METHOD FOR PROMOTING MUSCLE REGENERATION
20190111071 ยท 2019-04-18
Inventors
- Amelia Eva Aranega Jimenez (Jaen, ES)
- Diego Franco Jaime (Jaen, ES)
- Francisco Hernandez Torres (Jaen, ES)
- Estefania Lozano Velasco (Jaen, ES)
- Daniel Vallejo Pulido (Jaen, ES)
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61P21/00
HUMAN NECESSITIES
A61K31/7105
HUMAN NECESSITIES
C12N2310/113
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
C12N2740/10041
CHEMISTRY; METALLURGY
C12N2750/14141
CHEMISTRY; METALLURGY
C12N2710/10041
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
A61K31/7105
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
Abstract
The invention solves the problem of providing new therapies that are effective in the treatment of muscular dystrophies through the use of compositions comprising a compound capable of reducing the expression of miRNA-106b in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells.
Claims
1. A method of promoting muscle regeneration in a human or animal subject, the method comprising administering to the subject an effective amount of a composition comprising a compound that is capable of reducing; the expression of miRNA-106b in muscle, satellite stem cells.
2. The method according to claim 1, wherein said compound is selected from the group consisting of: a. an interfering RNA (siRNA) of miRNA-106b; b. an antisense RNA oligonucleotide of miRNA-106b; c. the miRNA inhibitor hsa-miR-106b-5p ID: MH10067, Cat: 4464084; and (d) a polynucleotide comprising or consisting of a nucleotide sequence identical by at least 90% to the nucleotide sequence of the hsa-miR-106b-5p ID: MH10067; Cat: 4464084, wherein the polynucleotide is capable of inhibiting miR-106b.
3. The method according to claim 2, wherein said compound is selected from (c) or (d).
4. The method according to claim 1, wherein said compound is comprised in a vector or plasmid capable of transporting or delivering said compound to muscle satellite stem cells.
5. The method according to claim 4, wherein said vector is a viral vector.
6. The method according to claim 5, wherein said viral vector is selected from: (a) an adenoviral vector; (b) a lentiviral vector; (c) a retroviral vector; and (d) an adeno-associated vector.
7. The method according to claim 1, wherein said compound comprises a muscle satellite stem cell of a human or animal subject that was treated, transformed, transfected or transduced with: (a) an interfering RNA (siRNA) of miRNA-106b; (b) an antisense RNA oligonucleotide of miRNA-106b; (c) the miRNA inhibitor hsa-miR-106b-5p ID: MH10067; Cat.: 4464084; (d) a polynucleotide comprising or consisting of a nucleotide sequence identical by at least 90% to the nucleotide sequence of the hsa-miR-106b-5p ID: MH10067; Cat: 4464084, wherein the polynucleotide is capable of inhibiting miR-106b.
8. The method according to claim 1, wherein said subject has a dystrophinopathy.
9. The method according to claim 8, wherein said dystrophinopathy is selected from Duchenne muscular dystrophy and Becker muscular dystrophy.
10. The method according to claim 1, wherein said subject is a human subject and wherein said composition is administered intramuscularly.
11. The method according to claim 10, wherein said composition is administered intramuscularly in a lower limb of said human subject.
12. The method according to claim 3, wherein said subject is a human subject and wherein said composition is administered intramuscularly in a lower limb of said human subject.
13. The method according to claim 10, wherein said human subject suffers from a dystrophinopathy.
14. The method according to claim 13, wherein said dystrophinopathy is selected from Duchenne muscular dystrophy and Becker muscular dystrophy.
15. The method according to claim 7, wherein said muscle satellite stem cell was treated, transformed, transfected or transduced with a vector or a plasmid comprising any one of (a)-(d).
16. The method of claim 15, wherein said muscle satellite stem cell was treated, transformed, transfected or transduced with a viral vector comprising any one of (a)-(d).
17. The method of claim 16, wherein said viral vector is selected from an adenoviral vector, a lentiviral vector, a retroviral vector, or an adeno-associated vector.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
DETAILED DISCLOSURE OF THE INVENTION
[0021] Definitions
[0022] As used in the specification and the attached claims, the term muscle satellite stem cells of a human or animal subject constitutes a small, scattered population of mitotically and physiologically quiescent cells, labeled by their expression of transcription factor Pax7 (
[0023] As used in the specification and the attached claims, the term miRNA-106b preferably refers to the single-stranded RNA Ensembl:ENSG00000208036 MIM:612983; miRBase:MI0000734, or to a polynucleotide sequence of RNA having a nucleotide sequence identical by at least 90%, 92%, 94%, 96%, 98% or 99%, based on the identity of all the nucleotides of said sequence, to the nucleotide sequence Ensembl:ENSG00000208036 MIM:612983; miRBase:MI0000734, preferably, a polynucleotide sequence of RNA having a nucleotide sequence identical by at least 90%, 92%, 94%, 96%, 98% or 99%, based on the identity of all the nucleotides of said sequence, to the nucleotide sequence Ensembl:ENSG00000208036 MIM:612983; miRBase:MI0000734, and having the function of regulating the expression of other genes using the ribo-interference pathway.
[0024] As used in the specification and the attached claims, the term miRNA inhibitor hsa-miR-106b-5p (ID: MH10067; Cat: 4464084, Ambion) refers to a nucleotide sequence of single-strand RNA chemically modified and designed for specifically binding to and inhibiting endogenous molecules of miR-106b.
[0025] As used in the specification and the attached claims, the term Pitx2 gene is a member of the family of bicoid homeobox transcription factors which plays a relevant role in morphogenesis (reference polynucleotide sequence in Genbank with accession number NM_000325, identifying Homo sapiens paired-like homeodomain 2 (PITX2))
[0026] The term increase or increasing refers to increases above the basal level. For example, basal levels are normal at in vivo levels before, or in the absence of, the addition of an activating compound.
[0027] The term reduction or reducing or inhibiting or inhibition refers to reductions below the basal level. For example, basal levels are normal at in vivo levels before, or in the absence of, the addition of an inhibitory compound.
[0028] In this specification and in the claims that follow, reference will be made to a number of terms that are defined to have the following meanings:
[0029] Optional or optionally means that the described event or circumstance subsequently may or may not occur, and that the description includes cases in which said event or circumstance occurs and cases in which it does not.
[0030] As it is used herein, the terms prevent, preventing and prevention refer to the methods for avoiding or impeding the development of a disease or disorder or delaying the recurrence or the onset of one or more symptoms of a disorder in a subject resulting from the administration of a prophylactic agent.
[0031] The term pharmaceutically acceptable carrier intends to include the formulation used to stabilize, solubilize and be mixed in some way with active ingredients that are administered to living animals, including human beings. This includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, which are compatible with the pharmaceutical dosage form. Except where any conventional medium or agent is incompatible with the active compound, such use in compositions is contemplated.
[0032] As it is used herein, the term disease is generally intended to be synonymous to, and used interchangeably with the terms disorder and condition (as in medical condition), in that they all reflect an abnormal condition of the body or of one of its parts that jeopardizes normal functioning and typically presents through distinctive signs and symptoms.
[0033] The term combination therapy means the administration of two or more therapeutic agents for treating a therapeutic condition or disorder described in the present description. Said administration encompasses the co-administration of these therapeutic agents in a substantially simultaneous manner, such as in a single capsule having a set active ingredient ratio or in multiple individual capsules for each active ingredient. Furthermore, such administration also encompasses the sequential use of each type of therapeutic agent. In any case, the treatment regimen will provide beneficial effects from combining compounds in the treatment of conditions or disorders described in the present.
[0034] The expression therapeutically effective intends to describe the amount of active ingredients used in the treatment of a disease or disorder. This amount will be the amount necessary for achieving the objective of reducing or eliminating said disease or disorder.
[0035] The term subject refers to all mammals, including human beings. Examples of subjects include, but are not limited to, human beings, cows, dogs, cats, goats, sheep, pigs, and rabbits.
[0036] Throughout this application, reference is made to various publications. The descriptions of these publications are incorporated herein in their entirety by reference for the purpose of describing the state of the art to which it belongs more thoroughly. The described references are also individually and specifically incorporated herein as a reference because of the material contained therein, which is discussed in the phrase on which said reference is based.
DESCRIPTION OF THE INVENTION
[0037] The present invention deals with the problem of providing new therapies that are effective in the treatment of muscular dystrophies, increasing the ability of skeletal muscle stem cells to regenerate tissue that is lost as a result of the muscular dystrophy.
[0038] For this purpose the authors of the present invention have evaluated the contribution of the Pitx2 gene in the regulation of the tissue-specific transcription of different microRNAs during myogenesis. The analysis of gene expression profiles (microRNA-microarrays) in a myoblast cell line (Sol8 cell line) has led the authors of the present invention to identify a series of microRNAs (miRNAs) that are differentially regulated into Sol8 myoblasts overexpressing Pitx2 (see
[0039] Additionally, these results demonstrate that reducing the expression of miRNA-106b in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells enlarges the satellite cell-derived myoblast population during regenerative myogenesis differentiation processes (see
[0040] Finally, treadmill tests to exhaustion were conducted in DMD/mdx mice injected with anti-miR106b compound 30 days after treatment with anti-miR-106b compound. As illustrated in
[0041] When considered together, the results showed that miR-106b plays a key role during the muscle regeneration process in mice. Furthermore, the data herein presented demonstrated that the intramuscular injection of anti-miR-106b compound can improve the ability of regeneration in DMD mice.
[0042] Accordingly, a first aspect of the present invention relates to the use of a composition (hereinafter composition of the present invention) comprising a compound capable of [0043] increasing the expression of the Pitx2 gene, activating compound, in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells; and/or [0044] reducing the expression of miRNA-106b, inhibitory compound, in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells;
for preparing a drug for promoting muscle regeneration.
[0045] Alternatively, the first aspect of the invention relates to a composition comprising a compound capable of [0046] increasing the expression of the Pitx2 gene, activating compound, in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells; and/or [0047] reducing the expression of miRNA-106b, inhibitory compound, in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells;
for use in promoting muscle regeneration.
[0048] Increasing the expression of the Pitx2 gene is understood as the increase with respect to the baseline, or compared to a control, by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 , 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40 , 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65 , 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90 , 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, or more times.
[0049] The activating compounds can be identified by means of a screening method that allows identifying in a compound the ability of activating Pitx2, which comprises putting a cell, preferably a muscle satellite stem cell, in contact with a compound suspected of being able to activate Pitx2; testing the content of the cells to determine the amount and/or biological activity of Pitx2 and to compare the determined amount and/or biological activity of Pitx2 with a pre-determined level, in which a change in said amount and/or biological activity of Pitx2 is indicative of a compound activating Pitx2. In a preferred embodiment, detection is performed by means of real-time quantitative RT-PCR using primers specific for each isoform.
[0050] In the context of the present invention, muscle satellite stem cells are understood as stem cells, or muscle pre-cells, which serve to aid the regeneration of adult skeletal muscle. As a result of proliferation (when the satellite cells are activated) and subsequent differentiation (when they start to express transcription factors that commit them to a myogenic (myoblast) line), the satellite cells fuse to one another or with adjacent damaged muscle fibers, which increases the number of myonueclei in fibers for growth and repair. Satellite cell activation and proliferation is necessary for the purpose of meeting the needs of forming new muscle fibers to regenerate muscle. The differentiation is necessary so that satellite cells can first be converted to myoblasts and to fibers after the fusion process.
[0051] A preferred embodiment of the first aspect of the invention relates to the use of the composition of the invention, where said drug is used for promoting muscle regeneration in the treatment of a dystrophinopathy or dystrophy, preferably, where said dystrophinopathy or dystrophy is selected from the list consisting of Duchenne muscular dystrophy and Becker muscular dystrophy.
[0052] Another preferred embodiment of the first aspect of the invention or of any of its preferred embodiments relates to the use of the composition of the invention, where said compound, activating compound, is a polynucleotide of DNA (hereinafter polynucleotide of the invention) comprising a sequence selected from the list consisting of: [0053] the polynucleotide sequence in Genbank with accession number NM_000325, or its complementary sequence; [0054] a sequence selectively hybridizing with the sequence of (a); and [0055] a polynucleotide sequence of DNA coding for an amino acid sequence identical by at least 90%, 92%, 94%, 96%, 98% or 99% based on the identity of all the amino acids of said sequence, to the amino acid sequence in Genbank with accession number NP_000316.
[0056] In the context of the present invention, the polynucleotide sequence in Genbank with accession number NM_000325 (SEQ ID NO 1) is identified as Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant 3, mRNA. Said nucleotide sequence is provided below:
TABLE-US-00001 GTTAGGCCAACAGGGAAGCGCGGAGCCGCAGATCTGGTCCGTCGCTCGCC TGGGTGCCTGGAGCTGAGCTGCGGCAAGGCCCGGCTCCTGTTCGACCGCC CGAGGGGTGTGCGTGTGCGCGTTGCGGAGGGTGCGCTCAGAGGGCCGCGT CGTGGCTGCAGCGGCTGCTGCCGCCGCAGGGGATCTAATATCACCTACCT GTCCCTGTCACTCTTGACACTTCTCTGTCAGGGCTGCCGCGTGGGGGGGG GGCGGGCAGAGCGCGGTCGGCGTTAGCTTTCCTTATTGGAGGGGTTCTTG GGGGAGGGAGGGAGAGAAGAAGGGGGTCTTTGCCCACTCTTGTTTCGCTT TGGAGCTTGGAAGCCTGCTCCCTAAAGACGCTCTGAGTGGTGCCCTTCTG CCCACATCCCATGTCTTCGTTTGCCCGCTGACTTTCCGTCTCCGGACTTT TTCGCTTGAGCCTTCCGGAGGAGACGGGGGCAGCTTGGCTTGAGAACTCG GCGGGGGTTGCGTCCCCTGGCTCTCCCCGCAGCGGGGAAACTCCGCGCCT AGAGCGCGACCCGGAGCGGGCAGCGGCGGCTACGGGGGCTCGGCGGGGCA GTAGCCAAGGACTAGTAGAGCGTCGCGCTCCCTCGTCCATGAACTGCATG AAAGGCCCGCTTCACTTGGAGCACCGAGCAGCGGGGACCAAGCTGTCGGC CGTCTCCTCATCTTCCTGTCACCATCCCCAGCCGTTAGCCATGGCTTCGG TTCTGGCTCCCGGTCAGCCCCGGTCGCTGGACTCCTCCAAGCACAGGCTG GAGGTGCACACCATCTCCGACACCTCCAGCCCGGAGGCCGCAGAGAAAGA TAAAAGCCAGCAGGGGAAGAATGAGGACGTGGGCGCCGAGGACCCGTCTA AGAAGAAGCGGCAAAGGCGGCAGCGGACTCACTTTACCAGCCAGCAGCTC CAGGAGCTGGAGGCCACTTTCCAGAGGAACCGCTACCCGGACATGTCCAC ACGCGAAGAAATCGCTGTGTGGACCAACCTTACGGAAGCCCGAGTCCGGG TTTGGTTCAAGAATCGTCGGGCCAAATGGAGAAAGAGGGAGCGCAACCAG CAGGCCGAGCTATGCAAGAATGGCTTCGGGCCGCAGTTCAATGGGCTCAT GCAGCCCTACGACGACATGTACCCAGGCTATTCCTACAACAACTGGGCCG CCAAGGGCCTTACATCCGCCTCCCTATCCACCAAGAGCTTCCCCTTCTTC AACTCTATGAACGTCAACCCCCTGTCATCACAGAGCATGTTTTCCCCACC CAACTCTATCTCGTCCATGAGCATGTCGTCCAGCATGGTGCCCTCAGCAG TGACAGGCGTCCCGGGCTCCAGTCTCAACAGCCTGAATAACTTGAACAAC CTGAGTAGCCCGTCGCTGAATTCCGCGGTGCCGACGCCTGCCTGTCCTTA CGCGCCGCCGACTCCTCCGTATGTTTATAGGGACACGTGTAACTCGAGCC TGGCCAGCCTGAGACTGAAAGCAAAGCAGCACTCCAGCTTCGGCTACGCC AGCGTGCAGAACCCGGCCTCCAACCTGAGTGCTTGCCAGTATGCAGTGGA CCGGCCCGTGTGAGCCGCACCCACAGCGCCGGGATCCTAGGACCTTGCCG GATGGGGCAACTCCGCCCTTGAAAGACTGGGAATTATGCTAGAAGGTCGT GGGCACTAAAGAAAGGGAGAGAAAGAGAAGCTATATAGAGAAAAGGAAAC CACTGAATCAAAGAGAGAGCTCCTTTGATTTCAAAGGGATGTCCTCAGTG TCTGACATCTTTCACTACAAGTATTTCTAACAGTTGCAAGGACACATACA CAAACAAATGTTTGACTGGATATGACATTTTAACATTACTATAAGCTTGT TATTTTTTAAGTTTAGCATTGTTAACATTTAAATGACTGAAAGGATGTAT ATATATCGAAATGTCAAATTAATTTTATAAAAGCAGTTGTTAGTAATATC ACAACAGTGTTTTTAAAGGTTAGGCTTTAAAATAAAGCATGTTATACAGA AGCGATTAGGATTTTTCGCTTGCGAGCAAGGGAGTGTATATACTAAATGC CACACTGTATGTTTCTAACATATTATTATTATTATAAAAAATGTGTGAAT ATCAGTTTTAGAATAGTTTCTCTGGTGGATGCAATGATGTTTCTGAAACT GCTATGTACAACCTACCCTGTGTATAACATTTCGTACAATATTATTGTTT TACTTTTCAGCAAATATGAAACAAATGTGTTTTATTTCATGGGAGTAAAA TATACTGCATACAAAAAAAAAAAAAAAAAAAAAAAAA
[0057] In the context of the present invention, the amino acid sequence with accession number NP_000316 (SEQ ID NO 2) is identified as pituitary homeobox 2 isoform c [Homo sapiens]. Said amino acid sequence is provided below:
TABLE-US-00002 MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSS KHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFT SQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKR ERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKS FPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLN NLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSS FGYASVQNPASNLSACQYAVDRPV
[0058] In the context of the present invention, the degree of identity of an amino acid sequence is based on the identity of all the amino acids of said sequence.
[0059] In this embodiment of the invention, synthetic or modified nucleotides can be included among the polynucleotides of the invention. A number of different polynucleotide modification types are known in the art. These include methylphosphate and phosphorothioate main chains, addition of acridine or polylysine chains at the 3 and 5 ends of the molecule. For the purposes of the present invention, it must be understood that the polynucleotides described herein can be modified by any method available in the art.
[0060] The polynucleotides according to the invention can be produced in a recombinant manner, in a synthetic manner or by means available for the persons skilled in the art. They can also be cloned by standard techniques. The polynucleotides are typically provided in an isolated and/or purified form.
[0061] Another preferred embodiment of the first aspect of the invention or of any of its preferred embodiments relates to the use of the composition of the invention, where the compound is a polynucleotide of DNA comprising a sequence selected from the list consisting of the polynucleotide sequence with accession number NM_000325 (SEQ ID NO 1), or its complementary sequence or a polynucleotide sequence coding for an amino acid sequence identical by at least 99%, based on the identity of all the amino acids of said sequence, to the amino acid sequence with accession number NP_000316.
[0062] In an additional preferred aspect of the invention, the polynucleotides of the invention, such as those described above, can be transported, without degradation, by plasmid or viral vectors including an promoter of expression of the nucleic acid in the cells in which is delivered.
[0063] Therefore, in an additional embodiment of the invention, the activating compounds of the invention can comprise any of the polynucleotides of the invention described above or a plasmid or a vector capable of transporting or delivering said polynucleotides, preferably by means of a viral vector.
[0064] The viral vectors are, for example, adenoviruses, adeno-associated viruses, herpes virus, vaccinia virus, polio virus, AIDS virus, neuronal trophic virus, Sindbis virus and other RNA viruses, including viruses with the structure of HIV. Viral families sharing the properties of these viruses, making them suitable for use as vectors, are also preferred. Retroviruses are Moloney murine leukemia virus, MMLV, and retroviruses expressing the desirable properties of MMLV as a vector. Retroviral vectors are capable of carrying a larger genetic payload, i.e., a marker gene or transgene, than other viral vectors, and for this reason they are commonly used. However, they are not as useful in non-proliferative cells. Adenovirus vectors are relatively stable and easy to work with, have high titrations and can be sent in an aerosol formulation, and they can transfect cells that do not divide. Smallpox viral vectors are large and have several sites for gene insertion, are heat-stable and can be stored at room temperature. A preferred embodiment is a viral vector that has been designed for the purpose of suppressing the immune response of the host organism, caused by viral antigens.
[0065] The activating compounds can comprise, in addition to the described polynucleotides of the invention, plasmids or vectors or the peptides of the invention, for example, lipids such as liposomes, such as cationic liposomes (for example, DOTMA, DOPE, DC-cholesterol) or anionic liposomes.
[0066] The liposomes can further comprise proteins to facilitate cell-targeting in particular, if desired. The administration of a composition comprises a compound and a cationic liposome which can be administered in blood flowing into a target organ. Furthermore, the activator can be administered as a component of a microcapsule which can target specific cells types, such as cardiomyocytes, or where diffusion of the compound or administration of the compound of the microcapsule is designed for a specific type or dose.
[0067] Therefore, another preferred embodiment of the first aspect of the invention or of any of its preferred embodiments relates to the use of the composition of the invention, in which said compound is a vector or plasmid capable of transporting or delivering the sequence of polynucleotides, as defined in the context of the present invention, to muscle satellite stem cells. Preferably, said vector is a viral vector coding for the sequence of polynucleotides as defined above. More preferably, said viral vector is selected from the list consisting of adenoviral, lentiviral, retroviral and adeno-associated vectors.
[0068] Another preferred embodiment of the first aspect of the invention or of any of its preferred embodiments relates to the use of the composition of the invention, in which said drug comprises muscle satellite stem cells of a human or animal subject treated, transformed, transfected or transduced with the compound defined in the first aspect of the invention or in any of its preferred embodiments. Preferably, said cells treated, transformed, transfected or transduced with the compound are autologous cells. More preferably, said cells transformed, transfected or transduced with the compound are muscle satellite stem cells of a human subject suffering from a dystrophinopathy or a dystrophy.
[0069] In addition and as discussed above, reducing the expression of miRNA-106b in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells enlarges the satellite cell-derived myoblast population during regenerative myogenesis differentiation processes. It is important to specify that said reduction must take place in muscle satellite stem cells of a human or animal subject, i.e., in those cells located between the basal lamina and the sarcolemma of skeletal muscle labeled by the expression of transcription factor Pax7 and from a Pax3/pax7+ muscle progeny of embryonic myogenic progenitor cells. To that end, the therapy must seek to achieve that objective, i.e., the therapy must allow the effective reduction of the levels of miRNA-106b in said cells.
[0070] Accordingly, a second aspect of the present invention relates to a composition comprising a compound, inhibitory compound, capable of reducing the expression of miRNA-106b in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells, for preparing a drug for promoting muscle regeneration.
[0071] In the context of the present invention, inhibiting or reducing the expression of miRNA-106b is understood as the reduction with respect to the baseline, or compared to a control, by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, or more times.
[0072] The inhibitory compounds can be identified by means of a screening method that allows identifying in a compound the ability of inhibiting or reducing the intracellular expression of miRNA-106b, which comprises putting a cell, preferably a muscle satellite stem cell, in contact with a compound suspected of being able to inhibit or reduce the expression of miRNA-106b; testing the content of the cells to determine the amount and/or biological activity of the expression of miRNA-106b and to compare the determined amount and/or biological activity of miRNA-106b with a predetermined level, in which a change in said amount and/or biological activity of the expression of miRNA-106b is indicative of a compound with the ability to inhibit or reduce the intracellular expression of miRNA-106b. In a preferred embodiment, detection is performed by means of real-time quantitative RT-PCR.
[0073] In a preferred embodiment of the second aspect of the invention or of any of its preferred embodiments, said compound is an interfering RNA (siRNA) of miRNA-106b, such as an antisense RNA oligonucleotide of miRNA-106b or a polynucleotide expressing said antisense oligonucleotide. Preferably, said compound is a synthetic antisense RNA oligonucleotide of miRNA-106b which optionally has modifications for increasing its resistance to nucleases. More preferably, said compound is the miRNA inhibitor hsa-miR-106b-5p ID: MH10067; Cat: 4464084, Ambion, or a polynucleotide capable of inhibiting hsa-miR-106b-5p and having a nucleotide sequence identical by at least 90%, 92%, 94%, 96%, 98% or 99%, based on the identity of all the nucleotides of said sequence, to nucleotide sequence ID: MH10067; Cat: 4464084, Ambion. More preferably, said compound is comprised in a vector or plasmid capable of transporting or delivering said compound to the muscle satellite stem cells, such as a viral vector, for example, adenoviral, lentiviral, retroviral and adeno-associated vectors.
[0074] In yet another preferred embodiment of the second aspect of the invention or of any of its preferred embodiments, said composition comprises muscle satellite stem cells of a human or animal subject treated, transformed, transfected or transduced with a compound capable of reducing the expression of miRNA-106b in said cells. Preferably, said cells treated, transformed, transfected or transduced with the compound are autologous cells. More preferably, said cells transformed, transfected or transduced with the compound are muscle satellite stem cells of a human or animal subject suffering from a dystrophinopathy or a dystrophy.
[0075] In another preferred embodiment of the second aspect of the invention or of any of its preferred embodiments, said drug is used for promoting muscle regeneration in the treatment of a dystrophinopathy.
[0076] In another preferred embodiment of the second aspect of the invention or of any of its preferred embodiments, said dystrophy or dystrophinopathy is selected from the list consisting of Duchenne muscular dystrophy and Becker muscular dystrophy.
[0077] It must be noted that the compositions described in the second aspect of the invention or in any of its preferred embodiments can be administered in the form of pharmaceutical composition comprising the compounds of this invention together with a pharmaceutically acceptable carrier or diluent. The compounds of this invention can thereby be administered in any conventional oral, parenteral, intramuscular or transdermal dosage form provided that said dosage forms are capable of transporting and delivering any of the compounds described in the second aspect of the invention to muscle satellite stem cells.
[0078] The composition of the second aspect of this invention can also be administered in a controlled release formulation, such as a slow release or a rapid release formulation. Such dosed controlled release formulations of the combination of the invention can be prepared using methods well known by the persons skilled in the art. The preferred method of administration will be determined by the physician in charge of the patient or another person skilled in the art after an evaluation of the subject's conditions and needs.
[0079] For parenteral administration purposes, nanoemulsions or solutions comprising nanoparticles or liposomes can be used. Said nanoemulsions or solutions can be suitably buffered. These aqueous solutions are particularly suitable for intravenous, intramuscular, subcutaneous and intraperitoneal injection purposes. In any case, methods of preparing various pharmaceutical compositions that can contain or comprise the inhibitory compound of the second aspect of the invention for administration in vivo in a pharmaceutically acceptable carrier are well known, as illustrated below in the description.
[0080] Preferably, said dystrophy or dystrophinopathy is treated by means of intramuscular administration, more preferably through intramuscular administration in the lower limbs of a human or animal subject. More preferably, the dystrophy or dystrophinopathy is treated by means of an intramuscular administration, more preferably by means of an intramuscular administration in the lower limbs of a human or animal subject, using as the compound an interfering RNA (siRNA) of miRNA-106b as an antisense RNA oligonucleotide of miRNA-106b or a polynucleotide expressing said antisense oligonucleotide, preferably using a synthetic antisense RNA oligonucleotide of miRNA-106b which optionally has modifications for increasing its resistance to nucleases, more preferably using the miRNA inhibitor hsa-miR-106b-5p ID: MH10067; Cat: 4464084, Ambion, or a polynucleotide capable of inhibiting hsa-miR-106b-5p and having a nucleotide sequence identical by at least 90%, 92%, 94%, 96%, 98% or 99%, based on the identity of all the nucleotides of said sequence, to nucleotide sequence ID: MH10067; Cat: 4464084.
[0081] Finally, a third aspect of the invention relates to a screening method for screening a compound capable of promoting muscle regeneration comprising: [0082] 1. Selecting compounds from a library of compounds; [0083] 2. Testing if any of said compounds is capable of: [0084] a. increasing the expression of the Pitx2 gene in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells; and/or [0085] b. reducing the expression of miRNA-106b in muscle satellite stem cells of a human or animal subject with respect to the expression observed in the absence of the compound in said cells; and [0086] 3. Selecting that compound or those compounds capable of carrying out that mentioned in any of the preceding paragraphs.
[0087] In the context of the present invention, the polynucleotides of DNA of the invention, such as those described above, that are delivered to the cells can be integrated in the host cell genome, normally through integration sequences. These sequences are often related to viral sequences, particularly in systems based on viruses when they are used. These viral integration systems can also be incorporated in the nucleic acids that will be delivered using an addition system of a non-nucleic acid-based delivery, said non-nucleic acid being a liposome, for example, such that the nucleic acid contained in the delivery system can be integrated in the host genome.
[0088] Other general techniques for integrating the host genome include, for example, systems designed for promoting homologous recombination with the host genome. These systems are typically based on the nucleic acid flanking sequence to be expressed having sufficient homology with a target sequence in the host cell genome where recombination between the nucleic acid vector and the target nucleic acid takes place, meaning that the delivered nucleic acid is integrated in the host genome. These systems and the methods required for promoting homologous recombination are known by persons skilled in the art.
[0089] The activating or inhibitory compounds described in the present specification can be administered in a pharmaceutically acceptable carrier and can be sent to the cells of the subject in vivo and/or ex vivo by means of a range of mechanisms well known in the art, as discussed above.
[0090] If ex vivo methods are used, the cells or tissues can be removed and kept outside the body according to standard protocols well known in the art. The activating or inhibitory compounds can be introduced in cells through any gene transfer mechanism, such as, for example, calcium phosphate-mediated gene delivery, electroporation, microinjection or proteoliposomes. Transduced cells can then be infused (for example, in a pharmaceutically acceptable carrier) or be homotopically transplanted in the subject by standard methods for the cell or tissue type. Standard methods are known for the transplant or infusion of several cells in a subject.
[0091] The activating or inhibitory compounds of the present invention can be used together with other treatment methods.
[0092] Furthermore, the present specification provides a method for increasing or improving the clinical status and the perceived well-being of a subject with dystrophy or with a dystrophinopathy, which comprises administering to subject in need of same an effective amount of an activating inhibitory compound, which increases or improves the clinical status of the subject treated for a certain period of time.
[0093] Current treatment methods also include a method for increasing the efficacy of other agents proposed for the same disease, which comprises administering to a subject in need of same an effective amount of an activating or inhibitory compound, and, optionally, a pharmaceutically acceptable carrier, thereby increasing the efficacy of the other agent or agents.
[0094] In any case, the compositions comprising the activating or inhibitory compound can be administered in vivo in a pharmaceutically acceptable carrier. Pharmaceutically acceptable is understood to be a material that is not biologically, or otherwise undesirable, i.e., the material can be administered to a subject, together with the nucleic acid or vector, without causing any undesirable biological effect or without harmfully interacting with any of the other components of the pharmaceutical composition in which it is contained. The carrier is obviously selected to minimize any degradation of the active ingredient and to minimize any adverse side effect in the subject, as is known for a person skilled in the art.
[0095] The effective dosages and administration timetables of the compositions comprising the activating or inhibitory compound described herein can be determined empirically, and making such determinations is within expertise in the art. The dosage intervals for the administration of the compositions are large enough to produce the desired anti-hypertrophic effect in the disorder. The dosage must not be so large that they cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage varies with age, condition, sex and extent of the disease in the patient, the administration route, or if other drugs are included in the regimen, and can be determined by a person skilled in the art. The dosage can be adjusted by the individual physician in case of any contraindication. The dose may vary and can be administered in one or more daily dose administrations for one or several days. Guidelines can be found in the literature in relation to suitable dosages for given classes of pharmaceutical products.
[0096] The following example is provided to merely illustrate the present invention.
EXAMPLES
Example 1
Pitx2 and Muscle Regeneration
[0097] Based on the results shown in the drawings and taking into account that, interestingly enough, the expression of Pitx2 is significantly increased during muscle regeneration in mouse and decreased in the Duchenne muscular dystrophy murine model (DMDmdx mice), an experimental approach to an in vivo cell transplant was carried out to test if Pitx2 could improve the regenerative ability of isolated dystrophic muscle satellite cells. It is important to point out that the possibility of modifying the regenerative ability of actual dystrophic cells is a significant advantage for their therapeutic application in humans (possibility of using cells from a dystrophic patient). The obtained results allow clearly showing that the overexpression of Pitx2 improves the muscle regeneration carried out by dystrophic satellite cells by increasing muscle regeneration in MDX mice. Therefore, the results herein demonstrate that the transplant of dystrophic satellite cells overexpressing Pitx2 in DMDmdx mice leads to: [0098] An increase in the number of myofibers formed de novo (
[0101] Therefore, these analyses led to identifying miR-31 as miRNA regulated by Pitx2 during muscle regeneration. Furthermore, additional evidence was also obtained that shows that the Pitx2-miRNAs pathway controlling cell proliferation is also present in in vivo the cell transplantation model used herein in DMDmdx mice (
Example 2
Detailed Description of the Results of the Invention
[0102] Firstly, as shown in
[0103] In addition, as shown in
[0104] Secondly, as illustrated in
[0105] Thirdly, as shown in
Example 3
Downrequlation in miR-106b In Vivo Mediated by Infection of the Anti-miR106b Compound Improves the Myogenic Regeneration Process in DMDmdx Mice
[0106] The preceding examples show that miR-106b selects as a target Myf5 mRNA 3UTR and that the downregulation in miR-106b in recently isolated satellite cells leads to the increase in the Myf5+ cell population. Furthermore, it has been detected by means of in situ LNA analysis that miR-106b carries out a tissue expression pattern compatible with the expression labeled in satellite cells (
Example 4
Downregulation in miR-106b In Vivo Mediated by Infection of the Anti-miR106b Compound Improves the Myogenic Regeneration Process in DMDmdx Mice
[0107] To further study the role of miR-106b during muscle repair, it was investigated whether the expression of miR-106b changed in a context in which muscle regeneration is not completed satisfactorily, such as in DMD. In this sense, it was demonstrated that the expression of miR-106b clearly increases in MDX mouse muscles, an animal model that is widely used for human DMD (
[0108] In summary, it was observed that the expression of miR-106b decreases during muscle regeneration but increases when muscle regeneration is not satisfactory. Therefore, it was then considered whether muscle regeneration in mice dystrophic could be modulated by decreasing the expression of miR-106b. To approach this issue, a strategy was developed by means of which cardiotoxin and miRNA inhibitor hsa-miR-106b-5p (ID: MH10067; Cat: 4464084, Ambion) were injected in TA muscle (tibialis anterior muscle) of 4 month old MDX mice (1.7 nmol per injection). After the injection of miRNA inhibitor, the muscles were removed 1, 3 and 15 days after the injection of anti-miR-106b compound for analysis. The results clearly show that the injection of anti-miR-106b compound can decrease the presence of miR-106b.
[0109] Interestingly enough, the decrease in miR-106b coincides with myogenic differentiation waves as observed by means of upregulation of Myf5, MyoD and myogenin, which indicates that decreased levels of miR-106b induced by means of injection of anti-miR106b compound can boost muscle differentiation (
[0110] The new formation of myofibers was also analyzed using e-MyHC antibody, and it was found that the number of myofibers positive for e-MyHC was potentiated in muscles treated with anti-miR compound compared to the control, which demonstrates that recently formed myofibers increased after the injection of anti-miR-106b compound (
Example 5
Evaluation of the Functional Yield
[0111] To evaluate the functional yield, treadmill tests to exhaustion were conducted in DMD/mdx mice injected with anti-miR106b compound 30 days after treatment with anti-miR-106b compound. As illustrated in
[0112] When considered together, the results showed that miR-106b plays a key role during the muscle regeneration process in mice. Furthermore, the data herein presented demonstrated that the intramuscular injection of anti-miR-106b compound can improve the ability of regeneration in DMD mice.