAM1 ENSG00000149294 Neural cell adhesion molecule 1 NCAN ENSG00000130287 Neurocan NCBP2-AS2 ENSG00000270170 NCBP2 antisense RNA 2 (head to head) NCSTN ENSG00000162736 Nicastrin NDNF ENSG00000173376 Neuron-derived neurotrophic factor NDP ENSG00000124479 Norrie disease (pseudoglioma) NDUFA10 ENSG00000130414 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42 kDa NDUFB5 ENSG00000136521 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16 kDa NDUFS8 ENSG00000110717 NADH dehydrogenase (ubiquinone) FeS protein 8, 23 kDa (NADH-coenzyme Q reductase) NDUFV1 ENSG00000167792 NADH dehydrogenase (ubiquinone) flavoprotein 1, 51 kDa NECAB3 ENSG00000125967 N-terminal EF-hand calcium binding protein 3 NELL1 ENSG00000165973 Neural EGFL like 1 NELL2 ENSG00000184613 Neural EGFL like 2 NENF ENSG00000117691 Neudesin neurotrophic factor NETO1 ENSG00000166342 Neuropilin (NRP) and tolloid (TLL)-like 1 NFASC ENSG00000163531 Neurofascin NFE2L1 ENSG00000082641 Nuclear factor, erythroid 2-like 1 NFE2L3 ENSG00000050344 Nuclear factor, erythroid 2-like 3 NGEF ENSG00000066248 Neuronal guanine nucleotide exchange factor NGF ENSG00000134259 Nerve growth factor (beta polypeptide) NGLY1 ENSG00000151092 N-glycanase 1 NGRN ENSG00000182768 Neugrin, neurite outgrowth associated NHLRC3 ENSG00000188811 NHL repeat containing 3 NID1 ENSG00000116962 Nidogen 1 NID2 ENSG00000087303 Nidogen 2 (osteonidogen) NKG7 ENSG00000105374 Natural killer cell granule protein 7 NLGN3 ENSG00000196338 Neuroligin 3 NLGN4Y ENSG00000165246 Neuroligin 4, Y-linked NLRP5 ENSG00000171487 NLR family, pyrin domain containing 5 NMB ENSG00000197696 Neuromedin B NME1 ENSG00000239672 NME/NM23 nucleoside diphosphate kinase 1 NME1-NME2 ENSG00000011052 NME1-NME2 readthrough NME3 ENSG00000103024 NME/NM23 nucleoside diphosphate kinase 3 NMS ENSG00000204640 Neuromedin S NMU ENSG00000109255 Neuromedin U NOA1 ENSG00000084092 Nitric oxide associated 1 NODAL ENSG00000156574 Nodal growth differentiation factor NOG ENSG00000183691 Noggin NOMO3 ENSG00000103226 NODAL modulator 3 NOS1AP ENSG00000198929 Nitric oxide synthase 1 (neuronal) adaptor protein NOTCH3 ENSG00000074181 Notch 3 NOTUM ENSG00000185269 Notum pectinacetylesterase homolog (Drosophila) NOV ENSG00000136999 Nephroblastoma overexpressed NPB ENSG00000183979 Neuropeptide B NPC2 ENSG00000119655 Niemann-Pick disease, type C2 NPFF ENSG00000139574 Neuropeptide FF-amide peptide precursor NPFFR2 ENSG00000056291 Neuropeptide FF receptor 2 NPHS1 ENSG00000161270 Nephrosis 1, congenital, Finnish type (nephrin) NPNT ENSG00000168743 Nephronectin NPPA ENSG00000175206 Natriuretic peptide A NPPB ENSG00000120937 Natriuretic peptide B NPPC ENSG00000163273 Natriuretic peptide C NPS ENSG00000214285 Neuropeptide S NPTX1 ENSG00000171246 Neuronal pentraxin I NPTX2 ENSG00000106236 Neuronal pentraxin II NPTXR ENSG00000221890 Neuronal pentraxin receptor NPVF ENSG00000105954 Neuropeptide VF precursor NPW ENSG00000183971 Neuropeptide W NPY ENSG00000122585 Neuropeptide Y NQO2 ENSG00000124588 NAD(P)H dehydrogenase, quinone 2 NRCAM ENSG00000091129 Neuronal cell adhesion molecule NRG1 ENSG00000157168 Neuregulin 1 NRN1L ENSG00000188038 Neuritin 1-like NRP1 ENSG00000099250 Neuropilin 1 NRP2 ENSG00000118257 Neuropilin 2 NRTN ENSG00000171119 Neurturin NRXN1 ENSG00000179915 Neurexin 1 NRXN2 ENSG00000110076 Neurexin 2 NT5C3A ENSG00000122643 5-nucleotidase, cytosolic IIIA NT5DC3 ENSG00000111696 5-nucleotidase domain containing 3 NT5E ENSG00000135318 5-nucleotidase, ecto (CD73) NTF3 ENSG00000185652 Neurotrophin 3 NTF4 ENSG00000225950 Neurotrophin 4 NTM ENSG00000182667 Neurotrimin NTN1 ENSG00000065320 Netrin 1 NTN3 ENSG00000162068 Netrin 3 NTN4 ENSG00000074527 Netrin 4 NTN5 ENSG00000142233 Netrin 5 NTNG1 ENSG00000162631 Netrin G1 NTNG2 ENSG00000196358 Netrin G2 NTS ENSG00000133636 Neurotensin NUBPL ENSG00000151413 Nucleotide binding protein-like NUCB1 ENSG00000104805 Nucleobindin 1 NUCB2 ENSG00000070081 Nucleobindin 2 NUDT19 ENSG00000213965 Nudix (nucleoside diphosphate linked moiety X)-type motif 19 NUDT9 ENSG00000170502 Nudix (nucleoside diphosphate linked moiety X)-type motif 9 NUP155 ENSG00000113569 Nucleoporin 155 kDa NUP214 ENSG00000126883 Nucleoporin 214 kDa NUP85 ENSG00000125450 Nucleoporin 85 kDa NXPE3 ENSG00000144815 Neurexophilin and PC-esterase domain family, member 3 NXPE4 ENSG00000137634 Neurexophilin and PC-esterase domain family, member 4 NXPH1 ENSG00000122584 Neurexophilin 1 NXPH2 ENSG00000144227 Neurexophilin 2 NXPH3 ENSG00000182575 Neurexophilin 3 NXPH4 ENSG00000182379 Neurexophilin 4 NYX ENSG00000188937 Nyctalopin OAF ENSG00000184232 Out at first homolog OBP2A ENSG00000122136 Odorant binding protein 2A OBP2B ENSG00000171102 Odorant binding protein 2B OC90 ENSG00000253117 Otoconin 90 OCLN ENSG00000197822 Occludin ODAM ENSG00000109205 Odontogenic, ameloblast asssociated OGG1 ENSG00000114026 8-oxoguanine DNA glycosylase OGN ENSG00000106809 Osteoglycin OIT3 ENSG00000138315 Oncoprotein induced transcript 3 OLFM1 ENSG00000130558 Olfactomedin 1 OLFM2 ENSG00000105088 Olfactomedin 2 OLFM3 ENSG00000118733 Olfactomedin 3 OLFM4 ENSG00000102837 Olfactomedin 4 OLFML1 ENSG00000183801 Olfactomedin-like 1 OLFML2A ENSG00000185585 Olfactomedin-like 2A OLFML2B ENSG00000162745 Olfactomedin-like 2B OLFML3 ENSG00000116774 Olfactomedin-like 3 OMD ENSG00000127083 Osteomodulin OMG ENSG00000126861 Oligodendrocyte myelin glycoprotein OOSP2 ENSG00000149507 Oocyte secreted protein 2 OPCML ENSG00000183715 Opioid binding protein/cell adhesion molecule-like OPTC ENSG00000188770 Opticin ORAI1 ENSG00000276045 ORAI calcium release-activated calcium modulator 1 ORM1 ENSG00000229314 Orosomucoid 1 ORM2 ENSG00000228278 Orosomucoid 2 ORMDL2 ENSG00000123353 ORMDL sphingolipid biosynthesis regulator 2 OS9 ENSG00000135506 Osteosarcoma amplified 9, endoplasmic reticulum lectin OSCAR ENSG00000170909 Osteoclast associated, immunoglobulin-like receptor OSM ENSG00000099985 Oncostatin M OSMR ENSG00000145623 Oncostatin M receptor OSTN ENSG00000188729 Osteocrin OTOA ENSG00000155719 Otoancorin OTOG ENSG00000188162 Otogelin OTOGL ENSG00000165899 Otogelin-like OTOL1 ENSG00000182447 Otolin 1 OTOR ENSG00000125879 Otoraplin OTOS ENSG00000178602 Otospiralin OVCH1 ENSG00000187950 Ovochymase 1 OVCH2 ENSG00000183378 Ovochymase 2 (gene/pseudogene) OVGP1 ENSG00000085465 Oviductal glycoprotein 1, 120 kDa OXCT1 ENSG00000083720 3-oxoacid CoA transferase 1 OXCT2 ENSG00000198754 3-oxoacid CoA transferase 2 OXNAD1 ENSG00000154814 Oxidoreductase NAD-binding domain containing 1 OXT ENSG00000101405 Oxytocin/neurophysin I prepropeptide P3H1 ENSG00000117385 Prolyl 3-hydroxylase 1 P3H2 ENSG00000090530 Prolyl 3-hydroxylase 2 P3H3 ENSG00000110811 Prolyl 3-hydroxylase 3 P3H4 ENSG00000141696 Prolyl 3-hydroxylase family member 4 (non-enzymatic) P4HA1 ENSG00000122884 Prolyl 4-hydroxylase, alpha polypeptide I P4HA2 ENSG00000072682 Prolyl 4-hydroxylase, alpha polypeptide II P4HA3 ENSG00000149380 Prolyl 4-hydroxylase, alpha polypeptide III P4HB ENSG00000185624 Prolyl 4-hydroxylase, beta polypeptide PAEP ENSG00000122133 Progestagen-associated endometrial protein PAM ENSG00000145730 Peptidylglycine alpha-amidating monooxygenase PAMR1 ENSG00000149090 Peptidase domain containing associated with muscle regeneration 1 PAPL ENSG00000183760 Iron/zinc purple acid phosphatase-like protein PAPLN ENSG00000100767 Papilin, proteoglycan-like sulfated glycoprotein PAPPA ENSG00000182752 Pregnancy-associated plasma protein A, pappalysin 1 PAPPA2 ENSG00000116183 Pappalysin 2 PARP15 ENSG00000173200 Poly (ADP-ribose) polymerase family, member 15 PARVB ENSG00000188677 Parvin, beta PATE1 ENSG00000171053 Prostate and testis expressed 1 PATE2 ENSG00000196844 Prostate and testis expressed 2 PATE3 ENSG00000236027 Prostate and testis expressed 3 PATE4 ENSG00000237353 Prostate and testis expressed 4 PATL2 ENSG00000229474 Protein associated with topoisomerase II homolog 2 (yeast) PAX2 ENSG00000075891 Paired box 2 PAX4 ENSG00000106331 Paired box 4 PCCB ENSG00000114054 Propionyl CoA carboxylase, beta polypeptide PCDH1 ENSG00000156453 Protocadherin 1 PCDH12 ENSG00000113555 Protocadherin 12 PCDH15 ENSG00000150275 Protocadherin-related 15 PCDHA1 ENSG00000204970 Protocadherin alpha 1 PCDHA10 ENSG00000250120 Protocadherin alpha 10 PCDHA11 ENSG00000249158 Protocadherin alpha 11 PCDHA6 ENSG00000081842 Protocadherin alpha 6 PCDHB12 ENSG00000120328 Protocadherin beta 12 PCDHGA11 ENSG00000253873 Protocadherin gamma subfamily A, 11 PCF11 ENSG00000165494 PCF11 cleavage and polyadenylation factor subunit PCOLCE ENSG00000106333 Procollagen C-endopeptidase enhancer PCOLCE2 ENSG00000163710 Procollagen C-endopeptidase enhancer 2 PCSK1 ENSG00000175426 Proprotein convertase subtilisin/kexin type 1 PCSK1N ENSG00000102109 Proprotein convertase subtilisin/kexin type 1 inhibitor PCSK2 ENSG00000125851 Proprotein convertase subtilisin/kexin type 2 PCSK4 ENSG00000115257 Proprotein convertase subtilisin/kexin type 4 PCSK5 ENSG00000099139 Proprotein convertase subtilisin/kexin type 5 PCSK9 ENSG00000169174 Proprotein convertase subtilisin/kexin type 9 PCYOX1 ENSG00000116005 Prenylcysteine oxidase 1 PCYOX1L ENSG00000145882 Prenylcysteine oxidase 1 like PDDC1 ENSG00000177225 Parkinson disease 7 domain containing 1 PDE11A ENSG00000128655 Phosphodiesterase 11A PDE2A ENSG00000186642 Phosphodiesterase 2A, cGMP-stimulated PDE7A ENSG00000205268 Phosphodiesterase 7A PDF ENSG00000258429 Peptide deformylase (mitochondrial) PDGFA ENSG00000197461 Platelet-derived growth factor alpha polypeptide PDGFB ENSG00000100311 Platelet-derived growth factor beta polypeptide PDGFC ENSG00000145431 Platelet derived growth factor C PDGFD ENSG00000170962 Platelet derived growth factor D PDGFRA ENSG00000134853 Platelet-derived growth factor receptor, alpha polypeptide PDGFRB ENSG00000113721 Platelet-derived growth factor receptor, beta polypeptide PDGFRL ENSG00000104213 Platelet-derived growth factor receptor-like PDHA1 ENSG00000131828 Pyruvate dehydrogenase (lipoamide) alpha 1 PDIA2 ENSG00000185615 Protein disulfide isomerase family A, member 2 PDIA3 ENSG00000167004 Protein disulfide isomerase family A, member 3 PDIA4 ENSG00000155660 Protein disulfide isomerase family A, member 4 PDIA5 ENSG00000065485 Protein disulfide isomerase family A, member 5 PDIA6 ENSG00000143870 Protein disulfide isomerase family A, member 6 PDILT ENSG00000169340 Protein disulfide isomerase-like, testis expressed PDYN ENSG00000101327 Prodynorphin PDZD8 ENSG00000165650 PDZ domain containing 8 PDZRN4 ENSG00000165966 PDZ domain containing ring finger 4 PEAR1 ENSG00000187800 Platelet endothelial aggregation receptor 1 PEBP4 ENSG00000134020 Phosphatidylethanolamine-binding protein 4 PECAM1 ENSG00000261371 Platelet/endothelial cell adhesion molecule 1 PENK ENSG00000181195 Proenkephalin PET117 ENSG00000232838 PET117 homolog PF4 ENSG00000163737 Platelet factor 4 PF4V1 ENSG00000109272 Platelet factor 4 variant 1 PFKP ENSG00000067057 Phosphofructokinase, platelet PFN1 ENSG00000108518 Profilin 1 PGA3 ENSG00000229859 Pepsinogen 3, group I (pepsinogen A) PGA4 ENSG00000229183 Pepsinogen 4, group I (pepsinogen A) PGA5 ENSG00000256713 Pepsinogen 5, group I (pepsinogen A) PGAM5 ENSG00000247077 PGAM family member 5, serine/threonine protein phosphatase, mitochondrial PGAP3 ENSG00000161395 Post-GPI attachment to proteins 3 PGC ENSG00000096088 Progastricsin (pepsinogen C) PGF ENSG00000119630 Placental growth factor PGLYRP1 ENSG00000008438 Peptidoglycan recognition protein 1 PGLYRP2 ENSG00000161031 Peptidoglycan recognition protein 2 PGLYRP3 ENSG00000159527 Peptidoglycan recognition protein 3 PGLYRP4 ENSG00000163218 Peptidoglycan recognition protein 4 PHACTR1 ENSG00000112137 Phosphatase and actin regulator 1 PHB ENSG00000167085 Prohibitin PI15 ENSG00000137558 Peptidase inhibitor 15 PI3 ENSG00000124102 Peptidase inhibitor 3, skin-derived PIANP ENSG00000139200 PILR alpha associated neural protein PIGK ENSG00000142892 Phosphatidylinositol glycan anchor biosynthesis, class K PIGL ENSG00000108474 Phosphatidylinositol glycan anchor biosynthesis, class L PIGT ENSG00000124155 Phosphatidylinositol glycan anchor biosynthesis, class T PIGZ ENSG00000119227 Phosphatidylinositol glycan anchor biosynthesis, class Z PIK3AP1 ENSG00000155629 Phosphoinositide-3-kinase adaptor protein 1 PIK3IP1 ENSG00000100100 Phosphoinositide-3-kinase interacting protein 1 PILRA ENSG00000085514 Paired immunoglobin-like type 2 receptor alpha PILRB ENSG00000121716 Paired immunoglobin-like type 2 receptor beta PINLYP ENSG00000234465 Phospholipase A2 inhibitor and LY6/PLAUR domain containing PIP ENSG00000159763 Prolactin-induced protein PIWIL4 ENSG00000134627 Piwi-like RNA-mediated gene silencing 4 PKDCC ENSG00000162878 Protein kinase domain containing, cytoplasmic PKHD1 ENSG00000170927 Polycystic kidney and hepatic disease 1 (autosomal recessive) PLA1A ENSG00000144837 Phospholipase A1 member A PLA2G10 ENSG00000069764 Phospholipase A2, group X PLA2G12A ENSG00000123739 Phospholipase A2, group XIIA PLA2G12B ENSG00000138308 Phospholipase A2, group XIIB PLA2G15 ENSG00000103066 Phospholipase A2, group XV PLA2G1B ENSG00000170890 Phospholipase A2, group IB (pancreas) PLA2G2A ENSG00000188257 Phospholipase A2, group IIA (platelets, synovial fluid) PLA2G2C ENSG00000187980 Phospholipase A2, group IIC PLA2G2D ENSG00000117215 Phospholipase A2, group IID PLA2G2E ENSG00000188784 Phospholipase A2, group IIE PLA2G3 ENSG00000100078 Phospholipase A2, group III PLA2G5 ENSG00000127472 Phospholipase A2, group V PLA2G7 ENSG00000146070 Phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) PLA2R1 ENSG00000153246 Phospholipase A2 receptor 1, 180 kDa PLAC1 ENSG00000170965 Placenta-specific 1 PLAC9 ENSG00000189129 Placenta-specific 9 PLAT ENSG00000104368 Plasminogen activator, tissue PLAU ENSG00000122861 Plasminogen activator, urokinase PLAUR ENSG00000011422 Plasminogen activator, urokinase receptor PLBD1 ENSG00000121316 Phospholipase B domain containing 1 PLBD2 ENSG00000151176 Phospholipase B domain containing 2 PLG ENSG00000122194 Plasminogen PLGLB1 ENSG00000183281 Plasminogen-like B1 PLGLB2 ENSG00000125551 Plasminogen-like B2 PLOD1 ENSG00000083444 Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 PLOD2 ENSG00000152952 Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2 PLOD3 ENSG00000106397 Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 PLTP ENSG00000100979 Phospholipid transfer protein PLXNA4 ENSG00000221866 Plexin A4 PLXNB2 ENSG00000196576 Plexin B2 PM20D1 ENSG00000162877 Peptidase M20 domain containing 1 PMCH ENSG00000183395 Pro-melanin-concentrating hormone PMEL ENSG00000185664 Premelanosome protein PMEPA1 ENSG00000124225 Prostate transmembrane protein, androgen induced 1 PNLIP ENSG00000175535 Pancreatic lipase PNLIPRP1 ENSG00000187021 Pancreatic lipase-related protein 1 PNLIPRP3 ENSG00000203837 Pancreatic lipase-related protein 3 PNOC ENSG00000168081 Prepronociceptin PNP ENSG00000198805 Purine nucleoside phosphorylase PNPLA4 ENSG00000006757 Patatin-like phospholipase domain containing 4 PODNL1 ENSG00000132000 Podocan-like 1 POFUT1 ENSG00000101346 Protein O-fucosyltransferase 1 POFUT2 ENSG00000186866 Protein O-fucosyltransferase 2 POGLUT1 ENSG00000163389 Protein O-glucosyltransferase 1 POLL ENSG00000166169 Polymerase (DNA directed), lambda POMC ENSG00000115138 Proopiomelanocortin POMGNT2 ENSG00000144647 Protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-) PON1 ENSG00000005421 Paraoxonase 1 PON2 ENSG00000105854 Paraoxonase 2 PON3 ENSG00000105852 Paraoxonase 3 POSTN ENSG00000133110 Periostin, osteoblast specific factor PPBP ENSG00000163736 Pro-platelet basic protein (chemokine (CXC motif) ligand 7) PPIB ENSG00000166794 Peptidylprolyl isomerase B (cyclophilin B) PPIC ENSG00000168938 Peptidylprolyl isomerase C (cyclophilin C) PPOX ENSG00000143224 Protoporphyrinogen oxidase PPP1CA ENSG00000172531 Protein phosphatase 1, catalytic subunit, alpha isozyme PPT1 ENSG00000131238 Palmitoyl-protein thioesterase 1 PPT2 ENSG00000221988 Palmitoyl-protein thioesterase 2 PPY ENSG00000108849 Pancreatic polypeptide PRAC2 ENSG00000229637 Prostate cancer susceptibility candidate 2 PRADC1 ENSG00000135617 Protease-associated domain containing 1 PRAP1 ENSG00000165828 Proline-rich acidic protein 1 PRB1 ENSG00000251655 Proline-rich protein BstNI subfamily 1 PRB2 ENSG00000121335 Proline-rich protein BstNI subfamily 2 PRB3 ENSG00000197870 Proline-rich protein BstNI subfamily 3 PRB4 ENSG00000230657 Proline-rich protein BstNI subfamily 4 PRCD ENSG00000214140 Progressive rod-cone degeneration PRCP ENSG00000137509 Prolylcarboxypeptidase (angiotensinase C) PRDM12 ENSG00000130711 PR domain containing 12 PRDX4 ENSG00000123131 Peroxiredoxin 4 PRELP ENSG00000188783 Proline/arginine-rich end leucine-rich repeat protein PRF1 ENSG00000180644 Perforin 1 (pore forming protein) PRG2 ENSG00000186652 Proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) PRG3 ENSG00000156575 Proteoglycan 3 PRG4 ENSG00000116690 Proteoglycan 4 PRH1 ENSG00000231887 Proline-rich protein HaeIII subfamily 1 PRH2 ENSG00000134551 Proline-rich protein HaeIII subfamily 2 PRKAG1 ENSG00000181929 Protein kinase, AMP-activated, gamma 1 non-catalytic subunit PRKCSH ENSG00000130175 Protein kinase C substrate 80K-H PRKD1 ENSG00000184304 Protein kinase D1 PRL ENSG00000172179 Prolactin PRLH ENSG00000071677 Prolactin releasing hormone PRLR ENSG00000113494 Prolactin receptor PRNP ENSG00000171867 Prion protein PRNT ENSG00000180259 Prion protein (testis specific) PROC ENSG00000115718 Protein C (inactivator of coagulation factors Va and VIIIa) PROK1 ENSG00000143125 Prokineticin 1 PROK2 ENSG00000163421 Prokineticin 2 PROL1 ENSG00000171199 Proline rich, lacrimal 1 PROM1 ENSG00000007062 Prominin 1 PROS1 ENSG00000184500 Protein S (alpha) PROZ ENSG00000126231 Protein Z, vitamin K-dependent plasma glycoprotein PRR27 ENSG00000187533 Proline rich 27 PRR4 ENSG00000111215 Proline rich 4 (lacrimal) PRRG2 ENSG00000126460 Proline rich Gla (G-carboxyglutamic acid) 2 PRRT3 ENSG00000163704 Proline-rich transmembrane protein 3 PRRT4 ENSG00000224940 Proline-rich transmembrane protein 4 PRSS1 ENSG00000204983 Protease, serine, 1 (trypsin 1) PRSS12 ENSG00000164099 Protease, serine, 12 (neurotrypsin, motopsin) PRSS16 ENSG00000112812 Protease, serine, 16 (thymus) PRSS2 ENSG00000275896 Protease, serine, 2 (trypsin 2) PRSS21 ENSG00000007038 Protease, serine, 21 (testisin) PRSS22 ENSG00000005001 Protease, serine, 22 PRSS23 ENSG00000150687 Protease, serine, 23 PRSS27 ENSG00000172382 Protease, serine 27 PRSS3 ENSG00000010438 Protease, serine, 3 PRSS33 ENSG00000103355 Protease, serine, 33 PRSS35 ENSG00000146250 Protease, serine, 35 PRSS36 ENSG00000178226 Protease, serine, 36 PRSS37 ENSG00000165076 Protease, serine, 37 PRSS38 ENSG00000185888 Protease, serine, 38 PRSS42 ENSG00000178055 Protease, serine, 42 PRSS48 ENSG00000189099 Protease, serine, 48 PRSS50 ENSG00000206549 Protease, serine, 50 PRSS53 ENSG00000151006 Protease, serine, 53 PRSS54 ENSG00000103023 Protease, serine, 54 PRSS55 ENSG00000184647 Protease, serine, 55 PRSS56 ENSG00000237412 Protease, serine, 56 PRSS57 ENSG00000185198 Protease, serine, 57 PRSS58 ENSG00000258223 Protease, serine, 58 PRSS8 ENSG00000052344 Protease, serine, 8 PRTG ENSG00000166450 Protogenin PRTN3 ENSG00000196415 Proteinase 3 PSAP ENSG00000197746 Prosaposin PSAPL1 ENSG00000178597 Prosaposin-like 1 (gene/pseudogene) PSG1 ENSG00000231924 Pregnancy specific beta-1-glycoprotein 1 PSG11 ENSG00000243130 Pregnancy specific beta-1-glycoprotein 11 PSG2 ENSG00000242221 Pregnancy specific beta-1-glycoprotein 2 PSG3 ENSG00000221826 Pregnancy specific beta-1-glycoprotein 3 PSG4 ENSG00000243137 Pregnancy specific beta-1-glycoprotein 4 PSG5 ENSG00000204941 Pregnancy specific beta-1-glycoprotein 5 PSG6 ENSG00000170848 Pregnancy specific beta-1-glycoprotein 6 PSG7 ENSG00000221878 Pregnancy specific beta-1-glycoprotein 7 (gene/pseudogene) PSG8 ENSG00000124467 Pregnancy specific beta-1-glycoprotein 8 PSG9 ENSG00000183668 Pregnancy specific beta-1-glycoprotein 9 PSMD1 ENSG00000173692 Proteasome 26S subunit, non-ATPase 1 PSORS1C2 ENSG00000204538 Psoriasis susceptibility 1 candidate 2 PSPN ENSG00000125650 Persephin PTGDS ENSG00000107317 Prostaglandin D2 synthase 21 kDa (brain) PTGIR ENSG00000160013 Prostaglandin 12 (prostacyclin) receptor (IP) PTGS1 ENSG00000095303 Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) PTGS2 ENSG00000073756 Prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) PTH ENSG00000152266 Parathyroid hormone PTH2 ENSG00000142538 Parathyroid hormone 2 PTHLH ENSG00000087494 Parathyroid hormone-like hormone PTK7 ENSG00000112655 Protein tyrosine kinase 7 (inactive) PTN ENSG00000105894 Pleiotrophin PTPRA ENSG00000132670 Protein tyrosine phosphatase, receptor type, A PTPRB ENSG00000127329 Protein tyrosine phosphatase, receptor type, B PTPRC ENSG00000081237 Protein tyrosine phosphatase, receptor type, C PTPRCAP ENSG00000213402 Protein tyrosine phosphatase, receptor type, C-associated protein PTPRD ENSG00000153707 Protein tyrosine phosphatase, receptor type, D PTPRF ENSG00000142949 Protein tyrosine phosphatase, receptor type, F PTPRJ ENSG00000149177 Protein tyrosine phosphatase, receptor type, J PTPRO ENSG00000151490 Protein tyrosine phosphatase, receptor type, O PTPRS ENSG00000105426 Protein tyrosine phosphatase, receptor type, S PTTG1IP ENSG00000183255 Pituitary tumor-transforming 1 interacting protein PTX3 ENSG00000163661 Pentraxin 3, long PTX4 ENSG00000251692 Pentraxin 4, long PVR ENSG00000073008 Poliovirus receptor PVRL1 ENSG00000110400 Poliovirus receptor-related 1 (herpesvirus entry mediator C) PXDN ENSG00000130508 Peroxidasin PXDNL ENSG00000147485 Peroxidasin-like PXYLP1 ENSG00000155893 2-phosphoxylose phosphatase 1 PYY ENSG00000131096 Peptide YY PZP ENSG00000126838 Pregnancy-zone protein QPCT ENSG00000115828 Glutaminyl-peptide cyclotransferase QPRT ENSG00000103485 Quinolinate phosphoribosyltransferase QRFP ENSG00000188710 Pyroglutamylated RFamide peptide QSOX1 ENSG00000116260 Quiescin Q6 sulfhydryl oxidase 1 R3HDML ENSG00000101074 R3H domain containing-like RAB26 ENSG00000167964 RAB26, member RAS oncogene family RAB36 ENSG00000100228 RAB36, member RAS oncogene family RAB9B ENSG00000123570 RAB9B, member RAS oncogene family RAET1E ENSG00000164520 Retinoic acid early transcript 1E RAET1G ENSG00000203722 Retinoic acid early transcript 1G RAMP2 ENSG00000131477 Receptor (G protein-coupled) activity modifying protein 2 RAPGEF5 ENSG00000136237 Rap guanine nucleotide exchange factor (GEF) 5 RARRES1 ENSG00000118849 Retinoic acid receptor responder (tazarotene induced) 1 RARRES2 ENSG00000106538 Retinoic acid receptor responder (tazarotene induced) 2 RASA2 ENSG00000155903 RAS p21 protein activator 2 RBM3 ENSG00000102317 RNA binding motif (RNP1, RRM) protein 3 RBP3 ENSG00000265203 Retinol binding protein 3, interstitial RBP4 ENSG00000138207 Retinol binding protein 4, plasma RCN1 ENSG00000049449 Reticulocalbin 1, EF-hand calcium binding domain RCN2 ENSG00000117906 Reticulocalbin 2, EF-hand calcium binding domain RCN3 ENSG00000142552 Reticulocalbin 3, EF-hand calcium binding domain RCOR1 ENSG00000089902 REST corepressor 1 RDH11 ENSG00000072042 Retinol dehydrogenase 11 (all-trans/9-cis/11-cis) RDH12 ENSG00000139988 Retinol dehydrogenase 12 (all-trans/9-cis/11-cis) RDH13 ENSG00000160439 Retinol dehydrogenase 13 (all-trans/9-cis) RDH5 ENSG00000135437 Retinol dehydrogenase 5 (11-cis/9-cis) RDH8 ENSG00000080511 Retinol dehydrogenase 8 (all-trans) REG1A ENSG00000115386 Regenerating islet-derived 1 alpha REG1B ENSG00000172023 Regenerating islet-derived 1 beta REG3A ENSG00000172016 Regenerating islet-derived 3 alpha REG3G ENSG00000143954 Regenerating islet-derived 3 gamma REG4 ENSG00000134193 Regenerating islet-derived family, member 4 RELN ENSG00000189056 Reelin RELT ENSG00000054967 RELT tumor necrosis factor receptor REN ENSG00000143839 Renin REPIN1 ENSG00000214022 Replication initiator 1 REPS2 ENSG00000169891 RALBP1 associated Eps domain containing 2 RET ENSG00000165731 Ret proto-oncogene RETN ENSG00000104918 Resistin RETNLB ENSG00000163515 Resistin like beta RETSAT ENSG00000042445 Retinol saturase (all-trans-retinol 13,14-reductase) RFNG ENSG00000169733 RFNG O-fucosylpeptide 3-beta-N- acetylglucosaminyltransferase RGCC ENSG00000102760 Regulator of cell cycle RGL4 ENSG00000159496 Ral guanine nucleotide dissociation stimulator-like 4 RGMA ENSG00000182175 Repulsive guidance molecule family member a RGMB ENSG00000174136 Repulsive guidance molecule family member b RHOQ ENSG00000119729 Ras homolog family member Q RIC3 ENSG00000166405 RIC3 acetylcholine receptor chaperone RIMS1 ENSG00000079841 Regulating synaptic membrane exocytosis 1 RIPPLY1 ENSG00000147223 Ripply transcriptional repressor 1 RLN1 ENSG00000107018 Relaxin 1 RLN2 ENSG00000107014 Relaxin 2 RLN3 ENSG00000171136 Relaxin 3 RMDN1 ENSG00000176623 Regulator of microtubule dynamics 1 RNASE1 ENSG00000129538 Ribonuclease, RNase A family, 1 (pancreatic) RNASE10 ENSG00000182545 Ribonuclease, RNase A family, 10 (non-active) RNASE11 ENSG00000173464 Ribonuclease, RNase A family, 11 (non-active) RNASE12 ENSG00000258436 Ribonuclease, RNase A family, 12 (non-active) RNASE13 ENSG00000206150 Ribonuclease, RNase A family, 13 (non-active) RNASE2 ENSG00000169385 Ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) RNASE3 ENSG00000169397 Ribonuclease, RNase A family, 3 RNASE4 ENSG00000258818 Ribonuclease, RNase A family, 4 RNASE6 ENSG00000169413 Ribonuclease, RNase A family, k6 RNASE7 ENSG00000165799 Ribonuclease, RNase A family, 7 RNASE8 ENSG00000173431 Ribonuclease, RNase A family, 8 RNASE9 ENSG00000188655 Ribonuclease, RNase A family, 9 (non-active) RNASEH1 ENSG00000171865 Ribonuclease H1 RNASET2 ENSG00000026297 Ribonuclease T2 RNF146 ENSG00000118518 Ring finger protein 146 RNF148 ENSG00000235631 Ring finger protein 148 RNF150 ENSG00000170153 Ring finger protein 150 RNF167 ENSG00000108523 Ring finger protein 167 RNF220 ENSG00000187147 Ring finger protein 220 RNF34 ENSG00000170633 Ring finger protein 34, E3 ubiquitin protein ligase RNLS ENSG00000184719 Renalase, FAD-dependent amine oxidase RNPEP ENSG00000176393 Arginyl aminopeptidase (aminopeptidase B) ROR1 ENSG00000185483 Receptor tyrosine kinase-like orphan receptor 1 RP11-1236K1.1 ENSG00000233050 RP11-14J7.7 ENSG00000259060 RP11-196G11.1 ENSG00000255439 RP11-350O14.18 ENSG00000261793 RP11-520P18.5 ENSG00000261667 RP11-812E19.9 ENSG00000259680 RP11-903H12.5 ENSG00000259171 RP11-977G19.10 ENSG00000144785 RP4-576H24.4 ENSG00000260861 RP4-608O15.3 ENSG00000276911 Complement factor H-related protein 2 RPL3 ENSG00000100316 Ribosomal protein L3 RPLP2 ENSG00000177600 Ribosomal protein, large, P2 RPN2 ENSG00000118705 Ribophorin II RPS27L ENSG00000185088 Ribosomal protein S27-like RQCD1 ENSG00000144580 RCD1 required for cell differentiation1 homolog (S. pombe) RS1 ENSG00000102104 Retinoschisin 1 RSF1 ENSG00000048649 Remodeling and spacing factor 1 RSPO1 ENSG00000169218 R-spondin 1 RSPO2 ENSG00000147655 R-spondin 2 RSPO3 ENSG00000146374 R-spondin 3 RSPO4 ENSG00000101282 R-spondin 4 RSPRY1 ENSG00000159579 Ring finger and SPRY domain containing 1 RTBDN ENSG00000132026 Retbindin RTN4RL1 ENSG00000185924 Reticulon 4 receptor-like 1 RTN4RL2 ENSG00000186907 Reticulon 4 receptor-like 2 SAA1 ENSG00000173432 Serum amyloid A1 SAA2 ENSG00000134339 Serum amyloid A2 SAA4 ENSG00000148965 Serum amyloid A4, constitutive SAP30 ENSG00000164105 Sin3A-associated protein, 30 kDa SAR1A ENSG00000079332 Secretion associated, Ras related GTPase 1A SARAF ENSG00000133872 Store-operated calcium entry-associated regulatory factor SARM1 ENSG00000004139 Sterile alpha and TIR motif containing 1 SATB1 ENSG00000182568 SATB homeobox 1 SAXO2 ENSG00000188659 Stabilizer of axonemal microtubules 2 SBSN ENSG00000189001 Suprabasin SBSPON ENSG00000164764 Somatomedin B and thrombospondin, type 1 domain containing SCARF1 ENSG00000074660 Scavenger receptor class F, member 1 SCG2 ENSG00000171951 Secretogranin II SCG3 ENSG00000104112 Secretogranin III SCG5 ENSG00000166922 Secretogranin V SCGB1A1 ENSG00000149021 Secretoglobin, family 1A, member 1 (uteroglobin) SCGB1C1 ENSG00000188076 Secretoglobin, family 1C, member 1 SCGB1C2 ENSG00000268320 Secretoglobin, family 1C, member 2 SCGB1D1 ENSG00000168515 Secretoglobin, family 1D, member 1 SCGB1D2 ENSG00000124935 Secretoglobin, family 1D, member 2 SCGB1D4 ENSG00000197745 Secretoglobin, family 1D, member 4 SCGB2A1 ENSG00000124939 Secretoglobin, family 2A, member 1 SCGB2A2 ENSG00000110484 Secretoglobin, family 2A, member 2 SCGB2B2 ENSG00000205209 Secretoglobin, family 2B, member 2 SCGB3A1 ENSG00000161055 Secretoglobin, family 3A, member 1 SCGB3A2 ENSG00000164265 Secretoglobin, family 3A, member 2 SCN1B ENSG00000105711 Sodium channel, voltage gated, type I beta subunit SCN3B ENSG00000166257 Sodium channel, voltage gated, type III beta subunit SCPEP1 ENSG00000121064 Serine carboxypeptidase 1 SCRG1 ENSG00000164106 Stimulator of chondrogenesis 1 SCT ENSG00000070031 Secretin SCUBE1 ENSG00000159307 Signal peptide, CUB domain, EGF-like 1 SCUBE2 ENSG00000175356 Signal peptide, CUB domain, EGF-like 2 SCUBE3 ENSG00000146197 Signal peptide, CUB domain, EGF-like 3 SDC1 ENSG00000115884 Syndecan 1 SDF2 ENSG00000132581 Stromal cell-derived factor 2 SDF2L1 ENSG00000128228 Stromal cell-derived factor 2-like 1 SDF4 ENSG00000078808 Stromal cell derived factor 4 SDHAF2 ENSG00000167985 Succinate dehydrogenase complex assembly factor 2 SDHAF4 ENSG00000154079 Succinate dehydrogenase complex assembly factor 4 SDHB ENSG00000117118 Succinate dehydrogenase complex, subunit B, iron sulfur (Ip) SDHD ENSG00000204370 Succinate dehydrogenase complex, subunit D, integral membrane protein SEC14L3 ENSG00000100012 SEC14-like lipid binding 3 SEC16A ENSG00000148396 SEC16 homolog A, endoplasmic reticulum export factor SEC16B ENSG00000120341 SEC16 homolog B, endoplasmic reticulum export factor SEC22C ENSG00000093183 SEC22 homolog C, vesicle trafficking protein SEC31A ENSG00000138674 SEC31 homolog A, COPII coat complex component SECISBP2 ENSG00000187742 SECIS binding protein 2 SECTM1 ENSG00000141574 Secreted and transmembrane 1 SEL1L ENSG00000071537 Sel-1 suppressor of lin-12-like (C. elegans) SELM ENSG00000198832 Selenoprotein M SELO ENSG00000073169 Selenoprotein O SEMA3A ENSG00000075213 Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A SEMA3B ENSG00000012171 Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B SEMA3C ENSG00000075223 Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C SEMA3E ENSG00000170381 Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E SEMA3F ENSG00000001617 Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F SEMA3G ENSG00000010319 Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G SEMA4A ENSG00000196189 Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A SEMA4B ENSG00000185033 Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B SEMA4C ENSG00000168758 Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C SEMA4D ENSG00000187764 Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D SEMA4F ENSG00000135622 Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F SEMA4G ENSG00000095539 Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G SEMA5A ENSG00000112902 Sema domain, seven thrombospondin repeats (type 1 and type 1- like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A SEMA6A ENSG00000092421 Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A SEMA6C ENSG00000143434 Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6C SEMA6D ENSG00000137872 Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D SEMG1 ENSG00000124233 Semenogelin I SEMG2 ENSG00000124157 Semenogelin II 15-Sep ENSG00000183291 15 kDa selenoprotein SEPN1 ENSG00000162430 Selenoprotein N, 1 SEPP1 ENSG00000250722 Selenoprotein P, plasma, 1 9-Sep ENSG00000184640 Septin 9 SERPINA1 ENSG00000197249 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 SERPINA10 ENSG00000140093 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 SERPINA11 ENSG00000186910 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 11 SERPINA12 ENSG00000165953 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 SERPINA3 ENSG00000196136 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3 SERPINA3 ENSG00000273259 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3 SERPINA4 ENSG00000100665 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 SERPINA5 ENSG00000188488 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5 SERPINA6 ENSG00000170099 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 SERPINA7 ENSG00000123561 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 7 SERPINA9 ENSG00000170054 Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9 SERPINB2 ENSG00000197632 Serpin peptidase inhibitor, clade B (ovalbumin), member 2 SERPINC1 ENSG00000117601 Serpin peptidase inhibitor, clade C (antithrombin), member 1 SERPIND1 ENSG00000099937 Serpin peptidase inhibitor, clade D (heparin cofactor), member 1 SERPINE1 ENSG00000106366 Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 SERPINE2 ENSG00000135919 Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 SERPINE3 ENSG00000253309 Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 SERPINF1 ENSG00000132386 Serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 SERPINF2 ENSG00000167711 Serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 SERPING1 ENSG00000149131 Serpin peptidase inhibitor, clade G (C1 inhibitor), member 1 SERPINH1 ENSG00000149257 Serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1) SERPINI1 ENSG00000163536 Serpin peptidase inhibitor, clade I (neuroserpin), member 1 SERPINI2 ENSG00000114204 Serpin peptidase inhibitor, clade I (pancpin), member 2 SETD8 ENSG00000183955 SET domain containing (lysine methyltransferase) 8 SEZ6L2 ENSG00000174938 Seizure related 6 homolog (mouse)-like 2 SFRP1 ENSG00000104332 Secreted frizzled-related protein 1 SFRP2 ENSG00000145423 Secreted frizzled-related protein 2 SFRP4 ENSG00000106483 Secreted frizzled-related protein 4 SFRP5 ENSG00000120057 Secreted frizzled-related protein 5 SFTA2 ENSG00000196260 Surfactant associated 2 SFTPA1 ENSG00000122852 Surfactant protein A1 SFTPA2 ENSG00000185303 Surfactant protein A2 SFTPB ENSG00000168878 Surfactant protein B SFTPD ENSG00000133661 Surfactant protein D SFXN5 ENSG00000144040 Sideroflexin 5 SGCA ENSG00000108823 Sarcoglycan, alpha (50 kDa dystrophin-associated glycoprotein) SGSH ENSG00000181523 N-sulfoglucosamine sulfohydrolase SH3RF3 ENSG00000172985 SH3 domain containing ring finger 3 SHBG ENSG00000129214 Sex hormone-binding globulin SHE ENSG00000169291 Src homology 2 domain containing E SHH ENSG00000164690 Sonic hedgehog SHKBP1 ENSG00000160410 SH3KBP1 binding protein 1 SIAE ENSG00000110013 Sialic acid acetylesterase SIDT2 ENSG00000149577 SID1 transmembrane family, member 2 SIGLEC10 ENSG00000142512 Sialic acid binding Ig-like lectin 10 SIGLEC6 ENSG00000105492 Sialic acid binding Ig-like lectin 6 SIGLEC7 ENSG00000168995 Sialic acid binding Ig-like lectin 7 SIGLECL1 ENSG00000179213 SIGLEC family like 1 SIGMAR1 ENSG00000147955 Sigma non-opioid intracellular receptor 1 SIL1 ENSG00000120725 SIL1 nucleotide exchange factor SIRPB1 ENSG00000101307 Signal-regulatory protein beta 1 SIRPD ENSG00000125900 Signal-regulatory protein delta SLAMF1 ENSG00000117090 Signaling lymphocytic activation molecule family member 1 SLAMF7 ENSG00000026751 SLAM family member 7 SLC10A3 ENSG00000126903 Solute carrier family 10, member 3 SLC15A3 ENSG00000110446 Solute carrier family 15 (oligopeptide transporter), member 3 SLC25A14 ENSG00000102078 Solute carrier family 25 (mitochondrial carrier, brain), member 14 SLC25A25 ENSG00000148339 Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 SLC2A5 ENSG00000142583 Solute carrier family 2 (facilitated glucose/fructose transporter), member 5 SLC35E3 ENSG00000175782 Solute carrier family 35, member E3 SLC39A10 ENSG00000196950 Solute carrier family 39 (zinc transporter), member 10 SLC39A14 ENSG00000104635 Solute carrier family 39 (zinc transporter), member 14 SLC39A4 ENSG00000147804 Solute carrier family 39 (zinc transporter), member 4 SLC39A5 ENSG00000139540 Solute carrier family 39 (zinc transporter), member 5 SLC3A1 ENSG00000138079 Solute carrier family 3 (amino acid transporter heavy chain), member 1 SLC51A ENSG00000163959 Solute carrier family 51, alpha subunit SLC52A2 ENSG00000185803 Solute carrier family 52 (riboflavin transporter), member 2 SLC5A6 ENSG00000138074 Solute carrier family 5 (sodium/multivitamin and iodide cotransporter), member 6 SLC6A9 ENSG00000196517 Solute carrier family 6 (neurotransmitter transporter, glycine), member 9 SLC8A1 ENSG00000183023 Solute carrier family 8 (sodium/calcium exchanger), member 1 SLC8B1 ENSG00000089060 Solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 SLC9A6 ENSG00000198689 Solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 SLCO1A2 ENSG00000084453 Solute carrier organic anion transporter family, member 1A2 SLIT1 ENSG00000187122 Slit guidance ligand 1 SLIT2 ENSG00000145147 Slit guidance ligand 2 SLIT3 ENSG00000184347 Slit guidance ligand 3 SLITRK3 ENSG00000121871 SLIT and NTRK-like family, member 3 SLPI ENSG00000124107 Secretory leukocyte peptidase inhibitor SLTM ENSG00000137776 SAFB-like, transcription modulator SLURP1 ENSG00000126233 Secreted LY6/PLAUR domain containing 1 SMARCA2 ENSG00000080503 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 SMG6 ENSG00000070366 SMG6 nonsense mediated mRNA decay factor SMIM7 ENSG00000214046 Small integral membrane protein 7 SMOC1 ENSG00000198732 SPARC related modular calcium binding 1 SMOC2 ENSG00000112562 SPARC related modular calcium binding 2 SMPDL3A ENSG00000172594 Sphingomyelin phosphodiesterase, acid-like 3A SMPDL3B ENSG00000130768 Sphingomyelin phosphodiesterase, acid-like 3B SMR3A ENSG00000109208 Submaxillary gland androgen regulated protein 3A SMR3B ENSG00000171201 Submaxillary gland androgen regulated protein 3B SNED1 ENSG00000162804 Sushi, nidogen and EGF-like domains 1 SNTB1 ENSG00000172164 Syntrophin, beta 1 (dystrophin-associated protein A1, 59 kDa, basic component 1) SNTB2 ENSG00000168807 Syntrophin, beta 2 (dystrophin-associated protein A1, 59 kDa, basic component 2) SNX14 ENSG00000135317 Sorting nexin 14 SOD3 ENSG00000109610 Superoxide dismutase 3, extracellular SOST ENSG00000167941 Sclerostin SOSTDC1 ENSG00000171243 Sclerostin domain containing 1 SOWAHA ENSG00000198944 Sosondowah ankyrin repeat domain family member A SPACA3 ENSG00000141316 Sperm acrosome associated 3 SPACA4 ENSG00000177202 Sperm acrosome associated 4 SPACA5 ENSG00000171489 Sperm acrosome associated 5 SPACA5B ENSG00000171478 Sperm acrosome associated 5B SPACA7 ENSG00000153498 Sperm acrosome associated 7 SPAG11A ENSG00000178287 Sperm associated antigen 11A SPAG11B ENSG00000164871 Sperm associated antigen 11B SPARC ENSG00000113140 Secreted protein, acidic, cysteine-rich (osteonectin) SPARCL1 ENSG00000152583 SPARC-like 1 (hevin) SPATA20 ENSG00000006282 Spermatogenesis associated 20 SPESP1 ENSG00000258484 Sperm equatorial segment protein 1 SPINK1 ENSG00000164266 Serine peptidase inhibitor, Kazal type 1 SPINK13 ENSG00000214510 Serine peptidase inhibitor, Kazal type 13 (putative) SPINK14 ENSG00000196800 Serine peptidase inhibitor, Kazal type 14 (putative) SPINK2 ENSG00000128040 Serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) SPINK4 ENSG00000122711 Serine peptidase inhibitor, Kazal type 4 SPINK5 ENSG00000133710 Serine peptidase inhibitor, Kazal type 5 SPINK6 ENSG00000178172 Serine peptidase inhibitor, Kazal type 6 SPINK7 ENSG00000145879 Serine peptidase inhibitor, Kazal type 7 (putative) SPINK8 ENSG00000229453 Serine peptidase inhibitor, Kazal type 8 (putative) SPINK9 ENSG00000204909 Serine peptidase inhibitor, Kazal type 9 SPINT1 ENSG00000166145 Serine peptidase inhibitor, Kunitz type 1 SPINT2 ENSG00000167642 Serine peptidase inhibitor, Kunitz type, 2 SPINT3 ENSG00000101446 Serine peptidase inhibitor, Kunitz type, 3 SPINT4 ENSG00000149651 Serine peptidase inhibitor, Kunitz type 4 SPOCK1 ENSG00000152377 Sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 SPOCK2 ENSG00000107742 Sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2 SPOCK3 ENSG00000196104 Sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 SPON1 ENSG00000262655 Spondin 1, extracellular matrix protein SPON2 ENSG00000159674 Spondin 2, extracellular matrix protein SPP1 ENSG00000118785 Secreted phosphoprotein 1 SPP2 ENSG00000072080 Secreted phosphoprotein 2, 24 kDa SPRN ENSG00000203772 Shadow of prion protein homolog (zebrafish) SPRYD3 ENSG00000167778 SPRY domain containing 3 SPRYD4 ENSG00000176422 SPRY domain containing 4 SPTY2D1-AS1 ENSG00000247595 SPTY2D1 antisense RNA 1 SPX ENSG00000134548 Spexin hormone SRGN ENSG00000122862 Serglycin SRL ENSG00000185739 Sarcalumenin SRP14 ENSG00000140319 Signal recognition particle 14 kDa (homologous Alu RNA binding protein) SRPX ENSG00000101955 Sushi-repeat containing protein, X-linked SRPX2 ENSG00000102359 Sushi-repeat containing protein, X-linked 2 SSC4D ENSG00000146700 Scavenger receptor cysteine rich family, 4 domains SSC5D ENSG00000179954 Scavenger receptor cysteine rich family, 5 domains SSPO ENSG00000197558 SCO-spondin SSR2 ENSG00000163479 Signal sequence receptor, beta (translocon-associated protein beta) SST ENSG00000157005 Somatostatin ST3GAL1 ENSG00000008513 ST3 beta-galactoside alpha-2,3-sialyltransferase 1 ST3GAL4 ENSG00000110080 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 ST6GAL1 ENSG00000073849 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 ST6GALNAC2 ENSG00000070731 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N- acetylgalactosaminide alpha-2,6-sialyltransferase 2 ST6GALNAC5 ENSG00000117069 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N- acetylgalactosaminide alpha-2,6-sialyltransferase 5 ST6GALNAC6 ENSG00000160408 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N- acetylgalactosaminide alpha-2,6-sialyltransferase 6 ST8SIA2 ENSG00000140557 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 ST8SIA4 ENSG00000113532 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 ST8SIA6 ENSG00000148488 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6 STARD7 ENSG00000084090 StAR-related lipid transfer (START) domain containing 7 STATH ENSG00000126549 Statherin STC1 ENSG00000159167 Stanniocalcin 1 STC2 ENSG00000113739 Stanniocalcin 2 STMND1 ENSG00000230873 Stathmin domain containing 1 STOML2 ENSG00000165283 Stomatin (EPB72)-like 2 STOX1 ENSG00000165730 Storkhead box 1 STRC ENSG00000242866 Stereocilin SUCLG1 ENSG00000163541 Succinate-CoA ligase, alpha subunit SUDS3 ENSG00000111707 SDS3 homolog, SIN3A corepressor complex component SULF1 ENSG00000137573 Sulfatase 1 SULF2 ENSG00000196562 Sulfatase 2 SUMF1 ENSG00000144455 Sulfatase modifying factor 1 SUMF2 ENSG00000129103 Sulfatase modifying factor 2 SUSD1 ENSG00000106868 Sushi domain containing 1 SUSD5 ENSG00000173705 Sushi domain containing 5 SVEP1 ENSG00000165124 Sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 SWSAP1 ENSG00000173928 SWIM-type zinc finger 7 associated protein 1 SYAP1 ENSG00000169895 Synapse associated protein 1 SYCN ENSG00000179751 Syncollin TAC1 ENSG00000006128 Tachykinin, precursor 1 TAC3 ENSG00000166863 Tachykinin 3 TAC4 ENSG00000176358 Tachykinin 4 (hemokinin) TAGLN2 ENSG00000158710 Transgelin 2 TAPBP ENSG00000231925 TAP binding protein (tapasin) TAPBPL ENSG00000139192 TAP binding protein-like TBL2 ENSG00000106638 Transducin (beta)-like 2 TBX10 ENSG00000167800 T-box 10 TCF12 ENSG00000140262 Transcription factor 12 TCN1 ENSG00000134827 Transcobalamin I (vitamin B12 binding protein, R binder family) TCN2 ENSG00000185339 Transcobalamin II TCTN1 ENSG00000204852 Tectonic family member 1 TCTN3 ENSG00000119977 Tectonic family member 3 TDP2 ENSG00000111802 Tyrosyl-DNA phosphodiesterase 2 TEK ENSG00000120156 TEK tyrosine kinase, endothelial TEPP ENSG00000159648 Testis, prostate and placenta expressed TEX101 ENSG00000131126 Testis expressed 101 TEX264 ENSG00000164081 Testis expressed 264 TF ENSG00000091513 Transferrin TFAM ENSG00000108064 Transcription factor A, mitochondrial TFF1 ENSG00000160182 Trefoil factor 1 TFF2 ENSG00000160181 Trefoil factor 2 TFF3 ENSG00000160180 Trefoil factor 3 (intestinal) TFPI ENSG00000003436 Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) TFPI2 ENSG00000105825 Tissue factor pathway inhibitor 2 TG ENSG00000042832 Thyroglobulin TGFB1 ENSG00000105329 Transforming growth factor, beta 1 TGFB2 ENSG00000092969 Transforming growth factor, beta 2 TGFB3 ENSG00000119699 Transforming growth factor, beta 3 TGFBI ENSG00000120708 Transforming growth factor, beta-induced, 68 kDa TGFBR1 ENSG00000106799 Transforming growth factor, beta receptor 1 TGFBR3 ENSG00000069702 Transforming growth factor, beta receptor III THBS1 ENSG00000137801 Thrombospondin 1 THBS2 ENSG00000186340 Thrombospondin 2 THBS3 ENSG00000169231 Thrombospondin 3 THBS4 ENSG00000113296 Thrombospondin 4 THOC3 ENSG00000051596 THO complex 3 THPO ENSG00000090534 Thrombopoietin THSD4 ENSG00000187720 Thrombospondin, type I, domain containing 4 THY1 ENSG00000154096 Thy-1 cell surface antigen TIE1 ENSG00000066056 Tyrosine kinase with immunoglobulin-like and EGF-like domains 1 TIMMDC1 ENSG00000113845 Translocase of inner mitochondrial membrane domain containing 1 TIMP1 ENSG00000102265 TIMP metallopeptidase inhibitor 1 TIMP2 ENSG00000035862 TIMP metallopeptidase inhibitor 2 TIMP3 ENSG00000100234 TIMP metallopeptidase inhibitor 3 TIMP4 ENSG00000157150 TIMP metallopeptidase inhibitor 4 TINAGL1 ENSG00000142910 Tubulointerstitial nephritis antigen-like 1 TINF2 ENSG00000092330 TERF1 (TRF1)-interacting nuclear factor 2 TLL2 ENSG00000095587 Tolloid-like 2 TLR1 ENSG00000174125 Toll-like receptor 1 TLR3 ENSG00000164342 Toll-like receptor 3 TM2D2 ENSG00000169490 TM2 domain containing 2 TM2D3 ENSG00000184277 TM2 domain containing 3 TM7SF3 ENSG00000064115 Transmembrane 7 superfamily member 3 TM9SF1 ENSG00000100926 Transmembrane 9 superfamily member 1 TMCO6 ENSG00000113119 Transmembrane and coiled-coil domains 6 TMED1 ENSG00000099203 Transmembrane p24 trafficking protein 1 TMED2 ENSG00000086598 Transmembrane p24 trafficking protein 2 TMED3 ENSG00000166557 Transmembrane p24 trafficking protein 3 TMED4 ENSG00000158604 Transmembrane p24 trafficking protein 4 TMED5 ENSG00000117500 Transmembrane p24 trafficking protein 5 TMED7 ENSG00000134970 Transmembrane p24 trafficking protein 7 TMED7-TICAM2 ENSG00000251201 TMED7-TICAM2 readthrough TMEM108 ENSG00000144868 Transmembrane protein 108 TMEM116 ENSG00000198270 Transmembrane protein 116 TMEM119 ENSG00000183160 Transmembrane protein 119 TMEM155 ENSG00000164112 Transmembrane protein 155 TMEM168 ENSG00000146802 Transmembrane protein 168 TMEM178A ENSG00000152154 Transmembrane protein 178A TMEM179 ENSG00000258986 Transmembrane protein 179 TMEM196 ENSG00000173452 Transmembrane protein 196 TMEM199 ENSG00000244045 Transmembrane protein 199 TMEM205 ENSG00000105518 Transmembrane protein 205 TMEM213 ENSG00000214128 Transmembrane protein 213 TMEM25 ENSG00000149582 Transmembrane protein 25 TMEM30C ENSG00000235156 Transmembrane protein 30C TMEM38B ENSG00000095209 Transmembrane protein 38B TMEM44 ENSG00000145014 Transmembrane protein 44 TMEM52 ENSG00000178821 Transmembrane protein 52 TMEM52B ENSG00000165685 Transmembrane protein 52B TMEM59 ENSG00000116209 Transmembrane protein 59 TMEM67 ENSG00000164953 Transmembrane protein 67 TMEM70 ENSG00000175606 Transmembrane protein 70 TMEM87A ENSG00000103978 Transmembrane protein 87A TMEM94 ENSG00000177728 Transmembrane protein 94 TMEM95 ENSG00000182896 Transmembrane protein 95 TMIGD1 ENSG00000182271 Transmembrane and immunoglobulin domain containing 1 TMPRSS12 ENSG00000186452 Transmembrane (C-terminal) protease, serine 12 TMPRSS5 ENSG00000166682 Transmembrane protease, serine 5 TMUB1 ENSG00000164897 Transmembrane and ubiquitin-like domain containing 1 TMX2 ENSG00000213593 Thioredoxin-related transmembrane protein 2 TMX3 ENSG00000166479 Thioredoxin-related transmembrane protein 3 TNC ENSG00000041982 Tenascin C TNFAIP6 ENSG00000123610 Tumor necrosis factor, alpha-induced protein 6 TNFRSF11A ENSG00000141655 Tumor necrosis factor receptor superfamily, member 11a, NFKB activator TNFRSF11B ENSG00000164761 Tumor necrosis factor receptor superfamily, member 11b TNFRSF12A ENSG00000006327 Tumor necrosis factor receptor superfamily, member 12A TNFRSF14 ENSG00000157873 Tumor necrosis factor receptor superfamily, member 14 TNFRSF18 ENSG00000186891 Tumor necrosis factor receptor superfamily, member 18 TNFRSF1A ENSG00000067182 Tumor necrosis factor receptor superfamily, member 1A TNFRSF1B ENSG00000028137 Tumor necrosis factor receptor superfamily, member 1B TNFRSF25 ENSG00000215788 Tumor necrosis factor receptor superfamily, member 25 TNFRSF6B ENSG00000243509 Tumor necrosis factor receptor superfamily, member 6b, decoy TNFSF11 ENSG00000120659 Tumor necrosis factor (ligand) superfamily, member 11 TNFSF12 ENSG00000239697 Tumor necrosis factor (ligand) superfamily, member 12 TNFSF12-TNFSF13 ENSG00000248871 TNFSF12-TNFSF13 readthrough TNFSF15 ENSG00000181634 Tumor necrosis factor (ligand) superfamily, member 15 TNN ENSG00000120332 Tenascin N TNR ENSG00000116147 Tenascin R TNXB ENSG00000168477 Tenascin XB TOMM7 ENSG00000196683 Translocase of outer mitochondrial membrane 7 homolog (yeast) TOP1MT ENSG00000184428 Topoisomerase (DNA) I, mitochondrial TOR1A ENSG00000136827 Torsin family 1, member A (torsin A) TOR1B ENSG00000136816 Torsin family 1, member B (torsin B) TOR2A ENSG00000160404 Torsin family 2, member A TOR3A ENSG00000186283 Torsin family 3, member A TPD52 ENSG00000076554 Tumor protein D52 TPO ENSG00000115705 Thyroid peroxidase TPP1 ENSG00000166340 Tripeptidyl peptidase I TPSAB1 ENSG00000172236 Tryptase alpha/beta 1 TPSB2 ENSG00000197253 Tryptase beta 2 (gene/pseudogene) TPSD1 ENSG00000095917 Tryptase delta 1 TPST1 ENSG00000169902 Tyrosylprotein sulfotransferase 1 TPST2 ENSG00000128294 Tyrosylprotein sulfotransferase 2 TRABD2A ENSG00000186854 TraB domain containing 2A TRABD2B ENSG00000269113 TraB domain containing 2B TREH ENSG00000118094 Trehalase (brush-border membrane glycoprotein) TREM1 ENSG00000124731 Triggering receptor expressed on myeloid cells 1 TREM2 ENSG00000095970 Triggering receptor expressed on myeloid cells 2 TRH ENSG00000170893 Thyrotropin-releasing hormone TRIM24 ENSG00000122779 Tripartite motif containing 24 TRIM28 ENSG00000130726 Tripartite motif containing 28 TRIO ENSG00000038382 Trio Rho guanine nucleotide exchange factor TRNP1 ENSG00000253368 TMF1-regulated nuclear protein 1 TSC22D4 ENSG00000166925 TSC22 domain family, member 4 TSHB ENSG00000134200 Thyroid stimulating hormone, beta TSHR ENSG00000165409 Thyroid stimulating hormone receptor TSKU ENSG00000182704 Tsukushi, small leucine rich proteoglycan TSLP ENSG00000145777 Thymic stromal lymphopoietin TSPAN3 ENSG00000140391 Tetraspanin 3 TSPAN31 ENSG00000135452 Tetraspanin 31 TSPEAR ENSG00000175894 Thrombospondin-type laminin G domain and EAR repeats TTC13 ENSG00000143643 Tetratricopeptide repeat domain 13 TTC19 ENSG00000011295 Tetratricopeptide repeat domain 19 TTC9B ENSG00000174521 Tetratricopeptide repeat domain 9B TTLL11 ENSG00000175764 Tubulin tyrosine ligase-like family member 11 TTR ENSG00000118271 Transthyretin TWSG1 ENSG00000128791 Twisted gastrulation BMP signaling modulator 1 TXNDC12 ENSG00000117862 Thioredoxin domain containing 12 (endoplasmic reticulum) TXNDC15 ENSG00000113621 Thioredoxin domain containing 15 TXNDC5 ENSG00000239264 Thioredoxin domain containing 5 (endoplasmic reticulum) TXNRD2 ENSG00000184470 Thioredoxin reductase 2 TYRP1 ENSG00000107165 Tyrosinase-related protein 1 UBAC2 ENSG00000134882 UBA domain containing 2 UBALD1 ENSG00000153443 UBA-like domain containing 1 UBAP2 ENSG00000137073 Ubiquitin associated protein 2 UBXN8 ENSG00000104691 UBX domain protein 8 UCMA ENSG00000165623 Upper zone of growth plate and cartilage matrix associated UCN ENSG00000163794 Urocortin UCN2 ENSG00000145040 Urocortin 2 UCN3 ENSG00000178473 Urocortin 3 UGGT2 ENSG00000102595 UDP-glucose glycoprotein glucosyltransferase 2 UGT1A10 ENSG00000242515 UDP glucuronosyltransferase 1 family, polypeptide A10 UGT2A1 ENSG00000173610 UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus UGT2B11 ENSG00000213759 UDP glucuronosyltransferase 2 family, polypeptide B11 UGT2B28 ENSG00000135226 UDP glucuronosyltransferase 2 family, polypeptide B28 UGT2B4 ENSG00000156096 UDP glucuronosyltransferase 2 family, polypeptide B4 UGT2B7 ENSG00000171234 UDP glucuronosyltransferase 2 family, polypeptide B7 UGT3A1 ENSG00000145626 UDP glycosyltransferase 3 family, polypeptide A1 UGT3A2 ENSG00000168671 UDP glycosyltransferase 3 family, polypeptide A2 UGT8 ENSG00000174607 UDP glycosyltransferase 8 ULBP3 ENSG00000131019 UL16 binding protein 3 UMOD ENSG00000169344 Uromodulin UNC5C ENSG00000182168 Unc-5 netrin receptor C UPK3B ENSG00000243566 Uroplakin 3B USP11 ENSG00000102226 Ubiquitin specific peptidase 11 USP14 ENSG00000101557 Ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) USP3 ENSG00000140455 Ubiquitin specific peptidase 3 UTS2 ENSG00000049247 Urotensin 2 UTS2B ENSG00000188958 Urotensin 2B UTY ENSG00000183878 Ubiquitously transcribed tetratricopeptide repeat containing, Y- linked UXS1 ENSG00000115652 UDP-glucuronate decarboxylase 1 VASH1 ENSG00000071246 Vasohibin 1 VCAN ENSG00000038427 Versican VEGFA ENSG00000112715 Vascular endothelial growth factor A VEGFB ENSG00000173511 Vascular endothelial growth factor B VEGFC ENSG00000150630 Vascular endothelial growth factor C VGF ENSG00000128564 VGF nerve growth factor inducible VIP ENSG00000146469 Vasoactive intestinal peptide VIPR2 ENSG00000106018 Vasoactive intestinal peptide receptor 2 VIT ENSG00000205221 Vitrin VKORC1 ENSG00000167397 Vitamin K epoxide reductase complex, subunit 1 VLDLR ENSG00000147852 Very low density lipoprotein receptor VMO1 ENSG00000182853 Vitelline membrane outer layer 1 homolog (chicken) VNN1 ENSG00000112299 Vanin 1 VNN2 ENSG00000112303 Vanin 2 VNN3 ENSG00000093134 Vanin 3 VOPP1 ENSG00000154978 Vesicular, overexpressed in cancer, prosurvival protein 1 VPREB1 ENSG00000169575 Pre-B lymphocyte 1 VPREB3 ENSG00000128218 Pre-B lymphocyte 3 VPS37B ENSG00000139722 Vacuolar protein sorting 37 homolog B (S. cerevisiae) VPS51 ENSG00000149823 Vacuolar protein sorting 51 homolog (S. cerevisiae) VSIG1 ENSG00000101842 V-set and immunoglobulin domain containing 1 VSIG10 ENSG00000176834 V-set and immunoglobulin domain containing 10 VSTM1 ENSG00000189068 V-set and transmembrane domain containing 1 VSTM2A ENSG00000170419 V-set and transmembrane domain containing 2A VSTM2B ENSG00000187135 V-set and transmembrane domain containing 2B VSTM2L ENSG00000132821 V-set and transmembrane domain containing 2 like VSTM4 ENSG00000165633 V-set and transmembrane domain containing 4 VTN ENSG00000109072 Vitronectin VWA1 ENSG00000179403 Von Willebrand factor A domain containing 1 VWA2 ENSG00000165816 Von Willebrand factor A domain containing 2 VWA5B2 ENSG00000145198 Von Willebrand factor A domain containing 5B2 VWA7 ENSG00000204396 Von Willebrand factor A domain containing 7 VWC2 ENSG00000188730 Von Willebrand factor C domain containing 2 VWC2L ENSG00000174453 Von Willebrand factor C domain containing protein 2-like VWCE ENSG00000167992 Von Willebrand factor C and EGF domains VWDE ENSG00000146530 Von Willebrand factor D and EGF domains VWF ENSG00000110799 Von Willebrand factor WDR25 ENSG00000176473 WD repeat domain 25 WDR81 ENSG00000167716 WD repeat domain 81 WDR90 ENSG00000161996 WD repeat domain 90 WFDC1 ENSG00000103175 WAP four-disulfide core domain 1 WFDC10A ENSG00000180305 WAP four-disulfide core domain 10A WFDC10B ENSG00000182931 WAP four-disulfide core domain 10B WFDC11 ENSG00000180083 WAP four-disulfide core domain 11 WFDC12 ENSG00000168703 WAP four-disulfide core domain 12 WFDC13 ENSG00000168634 WAP four-disulfide core domain 13 WFDC2 ENSG00000101443 WAP four-disulfide core domain 2 WFDC3 ENSG00000124116 WAP four-disulfide core domain 3 WFDC5 ENSG00000175121 WAP four-disulfide core domain 5 WFDC6 ENSG00000243543 WAP four-disulfide core domain 6 WFDC8 ENSG00000158901 WAP four-disulfide core domain 8 WFIKKN1 ENSG00000127578 WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 WFIKKN2 ENSG00000173714 WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 WIF1 ENSG00000156076 WNT inhibitory factor 1 WISP1 ENSG00000104415 WNT1 inducible signaling pathway protein 1 WISP2 ENSG00000064205 WNT1 inducible signaling pathway protein 2 WISP3 ENSG00000112761 WNT1 inducible signaling pathway protein 3 WNK1 ENSG00000060237 WNK lysine deficient protein kinase 1 WNT1 ENSG00000125084 Wingless-type MMTV integration site family, member 1 WNT10B ENSG00000169884 Wingless-type MMTV integration site family, member 10B WNT11 ENSG00000085741 Wingless-type MMTV integration site family, member 11 WNT16 ENSG00000002745 Wingless-type MMTV integration site family, member 16 WNT2 ENSG00000105989 Wingless-type MMTV integration site family member 2 WNT3 ENSG00000108379 Wingless-type MMTV integration site family, member 3 WNT3A ENSG00000154342 Wingless-type MMTV integration site family, member 3A WNT5A ENSG00000114251 Wingless-type MMTV integration site family, member 5A WNT5B ENSG00000111186 Wingless-type MMTV integration site family, member 5B WNT6 ENSG00000115596 Wingless-type MMTV integration site family, member 6 WNT7A ENSG00000154764 Wingless-type MMTV integration site family, member 7A WNT7B ENSG00000188064 Wingless-type MMTV integration site family, member 7B WNT8A ENSG00000061492 Wingless-type MMTV integration site family, member 8A WNT8B ENSG00000075290 Wingless-type MMTV integration site family, member 8B WNT9A ENSG00000143816 Wingless-type MMTV integration site family, member 9A WNT9B ENSG00000158955 Wingless-type MMTV integration site family, member 9B WSB1 ENSG00000109046 WD repeat and SOCS box containing 1 WSCD1 ENSG00000179314 WSC domain containing 1 WSCD2 ENSG00000075035 WSC domain containing 2 XCL1 ENSG00000143184 Chemokine (C motif) ligand 1 XCL2 ENSG00000143185 Chemokine (C motif) ligand 2 XPNPEP2 ENSG00000122121 X-prolyl aminopeptidase (aminopeptidase P) 2, membrane- bound XXbac- ENSG00000244255 BPG116M5.17 XXbac- ENSG00000248993 BPG181M17.5 XXbac-BPG32J3.20 ENSG00000204422 XXYLT1 ENSG00000173950 Xyloside xylosyltransferase 1 XYLT1 ENSG00000103489 Xylosyltransferase I XYLT2 ENSG00000015532 Xylosyltransferase II ZFYVE21 ENSG00000100711 Zinc finger, FYVE domain containing 21 ZG16 ENSG00000174992 Zymogen granule protein 16 ZG16B ENSG00000162078 Zymogen granule protein 16B ZIC4 ENSG00000174963 Zic family member 4 ZNF207 ENSG00000010244 Zinc finger protein 207 ZNF26 ENSG00000198393 Zinc finger protein 26 ZNF34 ENSG00000196378 Zinc finger protein 34 ZNF419 ENSG00000105136 Zinc finger protein 419 ZNF433 ENSG00000197647 Zinc finger protein 433 ZNF449 ENSG00000173275 Zinc finger protein 449 ZNF488 ENSG00000265763 Zinc finger protein 488 ZNF511 ENSG00000198546 Zinc finger protein 511 ZNF570 ENSG00000171827 Zinc finger protein 570 ZNF691 ENSG00000164011 Zinc finger protein 691 ZNF98 ENSG00000197360 Zinc finger protein 98 ZPBP ENSG00000042813 Zona pellucida binding protein ZPBP2 ENSG00000186075 Zona pellucida binding protein 2 ZSCAN29 ENSG00000140265 Zinc finger and SCAN domain containing 29

    [0242] In some embodiments of the disclosure, T cells are modified to express therapeutic proteins, including secreted proteins and secreted human proteins. In some embodiments of the methods of the disorder, compositions comprising CAR-T cells modified to express or to secrete a human protein are used to treat a clotting disorder. Blood clotting occurs through a multistep process known as the coagulation cascade. In the extrinsic pathway, Tissue Factor (also known as factor III or thromboplastin) comes into contact with factor VII to form an activated VIIa complex. This initiates a coagulation protease cascade, converting the inactive Factor X to an active protease Factor Xa, which, with activated Factor V, produces thrombin (IIa) from Prothrombin (II). In the intrinsic pathway, collagen forms a complex with high-molecular-weight-kininogen, prekallikrein and Factor XII, leading to the conversion of Factor XII into Factor XIIa. Factor XIIa converts Factor XI into Factor XIa, and Factor XIa activates Factor IX to produce Factor IXa, which, together with FVIIIa form the tenase complex, which activates Factor X, which helps convert Prothrombin (II) into Thrombin (IIa). Thrombin in turn leads to the conversion of Fibrinogen (I) into Fibrin, which together with Factor XIIIa forms a cross-linked fibrin clot. Many clotting disorders are the result of low levels of secreted proteins in the blood that are involved in the coagulation cascade. Clotting disorders can drastically increase the amount of blood leaving the body upon injury, or cause bleeding to occur under the skin or in vital organs. These disorders are frequently genetic. Exemplary, but non-limiting diseases caused by deficiencies in clotting factors include Hemophilias, von Willebrand disease and deficiencies in Antithrombin III, protein C or protein S. Hemophila A and B are X-linked, and are caused by insufficient levels of clotting factor VIII and factor IX (FIX) respectively. Hemophila C is caused by insufficient factor XI. Factor II, VII, X or XII deficiencies can also cause bleeding disorders. Von Willebrand disease is due to a low level of the von Willebrand clotting factor in the blood. In some cases, deficiencies in blood proteins that regulate clotting lead can lead to too much clotting. Factor V Leiden is a genetic disorder, where the factor V Leiden protein overreacts, causing the blood to clot too often or too much. Deficiencies in Antithrombin III, protein C or protein S, which help regulate bleeding, can also cause excessive clotting. Currently, clotting disorders such as Hemophilia are treated with blood transfusions or infusions of the missing clotting factor (replacement therapy). However, complications of replacement therapy include developing antibodies to the clotting factor, contracting viral infections from blood derived products and damage to joints. There thus exists a need for additional therapies.

    [0243] In some embodiments of the disclosure, T cells are modified to express therapeutic proteins, including secreted proteins and secreted human proteins. In some embodiments of the methods of the disorder, compositions comprising CAR-T cells modified to express or to secrete a human protein are used for enzyme replacement therapy. Enzyme replacement therapy typically involves intravenous infusions of therapeutically effective amounts of compositions comprising enzymes that balance underlying enzyme deficiencies that cause the symptoms of the disease. The missing enzyme activity is thus supplied exogenously in this manner. Exemplary diseases that can be treated by modified T cells of the disclosure include, but are not limited to, lysosomal storage diseases Gaucher's disease (glucocerebrosidase enzyme), Fabry disease, mucopolysaccharidosis I (MPS I), mucopolysaccharidosis I (MPS II, or Hunter syndrome, caused by iduronate-2-sulfatase deficiency), mucopolysaccharidosis VI (MPS VI, caused by arylsulfatase B deficiency) and Pompe disease (or glycogen stoarage disease type II, caused by a deficiency in acid alpha-glucosidase). Additional diseases treatable with enzyme replacement therapy include but are not limited to Adenosine deaminase (ADA) deficiency, Hyperammonemia due to the deficiency of the hepatic enzyme N-acetylglutamate synthetase (NAGS), Hypophosphatasia, Lysosomal acid lipase deficiency, Morquio Syndrome A, Wolman LAL Lysosomal Acid Lipase deficiency, A1AT (Alpha1-Antitrypsin) deficiency and Urea cycle disorder. Enzymes supplied to patients during enzyme replacement therapy include, but are not limited to Alpha1-Antitrypsin, ?-Glucocerebrosidase, Adenosine Deaminase, Alpha-Galactosidase A, ?-L-Iduronidase, Iduronate-2-Sulfatase, N-Acetylgalactosamine-6 Sulfatase, -Acetylgalactosamine-4 Sulfatase and Lysosomal Acid Lipase.

    [0244] In some embodiments of the disclosure, T cells are modified to express therapeutic proteins, including secreted proteins and secreted human proteins. In some embodiments of the methods of the disorder, compositions comprising CAR-T cells modified to express or to secrete a human protein are used to produce human antibodies. In some embodiments, the disease to be treated by modified T cells expressing secreted proteins is a disease that can be treated through the intravenous infusion or injection of an antibody or an antibody fragment. Antibody based therapies are used in the treatment of many types of diseases in addition to cancer, including immune-based diseases such as arthritis and asthma, and infections, as well as other diseases. Exemplary, but non-limiting list of diseases that can be treated with the modified T cells of the disclosure include platelet aggregation, Clostridium difficile infection, Rheumatoid arthritis, Crohn's Disease, Plaque Psoriasis, Psoriatic Arthritis, Ankylosing Spondylitis, Juvenile Idiopathic Arthritis, Alzheimer's disease, sepsis, Multiple Sclerosis, hypercholesterolemia, systemic lupus erythematosus, prevention of organ transplant rejections, viral infections, asthma, severe allergic disorders, retinopathy, osteoporosis, inflammatory bowel diseases, inflammatory diseases, influenza A, paroxysmal nocturnal hemoglobinuria, sepsis caused by Gram-negative bacteria, psoriasis, invasive Candida infection, ulcerative colitis, hypocholesterolemia, respiratory syncytial virus infection, focal segmental glomerulosclerosis, graft versus host disease, ankylosing spondylitis, HIV infection, ulcerative colitis, autoimmune diseases, chronic asthma, reduction of scarring after glaucoma surgery, hypercholesterolemia, white blood cell diseases, systemic scleroderma, respiratory syncytial virus (prevention), lupus erythematosus, diabetes mellitus type 1, inflammation, Pseudomonas aeruginosa infection, macular degeneration, anthrax, cytomegalovirus infection, inflammations of the airways, skin and gastrointestinal tract, systemic lupus erythematosus, rheumatic diseases, uveitis, cytomegalovirus infection, dermatomyositis, polymyositis, fibrosis, choroidal and retinal neovascularization, muscular dystrophy, Staphylococcus aureus infection, lupus nephritis, follicular lymphoma, chronic hepatitis B and ulcerative colitis.

    Infusion of Modified Cells as Adoptive Cell Therapy

    [0245] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises between 2?10.sup.5 and 5?10.sup.8 cells per kg of body weight of the patient per administration, or any range, value or fraction thereof.

    [0246] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises between 0.2?10.sup.6 to 20?10.sup.6 cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 0.2?10.sup.6 cells per kg of body weight of the patient per administration, 2?10.sup.6 cells per kg of body weight of the patient per administration, 20?10.sup.6 cells per kg of body weight of the patient per administration, or any cells per kg of body weight of the patient per administration in between.

    [0247] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 1?10.sup.6 cells or about 1?10.sup.6 cells per kg of body weight of the patient per administration.

    [0248] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 3?10.sup.6 cells or about 3?10.sup.6 cells per kg of body weight of the patient per administration.

    [0249] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises between 0.7?10.sup.6 to 6.7?10.sup.6 cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 0.7?10.sup.6 cells per kg of body weight of the patient per administration, 6.7?10.sup.6 cells per kg of body weight of the patient per administration or any cells per kg of body weight of the patient per administration in between.

    [0250] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises between 0.7?10.sup.6 to 16?10.sup.6 cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 0.7?10.sup.6 cells per kg of body weight of the patient per administration, 2?10.sup.6 cells per kg of body weight of the patient per administration, 6?10.sup.6 cells per kg of body weight of the patient per administration, 10.7?10.sup.6 cells per kg of body weight of the patient per administration, 16?10.sup.6 cells per kg of body weight of the patient per administration or any cells per kg of body weight of the patient per administration in between.

    [0251] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 1.2?10.sup.6 to 7.1?10.sup.6 cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 1.2?10.sup.6 cells per kg of body weight of the patient per administration, 7.1?10.sup.6 cells per kg of body weight of the patient per administration or any number of cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises between 2?10.sup.6 to 3?10.sup.6 cells per kg of body weight of the patient per administration.

    [0252] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 1106?10.sup.6 to 2106?10.sup.6 cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 1106?10.sup.6 cells per kg of body weight of the patient per administration, 2106?10.sup.6 cells per kg of body weight of the patient per administration or any number of cells per kg of body weight of the patient per administration in between. In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 0.7?10.sup.6 to 1.3?10.sup.6 cells per kg of body weight of the patient per administration. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises 0.7?10.sup.6 cells per kg of body weight of the patient per administration, 1.3?10.sup.6 cells per kg of body weight of the patient per administration or any number of cells per kg of body weight of the patient per administration in between.

    [0253] In certain embodiments of the disclosure, modified cells of the disclosure are delivered to a patient via injection or intravenous infusion. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises a single or multiple doses. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises a split dose. In certain embodiments, a therapeutically effective dose of a composition of the disclosure or of compositions comprising modified cells of the disclosure comprises an initial dose and a maintenance dose.

    [0254] In certain embodiments of the disclosure, the modified cells are T cells and the T cells may be sorted according to T cell markers prior to either in vitro expansion or formulation with a pharmaceutically acceptable carrier. In some embodiments, modified T cells may be sorted on using CD8+ and/or CD4+ markers.

    Nucleic Acid Molecules

    [0255] Nucleic acid molecules of the disclosure encoding protein scaffolds can be in the form of RNA, such as mRNA, hnRNA, tRNA or any other form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or produced synthetically, or any combinations thereof. The DNA can be triple-stranded, double-stranded or single-stranded, or any combination thereof. Any portion of at least one strand of the DNA or RNA can be the coding strand, also known as the sense strand, or it can be the non-coding strand, also referred to as the anti-sense strand.

    [0256] Isolated nucleic acid molecules of the disclosure can include nucleic acid molecules comprising an open reading frame (ORF), optionally, with one or more introns, e.g., but not limited to, at least one specified portion of at least one protein scaffold; nucleic acid molecules comprising the coding sequence for a protein scaffold or loop region that binds to the target protein; and nucleic acid molecules which comprise a nucleotide sequence substantially different from those described above but which, due to the degeneracy of the genetic code, still encode the protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase as described herein and/or as known in the art. Of course, the genetic code is well known in the art. Thus, it would be routine for one skilled in the art to generate such degenerate nucleic acid variants that code for specific protein scaffolds of the present invention. See, e.g., Ausubel, et al., supra, and such nucleic acid variants are included in the present invention.

    [0257] As indicated herein, nucleic acid molecules of the disclosure which comprise a nucleic acid encoding a protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase can include, but are not limited to, those encoding the amino acid sequence of a protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase fragment, by itself; the coding sequence for the entire protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase or a portion thereof; the coding sequence for a protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase, fragment or portion, as well as additional sequences, such as the coding sequence of at least one signal leader or fusion peptide, with or without the aforementioned additional coding sequences, such as at least one intron, together with additional, non-coding sequences, including but not limited to, non-coding 5 and 3 sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals (for example, ribosome binding and stability of mRNA); an additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities. Thus, the sequence encoding a protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase can be fused to a marker sequence, such as a sequence encoding a peptide that facilitates purification of the fused protein scaffold, Centyrin, CAR, CARTyrin, transposon, and/or transposase comprising a protein scaffold fragment or portion.

    Construction of Nucleic Acids

    [0258] The isolated nucleic acids of the disclosure can be made using (a) recombinant methods, (b) synthetic techniques, (c) purification techniques, and/or (d) combinations thereof, as well-known in the art.

    [0259] The nucleic acids can conveniently comprise sequences in addition to a polynucleotide of the present invention. For example, a multi-cloning site comprising one or more endonuclease restriction sites can be inserted into the nucleic acid to aid in isolation of the polynucleotide. Also, translatable sequences can be inserted to aid in the isolation of the translated polynucleotide of the disclosure. For example, a hexa-histidine marker sequence provides a convenient means to purify the proteins of the disclosure. The nucleic acid of the disclosure, excluding the coding sequence, is optionally a vector, adapter, or linker for cloning and/or expression of a polynucleotide of the disclosure.

    [0260] Additional sequences can be added to such cloning and/or expression sequences to optimize their function in cloning and/or expression, to aid in isolation of the polynucleotide, or to improve the introduction of the polynucleotide into a cell. Use of cloning vectors, expression vectors, adapters, and linkers is well known in the art. (See, e.g., Ausubel, supra; or Sambrook, supra).

    Recombinant Methods for Constructing Nucleic Acids

    [0261] The isolated nucleic acid compositions of this disclosure, such as RNA, cDNA, genomic DNA, or any combination thereof, can be obtained from biological sources using any number of cloning methodologies known to those of skill in the art. In some embodiments, oligonucleotide probes that selectively hybridize, under stringent conditions, to the polynucleotides of the present invention are used to identify the desired sequence in a cDNA or genomic DNA library. The isolation of RNA, and construction of cDNA and genomic libraries are well known to those of ordinary skill in the art. (See, e.g., Ausubel, supra; or Sambrook, supra).

    Vectors and Host Cells

    [0262] The disclosure also relates to vectors that include isolated nucleic acid molecules of the disclosure, host cells that are genetically engineered with the recombinant vectors, and the production of at least one protein scaffold by recombinant techniques, as is well known in the art. See, e.g., Sambrook, et al., supra; Ausubel, et al., supra, each entirely incorporated herein by reference.

    [0263] For example, the PB-EF1a vector may be used. The vector comprises the following nucleotide sequence:

    TABLE-US-00026 (SEQ ID NO: 35) tgtacatagattaaccctagaaagataatcatattgtgacgtacgttaaa gataatcatgcgtaaaattgacgcatgtgttttatcggtctgtatatcga ggtttatttattaatttgaatagatattaagttttattatatttacactt acatactaataataaattcaacaaacaatttatttatgtttatttattta ttaaaaaaaaacaaaaactcaaaatttcttctataaagtaacaaaacttt tatcgaatacctgcagcccgggggatgcagagggacagcccccccccaaa gcccccagggatgtaattacgtccctcccccgctagggggcagcagcgag ccgcccggggctccgctccggtccggcgctccccccgcatccccgagccg gcagcgtgcggggacagcccgggcacggggaaggtggcacgggatcgctt tcctctgaacgcttctcgctgctctttgagcctgcagacacctgggggga tacggggaaaagttgactgtgcctttcgatcgaaccatggacagttagct ttgcaaagatggataaagttttaaacagagaggaatctttgcagctaatg gaccttctaggtcttgaaaggagtgggaattggctccggtgcccgtcagt gggcagagcgcacatcgcccacagtccccgagaagttggggggaggggtc ggcaattgaaccggtgcctagagaaggtggcgcggggtaaactgggaaag tgatgtcgtgtactggctccgcctttttcccgagggtgggggagaaccgt atataagtgcagtagtcgccgtgaacgttctttttcgcaacgggtttgcc gccagaacacaggtaagtgccgtgtgtggttcccgcgggcctggcctctt tacgggttatggcccttgcgtgccttgaattacttccacctggctgcagt acgtgattcttgatcccgagcttcgggttggaagtgggtgggagagttcg aggccttgcgcttaaggagccccttcgcctcgtgcttgagttgaggcctg gcctgggcgctggggccgccgcgtgcgaatctggtggcaccttcgcgcct gtctcgctgctttcgataagtctctagccatttaaaatttttgatgacct gctgcgacgctttttttctggcaagatagtcttgtaaatgcgggccaaga tctgcacactggtatttcggtttttggggccgcgggcggcgacggggccc gtgcgtcccagcgcacatgttcggcgaggcggggcctgcgagcgcggcca ccgagaatcggacgggggtagtctcaagctggccggcctgctctggtgcc tggcctcgcgccgccgtgtatcgccccgccctgggcggcaaggctggccc ggtcggcaccagttgcgtgagcggaaagatggccgcttcccggccctgct gcagggagctcaaaatggaggacgcggcgctcgggagagcgggcgggtga gtcacccacacaaaggaaaagggcctttccgtcctcagccgtcgcttcat gtgactccacggagtaccgggcgccgtccaggcacctcgattagttctcg agcttttggagtacgtcgtctttaggttggggggaggggttttatgcgat ggagtttccccacactgagtgggtggagactgaagttaggccagcttggc acttgatgtaattctccttggaatttgccctttttgagtttggatcttgg ttcattctcaagcctcagacagtggttcaaagtttttttcttccatttca ggtgtcgtgagaattctaatacgactcactatagggtgtgctgtctcatc attttggcaaagattggccaccaagcttgtcctgcaggagggtcgacgcc tctagacgggcggccgctccggatccacgggtaccgatcacatatgcctt taattaaacactagttctatagtgtcacctaaattccctttagtgagggt taatggccgtaggccgccagaattgggtccagacatgataagatacattg atgagtttggacaaaccacaactagaatgcagtgaaaaaaatgctttatt tgtgaaatttgtgatgctattgctttatttgtaaccattataagctgcaa taaacaagttaacaacaacaattgcattcattttatgtttcaggttcagg gggaggtgtgggaggttttttcggactctaggacctgcgcatgcgcttgg cgtaatcatggtcatagctgtttcctgttttccccgtatccccccaggtg tctgcaggctcaaagagcagcgagaagcgttcagaggaaagcgatcccgt gccaccttccccgtgcccgggctgtccccgcacgctgccggctcggggat gcggggggagcgccggaccggagcggagccccgggcggctcgctgctgcc ccctagcgggggagggacgtaattacatccctgggggctttggggggggg ctgtccctctcaccgcggtggagctccagcttttgttcgaattggggccc cccctcgagggtatcgatgatatctataacaagaaaatatatatataata agttatcacgtaagtagaacatgaaataacaatataattatcgtatgagt taaatcttaaaagtcacgtaaaagataatcatgcgtcattttgactcacg cggtcgttatagttcaaaatcagtgacacttaccgcattgacaagcacgc ctcacgggagctccaagcggcgactgagatgtcctaaatgcacagcgacg gattcgcgctatttagaaagagagagcaatatttcaagaatgcatgcgtc aattttacgcagactatctttctagggttaatctagctagccttaagggc gcctattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgt gccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgt attgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgt tcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttat ccacagaatcaggggataacgcaggaaagaacatgaccaaaatcccttaa cgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaagg atcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaa aaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctacca actctttttccgaaggtaactggcttcagcagagcgcagataccaaatac tgttcttctagtgtagccgtagttaggccaccacttcaagaactctgtag caccgcctacatacctcgctctgctaatcctgttaccagtggctgctgcc agtggcgataagtcgtgtcttaccgggttggactcaagacgatagttacc ggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagccca gcttggagcgaacgacctacaccgaactgagatacctacagcgtgagcta tgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggt aagcggcagggtcggaacaggagagcgcacgagggagcttccagggggaa acgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgag cgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgc cagcaacgcggcctttttacggttcctggccttttgctggccttttgctc acatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaa tgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacag tcagaagaactcgtcaagaaggcgatagaaggcgatgcgctgcgaatcgg gagcggcgataccgtaaagcacgaggaagcggtcagcccattcgccgcca agctcttcagcaatatcacgggtagccaacgctatgtcctgatagcggtc cgccacacccagccggccacagtcgatgaatccagaaaagcggccatttt ccaccatgatattcggcaagcaggcatcgccatgggtcacgacgagatcc tcgccgtcgggcatgctcgccttgagcctggcgaacagttcggctggcgc gagcccctgatgctcttcgtccagatcatcctgatcgacaagaccggctt ccatccgagtacgtgctcgctcgatgcgatgtttcgcttggtggtcgaat gggcaggtagccggatcaagcgtatgcagccgccgcattgcatcagccat gatggatactttctcggcaggagcaaggtgagatgacaggagatcctgcc ccggcacttcgcccaatagcagccagtcccttcccgcttcagtgacaacg tcgagcacagctgcgcaaggaacgcccgtcgtggccagccacgatagccg cgctgcctcgtcttgcagttcattcagggcaccggacaggtcggtcttga caaaaagaaccgggcgcccctgcgctgacagccggaacacggcggcatca gagcagccgattgtctgttgtgcccagtcatagccgaatagcctctccac ccaagcggccggagaacctgcgtgcaatccatcttgttcaatcataatat tattgaagcatttatcagggttcgtctcgtcccggtctcctcccaatgca tgtcaatattggccattagccatattattcattggttatatagcataaat caatattggctattggccattgcatacgttgtatctatatcataata.

    [0264] The polynucleotides can optionally be joined to a vector containing a selectable marker for propagation in a host. Generally, a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it can be packaged in vitro using an appropriate packaging cell line and then transduced into host cells.

    [0265] The DNA insert should be operatively linked to an appropriate promoter. The expression constructs will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation. The coding portion of the mature transcripts expressed by the constructs will preferably include a translation initiating at the beginning and a termination codon (e.g., UAA, UGA or UAG) appropriately positioned at the end of the mRNA to be translated, with UAA and UAG preferred for mammalian or eukaryotic cell expression.

    [0266] Expression vectors will preferably but optionally include at least one selectable marker. Such markers include, e.g., but are not limited to, ampicillin, zeocin (Sh bla gene), puromycin (pac gene), hygromycin B (hygB gene), G418/Geneticin (neo gene), mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos. 5,122,464; 5,770,359; 5,827,739), blasticidin (bsd gene), resistance genes for eukaryotic cell culture as well as ampicillin, zeocin (Sh bla gene), puromycin (pac gene), hygromycin B (hygB gene), G418/Geneticin (neo gene), kanamycin, spectinomycin, streptomycin, carbenicillin, bleomycin, erythromycin, polymyxin B, or tetracycline resistance genes for culturing in E. coli and other bacteria or prokaryotics (the above patents are entirely incorporated hereby by reference). Appropriate culture mediums and conditions for the above-described host cells are known in the art. Suitable vectors will be readily apparent to the skilled artisan. Introduction of a vector construct into a host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection or other known methods. Such methods are described in the art, such as Sambrook, supra, Chapters 1-4 and 16-18; Ausubel, supra, Chapters 1, 9, 13, 15, 16.

    [0267] Expression vectors will preferably but optionally include at least one selectable cell surface marker for isolation of cells modified by the compositions and methods of the disclosure. Selectable cell surface markers of the disclosure comprise surface proteins, glycoproteins, or group of proteins that distinguish a cell or subset of cells from another defined subset of cells. Preferably the selectable cell surface marker distinguishes those cells modified by a composition or method of the disclosure from those cells that are not modified by a composition or method of the disclosure. Such cell surface markers include, e.g., but are not limited to, cluster of designation or classification determinant proteins (often abbreviated as CD) such as a truncated or full length form of CD19, CD271, CD34, CD22, CD20, CD33, CD52, or any combination thereof. Cell surface markers further include the suicide gene marker RQR8 (Philip B et al. Blood. 2014 Aug. 21; 124(8):1277-87).

    [0268] Expression vectors will preferably but optionally include at least one selectable drug resistance marker for isolation of cells modified by the compositions and methods of the disclosure. Selectable drug resistance markers of the disclosure may comprise wild-type or mutant Neo, DHFR, TYMS, FRANCF, RAD51C, GCS, MDR1, ALDH1, NKX2.2, or any combination thereof.

    [0269] At least one protein scaffold of the disclosure can be expressed in a modified form, such as a fusion protein, and can include not only secretion signals, but also additional heterologous functional regions. For instance, a region of additional amino acids, particularly charged amino acids, can be added to the N-terminus of a protein scaffold to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage. Also, peptide moieties can be added to a protein scaffold of the disclosure to facilitate purification. Such regions can be removed prior to final preparation of a protein scaffold or at least one fragment thereof. Such methods are described in many standard laboratory manuals, such as Sambrook, supra, Chapters 17.29-17.42 and 18.1-18.74; Ausubel, supra, Chapters 16, 17 and 18.

    [0270] Those of ordinary skill in the art are knowledgeable in the numerous expression systems available for expression of a nucleic acid encoding a protein of the disclosure. Alternatively, nucleic acids of the disclosure can be expressed in a host cell by turning on (by manipulation) in a host cell that contains endogenous DNA encoding a protein scaffold of the disclosure. Such methods are well known in the art, e.g., as described in U.S. Pat. Nos. 5,580,734, 5,641,670, 5,733,746, and 5,733,761, entirely incorporated herein by reference.

    [0271] Illustrative of cell cultures useful for the production of the protein scaffolds, specified portions or variants thereof, are bacterial, yeast, and mammalian cells as known in the art. Mammalian cell systems often will be in the form of monolayers of cells although mammalian cell suspensions or bioreactors can also be used. A number of suitable host cell lines capable of expressing intact glycosylated proteins have been developed in the art, and include the COS-1 (e.g., ATCC CRL 1650), COS-7 (e.g., ATCC CRL-1651), HEK293, BHK21 (e.g., ATCC CRL-10), CHO (e.g., ATCC CRL 1610) and BSC-1 (e.g., ATCC CRL-26) cell lines, Cos-7 cells, CHO cells, hep G2 cells, P3X63Ag8.653, SP2/0-Ag14, 293 cells, HeLa cells and the like, which are readily available from, for example, American Type Culture Collection, Manassas, Va. (www.atcc.org). Preferred host cells include cells of lymphoid origin, such as myeloma and lymphoma cells. Particularly preferred host cells are P3X63Ag8.653 cells (ATCC Accession Number CRL-1580) and SP2/0-Ag14 cells (ATCC Accession Number CRL-1851). In a particularly preferred embodiment, the recombinant cell is a P3X63Ab8.653 or an SP2/0-Ag14 cell.

    [0272] Expression vectors for these cells can include one or more of the following expression control sequences, such as, but not limited to, an origin of replication; a promoter (e.g., late or early SV40 promoters, the CMV promoter (U.S. Pat. Nos. 5,168,062; 5,385,839), an HSV tk promoter, a pgk (phosphoglycerate kinase) promoter, an EF-1 alpha promoter (U.S. Pat. No. 5,266,491), at least one human promoter; an enhancer, and/or processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites (e.g., an SV40 large T Ag poly A addition site), and transcriptional terminator sequences. See, e.g., Ausubel et al., supra; Sambrook, et al., supra. Other cells useful for production of nucleic acids or proteins of the present invention are known and/or available, for instance, from the American Type Culture Collection Catalogue of Cell Lines and Hybridomas (www.atcc.org) or other known or commercial sources.

    [0273] When eukaryotic host cells are employed, polyadenlyation or transcription terminator sequences are typically incorporated into the vector. An example of a terminator sequence is the polyadenlyation sequence from the bovine growth hormone gene. Sequences for accurate splicing of the transcript can also be included. An example of a splicing sequence is the VP1 intron from SV40 (Sprague, et al., J. Virol. 45:773-781 (1983)). Additionally, gene sequences to control replication in the host cell can be incorporated into the vector, as known in the art.

    Purification of a Protein Scaffold

    [0274] A protein scaffold can be recovered and purified from recombinant cell cultures by well-known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography (HPLC) can also be employed for purification. See, e.g., Colligan, Current Protocols in Immunology, or Current Protocols in Protein Science, John Wiley & Sons, NY, N.Y., (1997-2001), e.g., Chapters 1, 4, 6, 8, 9, 10, each entirely incorporated herein by reference.

    [0275] Protein scaffolds of the disclosure include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, E. coli, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production procedure, the protein scaffold of the disclosure can be glycosylated or can be non-glycosylated. Such methods are described in many standard laboratory manuals, such as Sambrook, supra, Sections 17.37-17.42; Ausubel, supra, Chapters 10, 12, 13, 16, 18 and 20, Colligan, Protein Science, supra, Chapters 12-14, all entirely incorporated herein by reference.

    Variants

    [0276] The amino acids that make up protein scaffolds of the disclosure are often abbreviated. The amino acid designations can be indicated by designating the amino acid by its single letter code, its three letter code, name, or three nucleotide codon(s) as is well understood in the art (see Alberts, B., et al., Molecular Biology of The Cell, Third Ed., Garland Publishing, Inc., New York, 1994). A protein scaffold of the disclosure can include one or more amino acid substitutions, deletions or additions, either from natural mutations or human manipulation, as specified herein. Amino acids in a protein scaffold of the disclosure that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (e.g., Ausubel, supra, Chapters 8, 15; Cunningham and Wells, Science 244:1081-1085 (1989)). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity, such as, but not limited to, at least one neutralizing activity. Sites that are critical for protein scaffold binding can also be identified by structural analysis, such as crystallization, nuclear magnetic resonance or photoaffinity labeling (Smith, et al., J. Mol. Biol. 224:899-904 (1992) and de Vos, et al., Science 255:306-312 (1992)).

    [0277] As used throughout the disclosure, the term substantially complementary refers to a first sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540, or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.

    [0278] As used throughout the disclosure, the term substantially identical refers to a first and second sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.

    [0279] As used throughout the disclosure, the term variant when used to describe a nucleic acid, refers to (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.

    [0280] As used throughout the disclosure, the term vector refers to a nucleic acid sequence containing an origin of replication. A vector can be a viral vector, a bacteriophage, a bacterial artificial chromosome or a yeast artificial chromosome. A vector can be a DNA or RNA vector. A vector can be a self-replicating extrachromosomal vector, and preferably, is a DNA plasmid.

    [0281] As used throughout the disclosure, the term variant when used to describe a peptide or polypeptide, refers to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant can also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity.

    [0282] A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids, as understood in the art (Kyte et al., J. Mol. Biol. 157: 105-132 (1982)). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. Amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ?2 are substituted. The hydrophilicity of amino acids can also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity. U.S. Pat. No. 4,554,101, incorporated fully herein by reference.

    [0283] Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity. Substitutions can be performed with amino acids having hydrophilicity values within ?2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.

    [0284] As used herein, conservative amino acid substitutions may be defined as set out in Tables A, B, or C below. In some embodiments, fusion polypeptides and/or nucleic acids encoding such fusion polypeptides include conservative substitutions have been introduced by modification of polynucleotides encoding polypeptides of the invention. Amino acids can be classified according to physical properties and contribution to secondary and tertiary protein structure. A conservative substitution is a substitution of one amino acid for another amino acid that has similar properties. Exemplary conservative substitutions are set out in Table A.

    TABLE-US-00027 TABLE A Conservative Substitutions I Side chain characteristics Amino Acid Aliphatic Non-polar G A P I L V F Polar - uncharged C S T M N Q Polar - charged D E K R Aromatic H F W Y Other N Q D E

    [0285] Alternately, conservative amino acids can be grouped as described in Lehninger, (Biochemistry, Second Edition; Worth Publishers, Inc. NY, N.Y. (1975), pp. 71-77) as set forth in Table B.

    TABLE-US-00028 TABLE B Conservative Substitutions II Side Chain Characteristic Amino Acid Non-polar (hydrophobic) Aliphatic: A L I V P Aromatic: F W Y Sulfur-containing: M Borderline: G Y Uncharged-polar Hydroxyl: S T Y Amides: N Q Sulfhydryl: C Borderline: G Y Positively Charged (Basic): K R H Negatively Charged (Acidic): D E

    [0286] Alternately, exemplary conservative substitutions are set out in Table C.

    TABLE-US-00029 TABLE C Conservative Substitutions III Original Residue Exemplary Substitution Ala (A) Val Leu Ile Met Arg (R) Lys His Asn (N) Gln Asp (D) Glu Cys (C) Ser Thr Gln (Q) Asn Glu (E) Asp Gly (G) Ala Val Leu Pro His (H) Lys Arg Ile (I) Leu Val Met Ala Phe Leu (L) Ile Val Met Ala Phe Lys (K) Arg His Met (M) Leu Ile Val Ala Phe (F) Trp Tyr Ile Pro (P) Gly Ala Val Leu Ile Ser (S) Thr Thr (T) Ser Trp (W) Tyr Phe Ile Tyr (Y) Trp Phe Thr Ser Val (V) Ile Leu Met Ala

    [0287] It should be understood that the polypeptides of the disclosure are intended to include polypeptides bearing one or more insertions, deletions, or substitutions, or any combination thereof, of amino acid residues as well as modifications other than insertions, deletions, or substitutions of amino acid residues. Polypeptides or nucleic acids of the disclosure may contain one or more conservative substitution.

    [0288] As used throughout the disclosure, the term more than one of the aforementioned amino acid substitutions refers to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more of the recited amino acid substitutions. The term more than one may refer to 2, 3, 4, or 5 of the recited amino acid substitutions.

    [0289] Polypeptides and proteins of the disclosure, either their entire sequence, or any portion thereof, may be non-naturally occurring. Polypeptides and proteins of the disclosure may contain one or more mutations, substitutions, deletions, or insertions that do not naturally-occur, rendering the entire amino acid sequence non-naturally occurring. Polypeptides and proteins of the disclosure may contain one or more duplicated, inverted or repeated sequences, the resultant sequence of which does not naturally-occur, rendering the entire amino acid sequence non-naturally occurring. Polypeptides and proteins of the disclosure may contain modified, artificial, or synthetic amino acids that do not naturally-occur, rendering the entire amino acid sequence non-naturally occurring.

    [0290] As used throughout the disclosure, sequence identity may be determined by using the stand-alone executable BLAST engine program for blasting two sequences (bl2seq), which can be retrieved from the National Center for Biotechnology Information (NCBI) ftp site, using the default parameters (Tatusova and Madden, FEMS Microbiol Lett., 1999, 174, 247-250; which is incorporated herein by reference in its entirety). The terms identical or identity when used in the context of two or more nucleic acids or polypeptide sequences, refer to a specified percentage of residues that are the same over a specified region of each of the sequences. The percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thymine (T) and uracil (U) can be considered equivalent. Identity can be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.

    EXAMPLES

    Example 1: Production of Stem-Like Modified T-Cells

    [0291] The following is an illustrative but nonlimiting example of one protocol for modifying T cells to express a chimeric antigen receptor (CAR) under conditions that induce or preserve desirable stem-like properties of the T cells.

    [0292] Day 0: Nucleofection of T Cells

    [0293] Pre-warm ImmunoCult?-XF T cell expansion medium (Stemcell Technologies, Cat #: 10981) in 37? C., 5% CO.sub.2, high humidity incubator. For 5?10.sup.6 T cells/reaction (100 ?L cuvette size) warm 3 mL of media/reaction in a single well of a 6-well plate. For 25?10.sup.6 T cells/reaction (100 ?L cuvette size) warm 20 mL of media/reaction in a G-Rex10 (Wilson Wolf, Cat #: 80040S).

    [0294] Warm P3 primary cell solution (Lonza, Cat #: PBP3-02250) up to room temperature and add supplement if necessary.

    [0295] Turn on the core unit (Lonza, Cat #: AAF-1002B) of the 4D-Nucleofector? System, which controls the X-unit (Lonza, Cat #: AAF-1002X). Program the number of nucleofections required to use P3 buffer. Program EO-210.

    [0296] Label cuvettes, pre-open transfer pipettes (supplied with the Lonza P3 kit), and prepare proper dilutions of nucleic acids prior to working with the cells.

    [0297] For a transposon plasmid, make a 0.5 ?g/?L solution in nuclease free H.sub.2O.

    [0298] Count CD14, CD56, and CD19 depleted cells collected using the CliniMACs Prodigy and calculate the volume needed for the required cell number.

    [0299] Centrifuge T cells at 90 g for 10 minutes with brake at 7 on a Heraeus Multifuge X3R benchtop centrifuge (Thermofisher Scientific). If performing multiple reactions using the same number of cells/reaction, centrifuge all the necessary cells in a single centrifuge tube. Either a 15 mL (Fisher, Cat #: 14-959-49B) or 50 mL (Fisher, Cat #: 14-959-49A) conical tube can be used depending on volume. During centrifugation add nucleic acids directly to the bottom of cuvettes that come with the P3 primary cell solution box (Lonza, Cat #: PBP3-02250). Add 2 ?L of the 0.5 ?g/?L transposon plasmid solution made in step 4 for a total of 1 ?g transposon to one of the bottom corners of the cuvette. Add 5 ?g of Super piggyBac? (SPB) transposase mRNA to the other corner of the cuvette.

    [0300] Because mRNA can be rapidly degraded, it is optimal to minimize the time it is in contact with other nucleic acid solutions and with cells prior to electroporation due to the potential presence of RNases. This is why, for example, the transposon and transposase are delivered to opposite corners of the cuvette to prevent mixing. In addition, it is optimal to keep the total volume of nucleic acids under 10 ?L (10%) of the total reaction volume.

    [0301] The amount of both transposon (1 ?g) and transposase (5 ?g) stays the same regardless of the number of cells/reaction. Transposition efficiencies remain unchanged between 5?10.sup.6 cells/100 ?L reaction and 25?10.sup.6 cells/100 ?L reaction.

    [0302] Following centrifugation, completely aspirate off the media without disturbing the cell pellet.

    [0303] Suspend the cell pellet in 100 ?L of room temperature P3 buffer containing the supplement/reaction.

    [0304] Transfer 100 ?L of cells in P3 buffer to a cuvette containing the appropriate nucleic acids, optimally, taking care not to introduce any air bubbles into the solution. It is recommended that only up to 2 cuvettes should loaded with cells at a time. After the addition of cells to the cuvette, it is optimal to work quickly and efficiently to reduce contact time of mRNA with cells prior to nucleofection. While no decrease in transposition efficiency has observed for cells resting in P3 buffer for up to 10 minutes, it is recommended to minimize the amount of time cells remain in P3.

    [0305] Mix the contents of the cuvette by flicking several times and load up to two cuvettes into the 4D-Nucleofector? X-unit.

    [0306] Pulse the cells with program EO-210 and ensure there was no error recorded by the machine.

    [0307] Immediately transfer the nucleofected cells into either the 6-well plate or G-Rex10 using the transfer pipettes provided with the Lonza P3 kit. To transfer the cells, first draw up a small amount of pre-warmed media into the transfer pipette from either the 6-well plate or the G-Rex flask. Then pipette the media into the cuvette and transfer the entire contents of the cuvette using the pipette into the final culture dish. It is recommended not to pipette the cells up and down in either the cuvette or the final culture dish.

    [0308] Repeat protocol from the transfer of cells in P3 buffer to a cuvette containing the appropriate nucleic acids through the mixing, pulsing, and transfer of the nucleofected cells into either the 6-well plate or G-Rex10 for any remaining reactions.

    [0309] Place cells in incubator at 37? C., 5% CO.sub.2, high humidity.

    [0310] Day 2: T Cell Activation

    [0311] Add 25 ?L/mL of ImmunoCult? Human CD3/CD28/CD2 T cell Activator (Stemcell Technologies, Cat #: 10970) to the nucleofected cells.

    [0312] Mix cells gently by pipetting.

    [0313] Place cells back into the incubator at 37? C., 5% CO.sub.2, high humidity.

    [0314] For Cells being Grown in G-Rex Flask:

    [0315] It is essential not to disturb the cultures until visible cell clumping is observed. Thus, it is recommended to separate the media additions and changes from the disruption/mixing/pipetting of the cells.

    [0316] Culture Media Notes:

    [0317] For growing cells in the G-Rex flask, media addition and/or changes should be done based off of glucose and other metabolite levels. If the glucose level (or another indicating metabolite) falls to a critical level (?100 mg/dL of glucose, for example) media volume should be doubled and/or replenished by a half-media change using pre-warmed ImmunoCult?-XF T cell expansion medium. Media addition should be performed slowly and care taken to disrupt the cells as little as possible. Half media changes should be performed at least 12 hours post mechanical disruption of the cell culture to allow the cells to fully settle to the bottom of the culture flask.

    [0318] Cell Sampling and Disruption:

    [0319] Cells should be left undisturbed during much of the culture period.

    [0320] The first disruption of the cell culture following activation reagent addition should occur once large visible aggregates of cells have formed (aggregates will measure 3-4 squares by 3-4 squares of the grid that can be seen on the G-Rex membrane).

    [0321] Once cell aggregates have reached the required size, they can be mechanically disrupted using a 10 mL serological pipette. This time point may occur between 11-14 days depending on donor and transposition efficiency. In certain circumstances, this time point may occur closer to day 14 than day 11, for example, when using a manual cassette, a large volume and/or a large cell number for nucleofection. A sampling of cells should be collected at this point for cell counts, viability, and flow analysis. Ideally the volume of culture medium at this point will have no more than doubled from the initial volume used (200 mL for a G-Rex100). It is recommended to collect all of the cells needed at once so that the cells do not need to be disturbed again.

    [0322] Once the cells have been disrupted they should be left undisturbed for 12 hours in the same volume of media they started in. Cells should re-aggregate at this point; however, the aggregates will be smaller and more numerous. These aggregates should measure 1-2 squares by 1-2 squares on the G-Rex membrane grid.

    [0323] Three days following the first disruption (day 14-17 depending on the culture) of the cells they can be pipetted a second time. Samples should be taken again for cell counts, viability, and flow cytometry. Once again the cells should be left undisturbed for at least 12 hours post sampling. It is recommended to collect all of the cells needed at once so that the cells do not need to be disturbed again.

    [0324] Following this second disruption, the cells will likely not form any clumps and the rate of cell growth will slow considerably.

    [0325] Cell harvest should be performed 3 days after the second disruption of cells between day 17 and day 20 of the culture.

    [0326] Flow Cytometry

    [0327] Flow should be run on Day 5, D-Day, D-Day+3, and D-Day+6.

    [0328] For Day 5, D-Day, and D-Day+3 use the CD45, CD4, CD8, and CARTyrin flow panel

    [0329] For D-Day+6, there are 3 target panels:

    a. Panel 1: CD3, CD8, CD4, CARTyrin, CD45RA, CD45RO, CD62L
    b. Panel 2: CD3, CD8, CD4, CARTyrin, CD25, CXCR4, PD-1
    c. Panel 3: CD45, CD14, CD20, CD56, CD8, CD4, CD3

    Example 2: Functional Characterization of CARTyrin+ Stem Memory T Cells

    [0330] CARTyrins of the disclosure may be introduced to T cells using a plasmid DNA transposon encoding the CARTyrin that is flanked by two cis-regulatory insulator elements to help stabilize CARTyrin expression by blocking improper gene activation or silencing.

    [0331] In certain embodiments of the methods of the disclosure, the piggyBac? (PB) Transposon System may be used for stable integration of antigen-specific (including cancer antigen-specific) CARTyrin into resting pan T cells, whereby the transposon was co-delivered along with an mRNA transposase enzyme, called Super piggyBac? (SPB), in a single electroporation reaction. Delivery of piggyBac? transposon into untouched, resting primary human pan T cells resulted in 20-30% of cells with stable integration and expression of PB-delivered genes. Unexpectedly, a majority of these modified CARTyrin-expressing T cells were positive for expression of CD62L and CD45RA, markers commonly associated with stem memory T-cells (T.sub.SCM cells). To confirm that this phenotype was retained upon CAR-T cell stimulation and expansion, the modified CARTyrin-expressing T cells positive for expression of CD62L and CD45RA were activated via stimulation of CD3 and CD28. As a result of stimulation of CD3 and CD28, >60% of CARTyrin+ T cells exhibited a stem-cell memory phenotype. Furthermore, these cells, which expressed a CARTyrin specific for a cancer antigen, were fully capable of expressing potent anti-tumor effector function.

    [0332] To determine whether or not the PB system directly contributed to enhancing the expression of stem-like markers, the phenotype of CAR-T cells generated either by PB transposition or lentiviral (LV) transduction was compared. To do this, a new vector was constructed by subcloning the CARTyrin transgene into a common LV construct for production of virus. Following introduction of the CARTyrin to untouched resting T cells either by PB-transposition or LV-transduction, the CARTyrin.sup.+ cells were expanded and then allowed to return to a resting state. A variety of phenotypic and functional characteristics were measured including kinetic analysis of memory and exhaustion-associated markers, secondary proliferation in response to homeostatic cytokine or tumor-associated Ag, cytokine production, and lytic capability in response to target tumor cells. Unlike the PB-transposed CARTyrin.sup.+ T cells, the LV-transduced CARTyrin.sup.+ T cells did not exhibit an augmented memory phenotype. In addition, PB-transposed cells exhibited a comparable or greater capability for secondary proliferation and killing of target tumor cells. Together, these data demonstrate that CAR-T cells produced by PB transposition are predominantly T.sub.SCM cells, a highly desirable product phenotype in the CAR-T field. Furthermore, these CARTyrin T cells exhibit strong anti-tumor activity and may give rise to cells that persist longer in vivo due to the use of a Centyrin-based CAR, which may be less prone to tonic signaling and functional exhaustion.

    Example 3: Sleeping Beauty Transposition Yields Predominantly T.SUB.SCM .Phenotype

    [0333] Sleeping Beauty (SB100x) Transposition yielded a predominately T.sub.SCM phenotype using the methods of the disclosure. Human pan T cells were transposed using 1 ?g of either a Sleeping Beauty or piggyBac transposon plasmid and SB100x or SPB mRNA, respectively as shown in FIG. 10. Following transposition, cells were expanded ex vivo and all non-transposed cells were depleted using a drug selection system. Following 18 days in culture, cells were stained with the phenotypic markers CD4, CD8, CD45RA, and CD62L. Stem cell memory phenotype (T.sub.SCM) is defined by CD45RA and CD62L double positive cells and make up >65% of the cells in all of samples.

    Example 4: Expression of Factor IX in Modified T-Cells

    [0334] Genetic deficiencies in Factor IX (FIG. 11) lead to a life threatening disease called Hemophila B. Hemophila B is a rare disease that affects 1 in 25,000 to 1 in 30,000 people. Current Hemophilia B treatments involve an infusion of recombinant Factor IX protein every 2-3 days, at a cost of around $250,000 per year.

    [0335] Stem memory T cells (T.sub.SCM cells) are maintained in humans for several decades, and are therefore an ideal vehicle to secrete Factor IX, supplying the Factor IX missing in Hemophilia B patients without the need for frequent transfusions. T cells were transformed with PiggyBac to secrete Factor IX. When transgenic T cells encoding a human Factor IX transgene were examined for T and T.sub.SCM cell markers using FACS, approximately 80% of all cells showed a T.sub.SCM phenotype (FIG. 12). These modified T cells were able to secrete human Factor IX (FIG. 13A), and this secreted Factor IX provided clotting activity (FIG. 13B).

    INCORPORATION BY REFERENCE

    [0336] Every document cited herein, including any cross referenced or related patent or application is hereby incorporated herein by reference in its entirety unless expressly excluded or otherwise limited. The citation of any document is not an admission that it is prior art with respect to any invention disclosed or claimed herein or that it alone, or in any combination with any other reference or references, teaches, suggests or discloses any such invention. Further, to the extent that any meaning or definition of a term in this document conflicts with any meaning or definition of the same term in a document incorporated by reference, the meaning or definition assigned to that term in this document shall govern.

    Other Embodiments

    [0337] While particular embodiments of the disclosure have been illustrated and described, various other changes and modifications can be made without departing from the spirit and scope of the disclosure. The scope of the appended claims includes all such changes and modifications that are within the scope of this disclosure.