ANTI-METALLOPROTEASE ANTIBODY FOR DIAGNOSIS AND TREATMENT OF CANCERS
20190105405 ยท 2019-04-11
Inventors
- Martin Lackmann (St. Andrews Beach, AU)
- Peter W. Janes (Hawthorn East, AU)
- Lakmali Atapattu Mudiyanselage (Hughesdale, AU)
- Andrew M. Scott (Kew East, AU)
- Dimitar B. Nikolov (New York, NY)
- Nayanendu Saha (Jackson Heights, NY)
Cpc classification
A61K47/6887
HUMAN NECESSITIES
C07K16/3076
CHEMISTRY; METALLURGY
A61K47/6851
HUMAN NECESSITIES
A61K47/6891
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K16/283
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6843
HUMAN NECESSITIES
C07K16/2896
CHEMISTRY; METALLURGY
International classification
A61K47/68
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Expression of proteolytically active, high molecular weight ADAM10 protease is relatively increased in tumour cells that also express the putative tumour stem cell marker CD133. A recombinant humanized antibody or antibody fragment based on 8C7 monoclonal antibody may be used to selectively bind to proteolytically active, high molecular weight ADAM10 protease to thereby detect tumour cells and also as a therapeutic agent for treating cancers, tumours and other malignancies inclusive of leukemia, lymphoma, lung cancer, colon cancer, adenoma, neuroblastoma, brain tumour, renal tumour, prostate cancer, sarcoma and/or melanoma.
Claims
1. A recombinant, humanized antibody or antibody fragment comprising that comprises: (i) an amino acid sequence set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4, or an amino acid sequence at least 80% identical thereto; (ii) at least one complementarity determining region (CDR), or a portion thereof, having a CDR amino acid sequence set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4; or (iii) at least one CDR, or a portion thereof, comprising an amino acid sequence at least 80% identical to a CDR amino acid sequence in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4.
2. The recombinant, humanized antibody or antibody fragment of claim 1, further comprising one or more human immunoglobulin Fc and/or constant region amino acid sequences.
3. The recombinant, humanized antibody or antibody fragment of claim 2, wherein the one or more human immunoglobulin Fc and/or constant region amino acid sequences are set forth in SEQ ID NO:7 and/or SEQ ID NO:8, or an amino acid sequence at least 80% identical thereto.
4. The recombinant humanized antibody or antibody fragment of claim 1, which specifically, selectively or preferentially binds a proteolytically active form of an ADAM10 protease.
5. The recombinant humanized antibody or antibody fragment of claim 4, which binds a region, portion and/or amino acid sequence of an ADAM10 protease that provides a switch between a proteolytically active and inactive form of an ADAM10 protease.
6. The recombinant humanized antibody or antibody fragment of claim 5, which region, portion or the amino acid sequence of the ADAM10 protease is of a loop which preferably comprises a disulphide bond between a cysteine residue and an adjacent CXXC motif.
7. The recombinant humanized antibody or antibody fragment of claim 6, wherein the loop comprises two intramolecular disulfide bonds: C.sub.594-C.sub.639 and C.sub.632-C.sub.645.
8. The recombinant humanized antibody or antibody fragment of claim 1, wherein the antibody or antibody fragment binds or interacts with one or more ADAM10 protease residues selected from the group consisting of: Arg.sub.557, Lys.sub.591, Pro.sub.628, Asp.sub.640, Val.sub.641, Phe.sub.642, Arg.sub.644, and Arg.sub.646.
9. The recombinant humanized antibody or antibody fragment of claim 8, wherein hydrogen bonds are formed between Asp.sub.641, Val.sub.641, Phe.sub.642, Arg.sub.644, and Arg.sub.646, and the antibody or antibody fragment.
10. A method of detecting a proteolytically active form of an ADAM10 protease, said method including the step of selectively binding the recombinant humanized antibody or antibody fragment of claim 1 to a proteolytically active form of an ADAM10 protease to thereby detect the proteolytically active form of the ADAM10 protease.
11. A method of detecting a tumour cell, said method including the step of binding the recombinant humanized antibody or antibody fragment of claim 1 to a proteolytically active form of an ADAM10 protease expressed by the tumour cell to thereby detect the tumour cell.
12. The method of claim 11, wherein the tumour cell is of a leukemia, lymphoma, lung cancer, colon cancer, breast cancer, adenoma, neuroblastoma, brain tumour, renal tumour, prostate cancer, sarcoma or melanoma.
13. A method of inhibiting an ADAM 10 protease and/or one or more downstream signalling molecules in a cell, including the step of binding an antibody or antibody fragment which specifically, selectively or preferentially recognizes and binds a proteolytically active form of the ADAM10 protease to the ADAM10 protease expressed by the cell, to thereby at least partly inhibit a biological activity of the ADAM10 protease and/or one or more downstream signalling molecules in the cell.
14. The method of claim 13, wherein the one or more downstream signalling molecules include one or more members of the Notch, erbB and Eph signalling pathways.
15. The method of claim 14, wherein the cell is a tumour cell.
16. The method of claim 15, wherein the tumour cell is of a leukemia, lymphoma, lung cancer, colon cancer, breast cancer, adenoma, neuroblastoma, brain tumour, renal tumour, prostate cancer, sarcoma or melanoma.
17. A method of treating or preventing cancer in a mammal, said method including the step of administering to the mammal the recombinant humanized antibody or antibody fragment of claim 1 to thereby treat cancer in the mammal.
18. The method of claim 17, wherein the ADAM10 protease is expressed by a tumour cell.
19. The method of claim 18, wherein the tumour cell is of a leukemia, lymphoma, lung cancer, colon cancer, breast cancer, adenoma, neuroblastoma, brain tumour, renal tumour, prostate cancer, sarcoma or melanoma.
20. A kit comprising the recombinant humanized antibody or antibody fragment of claim 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
DETAILED DESCRIPTION
[0054] ADAM10 is a transmembrane metalloprotease frequently overexpressed in many tumours where it acts by releasing a range of cell surface proteins that promote tumour progression. By shedding ligands and receptors of the Notch, Eph, EGF, GP130/IL6 and chemokine families, ADAM10 activates key cancer signalling pathways and drug resistance mechanisms, but lack of active site inhibitors with sufficient specificity has hindered its clinical development to date. The ADAM10 protease comprises disintegrin and cysteine-rich domains having a substrate-binding pocket within the C domain that specifies ligand cleavage. The 8C7 monoclonal antibody specifically recognises the substrate binding domain and inhibits ADAM10-mediated cleavage of Eph receptor ligands (ephrins) and ephrin/Eph-dependent signalling and cell segregation in vitro. Analysis of the structure of 8C7 in complex with ADAM10 revealed binding to a critical cysteine-rich sequence motif that regulates ADAM10 function. 8C7 treatment inhibits growth of human colon tumour xenografts due to inhibition of Notch signalling and down-regulation of Notch, EGFR and Eph receptor levels. 8C7 specifically targets tumour cells, preferentially binding to cells that express the putative tumour stem cell marker CD133 and that display active Notch-signalling within tumours. More particularly, 8C7 selectively binds a proteolytically active form of ADAM10, which is diagnostic in mouse tumour models and in several human solid tumours. Accordingly, certain embodiments of the invention relate to 8C7 as an antibody suitable for human cancer therapeutic and diagnostic uses. It is also proposed that the disclosure provided herein may also be applicable to related ADAM proteases such as ADAM17.
[0055] For the purposes of this invention, by isolated is meant material that has been removed from its natural state or otherwise been subjected to human manipulation. Isolated material may be substantially or essentially free from components that normally accompany it in its natural state, or may be manipulated so as to be in an artificial state together with components that normally accompany it in its natural state. Isolated material may be in native, chemical synthetic or recombinant form.
[0056] By protein is meant an amino acid polymer. The amino acids may be natural or non-natural amino acids, D- or L-amino acids as are well understood in the art.
[0057] A peptide is a protein having no more than fifty (50) amino acids.
[0058] A polypeptide is a protein having more than fifty (50) amino acids.
[0059] As used herein, the abbreviation ADAM relates to a family of transmembrane metalloproteases that catalyse the release of a range of cell surface proteins, activating receptor tyrosine kinase (RTK), Notch, cytokine-, chemokine- and adhesion signalling pathways important in normal and oncogenic development. Prominent oncogenic substrates include ligands and receptors in the Notch, erbB and Eph families, cytokines (TNF?, IL6), FASL, Slit, L-selectin and cadherins. The amino acid residue numbering system used herein is based on ADAM sequences available under Genbank accession numbers: NM_001110 (human ADAM10; SEQ ID NO:12), NM_174496 (mouse ADAM 10), NM_007399 (bovine ADAM10), NM 003183 (human ADAM17) and NM_009615 (mouse ADAM17).
[0060] As used herein an antibody is or comprises an immunoglobulin. The term immunoglobulin includes any antigen-binding protein product of a mammalian immunoglobulin gene complex, including immunoglobulin isotypes IgA, IgD, IgM, IgG and IgE and antigen-binding fragments thereof. Included in the term immunoglobulin are immunoglobulins that are chimeric or humanised or otherwise comprise altered or variant amino acid residues, sequences and/or glycosylation, whether naturally occurring or produced by human intervention (e.g. by recombinant DNA technology).
[0061] Antibody fragments include Fab and Fab2 fragments, diabodies and single chain antibody fragments (e.g. scVs), although without limitation thereto. Typically, an antibody comprises respective light chain and heavy chain variable regions that each comprise CDR 1, 2 and 3 amino acid sequences The antibody or antibody fragment may comprise at least a portion of a CDR1, 2 and/or 3 amino acid sequence A preferred antibody fragment comprises at least one entire light chain variable region CDR and/or at least one entire heavy chain variable region CDR.
[0062] Antibodies and antibody fragments may be polyclonal or preferably monoclonal. Monoclonal antibodies may be produced using the standard method as for example, described in an article by K?hler & Milstein, 1975, Nature 256, 495, or by more recent modifications thereof as for example described in Chapter 2 of Coligan et al., CURRENT PROTOCOLS IN IMMUNOLOGY, by immortalizing spleen or other antibody producing cells derived from a production species which has been inoculated with an ADAM protease or fragment thereof. It will also be appreciated that antibodies may be produced as recombinant synthetic antibodies or antibody fragments by expressing a nucleic acid encoding the antibody or antibody fragment in an appropriate host cell. Recombinant synthetic antibody or antibody fragment heavy and light chains may be co-expressed from different expression vectors in the same host cell or expressed as a single chain antibody in a host cell. Non-limiting examples of recombinant antibody expression and selection techniques are provided in Chapter 17 of Coligan et al., CURRENT PROTOCOLS IN IMMUNOLOGY and Zuberbuhler et al., 2009, Protein Engineering, Design & Selection 22 169.
[0063] Antibodies and antibody fragments may be modified so as to be administrable to one species having being produced in, or originating from, another species without eliciting a deleterious immune response to the foreign antibody. In the context of humans, this is humanization of the antibody produced in, or originating from, another species. Such methods are well known in the art and generally involve recombinant grafting of non-human antibody complementarity determining regions (CDRs) onto a human antibody scaffold or backbone. Particular embodiments of recombinant, humanized antibodies will be described in more detail hereinafter.
[0064] In some embodiments, the antibody or antibody fragment is labeled.
[0065] The label may be selected from a group including a chromogen, a catalyst, biotin, digoxigenin, an enzyme, a fluorophore, a chemiluminescent molecule, a radioisotope, a drug or other chemotherapeutic agent, a magnetic bead and/or a direct visual label.
[0066] In the case of a direct visual label, use may be made of a colloidal metallic or non -metallic particle, a dye particle, an enzyme or a substrate, an organic polymer, a latex particle, a liposome, or other vesicle containing a signal producing substance and the like.
[0067] The fluorophore may be, for example, fluorescein isothiocyanate (FITC), Alexa dyes, tetramethylrhodamine isothiocyanate (TRITL), allophycocyanin (APC), Texas Red, Cy5, Cy3, or R-Phycoerythrin (RPE) as are well known in the art.
[0068] The enzyme may be horseradish peroxidase (HRP), alkaline phosphatase (AP), ?-galactosidase or glucose oxidase, although without limitation thereto.
[0069] Suitably, the antibody or antibody fragment specifically, selectively or preferentially binds or interacts with a proteolytically active form of a human ADAM protease. Accordingly, the antibody or antibody fragment may be capable of distunguishing or discriminating between a proteolytically active form of an ADAM protease and a proteolytically inactive form of an ADAM protease.
[0070] One embodiment of an antibody or antibody fragment disclosed herein is mAb 8C7 which is a monoclonal antibody which specifically, selectively or preferentially binds or interacts with a proteolytically active form of a human ADAM10 protease. By this is meant that 8C7 monoclonal antibody binds to, or interacts with, a proteolytically active form of an ADAM10 mprotease but does not bind to or interact with, or binds to or interacts with substantially less affinity, a proteolytically inactive form of an ADAM10 protease. Accordingly, the 8C7 monoclonal antibody may be capable of distinguishing or discriminating between a proteolytically active form of an ADAM10 protease and a proteolytically inactive form of an ADAM10 protease. In one form, the proteolytically active form of the ADAM protease may be characterized by the presence of a disulfide bond between: (i) a cysteine residue present in a loop that protrudes away from the ADAM10 cysteine-rich domain, which in ADAM10 comprises substrate-binding residues Glu.sub.573, Glu.sub.578, Glu.sub.589; and (ii) another cysteine in the amino acid sequence CXXC, such as C.sub.594 in the ADAM10 sequence C.sub.594HVCC.sub.598 (SEQ ID NO:11). The loop may comprise two intramolecular disulfide bonds: such as C.sub.594-C.sub.639 and C.sub.632-C.sub.645 in ADAM10.
[0071] In further embodiments, the antibody or antibody fragment may be characterized as binding or interacting with one or more human ADAM10 residues selected from the group consisting of: Arg.sub.557; Asp589; Lys.sub.591; Pro.sub.628; Tyr.sub.638; Cys.sub.639; Asp.sub.640; Val.sub.641; Phe.sub.642; Arg.sub.644, and Arg.sub.646, or the corresponding residues in other non-human mammalian ADAM proteases. Preferably, the binding or interaction includes hydrogen bonds formed between Asp640, Val.sub.641, Phe.sub.642, Arg.sub.644, and Arg.sub.646 of ADAM10 protease or the corresponding residues in other, non -human mammalian forms of ADAM proteases, and the antibody or antibody fragment.
[0072] Therefore, an antibody or antibody fragment useful according to the invention may broadly be defined as an antibody or antibody fragment characterized as having substantially the same or similar activity as 8C7 mAb in a mammal, with regard to specifically, preferentially or selectively binding to, or interacting with, a proteolytically active form of an ADAM10 protease.
[0073] The 8C7 mAb comprises heavy and light chain variable region amino acid sequences as set forth below:
TABLE-US-00001 8C7V.sub.HProteinSequence: (SEQIDNO:1) EVQLQQSGAELARPGSSVKLSCKASGYTFTNYWLQWVKQRTGQGLEWIGA IYPRDGDAKYSQKFKDKASLTVNESSSTAYMHLSALASEDSAVYYCARAN YGLYYAMDRWGQGTSVTVSS 8C7V.sub.LProteinSequence: (SEQIDNO:2) DIFLTQSPANMSVSPGERVSFSCRASQNIGTNIHWYQQRTNGSPRLLIKY ASESISGIPSRFSGSGSGTDFILSINTVESEDIAVYFCQQSNRWPFTFGS GTKLEVIR
[0074] The CDR1, 2 and 3 amino acid sequences are underlined and numbered based on the Kabat numbering system.
[0075] A particular aspect of the invention provides a recombinant humanized antibody or antibody fragment which binds ADAM10. Preferably, the recombinant humanized antibody or antibody fragment specifically, selectively or preferentially binds a proteolytically active form of an ADAM10 protease.
[0076] Suitably, the recombinant humanized antibody or antibody fragment comprises one or more amino acids or amino acid sequences of a human immunoglobulin.
[0077] In one embodiment, the one or more amino acids or amino acid sequences are of an Fc region and/or constant region of a human immunoglobulin, such as IgG1 although without limitation thereto. Non-limiting examples are set forth in SEQ ID NOS: 7 and 8, and include fragments and variants thereof.
[0078] A non-limiting example of an antibody or antibody fragment according to this embodiment is a human Fc chimerised version of mAb 8C7 referred to herein as ch8C7.
[0079] In another embodiment, the one or more amino acids or amino acid sequences are of a variable region of a human immunoglobulin light chain or heavy chain.
[0080] In an embodiment, a human immunoglobulin heavy chain variable region comprises the amino acid sequence of SEQ ID NO:3, or a fragment or variant thereof.
[0081] In an embodiment, a human immunoglobulin light chain variable region comprises the amino acid sequence of SEQ ID NO:4, or a fragment or variant thereof.
[0082] In a particular embodiment, the recombinant humanized antibody or antibody fragment comprises the amino acid sequence of SEQ ID NO:3, or a fragment or variant thereof and the amino acid sequence of SEQ ID NO:4, or a fragment or variant thereof. Preferably, the recombinant humanized antibody or antibody fragment is of the human IgG1-? subtype. A non-limiting example of this embodiment is a fully humanised version of 8C7 designated herein as hu8C7.
[0083] In a general embodiment, the antibody or antibody fragment, inclusive of recombinant humanized antibody fragments, may comprise respective light chain and heavy chain variable regions that each comprise CDR 1, 2 and 3 amino acid sequences present in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4, or a variant thereof. This includes an amino acid sequence of at least a portion of an entire CDR1, 2 or 3, such as present in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4, or a variant thereof. By way of example, this may include at least 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 contiguous amino acids of an entire CDR1, 2 or 3, such as present in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4, or a variant thereof. A preferred antibody fragment comprises at least one entire light chain variable region CDR and/or at least one entire heavy chain variable region CDR set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4, or a variant thereof.
[0084] In general, as used herein variants may comprise an amino acid sequence at least 80%, at least 85%, at least 90% or at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence such as set forth in any one of SEQ ID NOS:1, 2, 3, 4, 7 and/or 8, or a fragment comprising a CDR region of SEQ ID NOS:1, 2, 3 and/or 4.
[0085] In some embodiments, an antibody or antibody fragment may comprise an amino acid sequence at least 80%, at least 85%, at least 90% or at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to at an amino acid sequence of least one immunoglobulin heavy chain and/or light chain CDR present in the amino acid sequence set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4.
[0086] In some embodiments, the antibody or antibody fragment may comprise one, two or three immunoglobulin heavy chain and/or light chain CDRs present in the amino acid sequence set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4, or one, two or three immunoglobulin heavy chain and/or light chain CDRs respectively at least 80%, at least 85%, at least 90% or at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of a heavy chain and/or light chain CDR present in the amino acid sequence set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and/or SEQ ID NO:4.
[0087] Terms used herein to describe sequence relationships between respective proteins include comparison window, sequence identity, percentage of sequence identity and substantial identity. Because respective amino acid sequences may each comprise: (1) only one or more portions of a complete sequence that are shared by respective nucleic acids or proteins, and (2) one or more portions which are divergent between the nucleic acids or proteins, sequence comparisons are typically performed by comparing sequences over a comparison window to identify and compare local regions of sequence similarity. A comparison window refers to a conceptual segment of typically at least 6, 10, 12, 20 or more contiguous residues that is compared to a reference sequence. The comparison window may comprise additions or deletions (i.e., gaps) of about 20% or less (e.g. 5, 10 or 15%) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the respective sequences. Optimal alignment of sequences for aligning a comparison window may be conducted by computerised implementations of algorithms (for example ECLUSTALW and BESTFIT provided by WebAngis GCG, 2D Angis, GCG and GeneDoc programs, incorporated herein by reference) or by inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected.
[0088] The invention also provides one or more isolated nucleic acids encoding a recombinant humanized antibody or antibody fragment, a genetic construct comprising the one or more isolated nucleic acids and/or a host cell comprising the genetic construct.
[0089] As used herein, a nucleic acid may be a single- or double-stranded DNA, RNA or DNA-RNA hybrids inclusive of cDNA, genomic DNA, mRNA, tRNA, oligonucleotides, primers and probes, although without limitation thereto. Preferably, the genetic construct is suitable for expression of the one or more isolated nucleic acids, comprising one or more of a promoter, enhancer, polyadenylation sequence, bacterial origin or replication, selection marker, splice donor/acceptor and Kozak sequence, as are well understood in the art. Suitably, the genetic construct is expressible in a host cell inclusive of bacterial, mammalian, yeast, insect, plant and amphibian host cells, although without limitation thereto.
[0090] In an embodiment, the nucleic acid comprises a nucleotide sequence set forth in any one of SEQ ID NOS:5, 6, 9 or 10, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical thereto.
[0091] In one aspect the invention therefore provides a method of detecting a proteolytically active form of an ADAM protease, said method including the step of selectively binding an antibody or antibody fragment to the proteolytically active form of the ADAM protease to thereby detect the proteolytically active form of the ADAM protease.
[0092] Suitably, the ADAM protease is expressed by a cell, including but not limited to lymphocytes, hepatocytes, kidney cells, epithelial cells, neural cells, vascular smooth muscle cells, intestinal epithelium and lung cells, inclusive of normal or non-malignant cells and tumour cells, although without limitation thereto.
[0093] In another aspect, the invention provides a method of detecting a tumour cell, said method including the step of binding an antibody or antibody fragment which specifically, selectively or preferentially recognizes a proteolytically active form of an ADAM protease expressed by the tumour cell to thereby detect the tumour cell.
[0094] As generally used herein, the terms cancer, tumour, malignant and malignancy refer to diseases or conditions, or to cells or tissues associated with the diseases or conditions, characterized by aberrant or abnormal cell proliferation, differentiation and/or migration often accompanied by an aberrant or abnormal molecular phenotype that includes one or more genetic mutations or other genetic changes associated with oncogenesis, expression of tumour markers, loss of tumour suppressor expression or activity and/or aberrant or abnormal cell surface marker expression.
[0095] Some tumour cells typically express relatively increased levels of a proteolytically active form of an ADAM protease (e.g. compared to normal or non-malignant cells, whereby an antibody or antibody fragment such as 8C7 mAb is capable of distinguishing tumour cells from normal or non-malignant cells. Typically, the proteolytically active form of the ADAM protease expressed by tumour cells is a high molecular weight form of an ADAM protease which comprises the intramolecular disulfide bonds as hereinbefore described. ADAM proteases may exist in a high molecular weight form (high molecular weight or HMW ADAM) or in a low molecular weight form (LMW) as a result of release of an N-terminal prodomain by furin or other pro-protein convertases. Contrary to previous understanding, the inventors have shown that the HMW form of ADAM10 proteases is proteolytically active and that ADAM10 protease does not require release of the N-terminal prodomain to become proteolytically active.
[0096] In some embodiments, the tumour cells co-express relatively increased levels of a proteolytically active, HMW form of an ADAM protease and CD133. The tumour cells may further express one or more members of the Notch, Eph and/or erbB receptor families. Non -limiting examples of tumour cells include leukemias and lymphomas, lung cancer, colon cancer, adenomas, neuroblastomas, brain, renal and kidney tumours, prostate cancers, sarcomas and melanoma. For a more comprehensive review of potentially relevant tumours the skilled person is directed to Murphy, G., 2008, Nature Rev Cancer. 8 929-941, Mochizuki S & Okada Y, 2007, Cancer Sci 98, 621-628 Groth, C & Fortini M E, 2012, Semin Cell Dev Biol. 23:465-72.
[0097] It will therefore be understood that an antibody or antibody fragment disclosed herein may be used to detect tumour cells, to assist medical diagnosis of a cancer or cancer symptoms. Suitably, the method includes detecting the proteolytically active form of the ADAM protease expressed by tumour cells present in, or obtained from, a biological sample. In certain embodiments, the biological sample may be a pathology sample that comprises one or more fluids, cells, tissues, organs or organ samples obtained from a mammal. Non-limiting examples include blood, plasma, serum, lymphocytes, urine, faeces, amniotic fluid, cervical samples, cerebrospinal fluid, tissue biopsies, bone marrow and skin, although without limitation thereto.
[0098] Suitably, detection of the proteolytically active ADAM protease includes the step of forming a detectable complex between an antibody or antibody fragment and the proteolytically active ADAM protease. The complex so formed may be detected by any technique, assay or means known in the art including immunoblotting, immunohistochemistry, immunocytochemistry, immunoprecipitation, ELISA, flow cytometry, magnetic bead separation, and biosensor-based detection systems such as surface plasmon resonance, although without limitation thereto.
[0099] To facilitate detection the antibody may be directly labeled as hereinbefore described or a labeled secondary antibody may be used. The labels may be as hereinbefore described.
[0100] In some embodiments, detection methods may be performed in high throughput diagnostic tests or procedures such as performed by commercial pathology laboratories or in hospitals.
[0101] It will therefore be appreciated that another aspect of the invention provides a kit for detecting a proteolytically active form of an ADAM protease and/or a tumour cell as hereinbefore described, the kit comprising an antibody or antibody fragment as hereinbefore described.
[0102] The antibody or antibody fragment may be labeled with biotin, an enzyme, fluorophore or other label as previously described. Alternatively, the antibody or antibody fragment is unlabeled and a secondary antibody comprises a label. In embodiments where the antibody or antibody fragment or the secondary antibody is labeled with an enzyme, the kit may further comprise an appropriate substrate substrate such as diaminobanzidine (DAB), permanent red, 3-ethylbenzthiazoline sulfonic acid (ABTS), 5-bromo-4-chloro-3-indolyl phosphate (BCIP), nitro blue tetrazolium (NBT), 3,3,5,5-tetramethyl benzidine (TNB) and 4-chloro-1-naphthol (4-CN), although without limitation thereto. A non-limiting example of a chemiluminescent substrate is Luminol?, which is oxidized in the presence of HRP and hydrogen peroxide to form an excited state product (3-aminophthalate).
[0103] The kit may further comprise one or more reaction vessels (e.g multiwell plates, tubes etc), control antibodies and instructions for use.
[0104] A further aspect of the invention provides a method of inhibiting an ADAM protease and/or one or more downstream signalling molecules in a cell, including the step of binding an antibody or antibody fragment which selectively recognizes a proteolytically active form of the ADAM protease to the ADAM protease expressed by the cell, to thereby at least partly inhibit a biological activity of the ADAM protease and/or one or more downstream signalling molecules in the cell.
[0105] Preferably, the cell is a tumour cell.
[0106] In some embodiments, the tumour cell is of a leukemia, lymphoma, lung cancer, colon cancer, breast cancer, adenoma, neuroblastoma, brain tumour, renal tumour, prostate cancer, sarcoma or melanoma.
[0107] In certain embodiments, the tumour cell expresses CD133. The tumour cell that expresses CD133 may be a cancer stem cell (CSC).
[0108] A still further aspect of the invention provides a method of treating or preventing cancer in a mammal, said method including the step of administering to the mammal an antibody or antibody fragment which selectively recognizes a proteolytically active form of the ADAM protease to thereby treat cancer in the mammal.
[0109] As disclosed herein, tumour cells typically express relatively increased levels of a proteolytically active form of an ADAM protease (e.g. compared to normal or non-malignant cells). Typically, the proteolytically active form of the ADAM protease expressed by tumour cells is a high molecular weight form of an ADAM protease, although this form may additionally or alternatively comprise the intramolecular disulfide bonds referred to hereinbefore. Furthermore, treatment of human tumour-bearing mice with an antibody such as mAb 8C7 caused a significant, dose-dependent inhibition of tumour growth, with no discernible detrimental effects on the overall health of the mice The treated tumours also displayed significantly reduced levels of downstream signalling molecules or effectors such as Notch, Eph, and erbB receptors and their ligands as well as MET, suggesting down-regulation of multiple oncogenic signalling pathways. This suggests that antibodies such as 8C7 may act, at least in part, by inhibiting the activation of the ADAM substrate, Notch. Furthermore, antibodies such as mAb 8C7 binding to ADAM prevent Notch cleavage and activation and largely blocked lymphoma proliferation, thereby demonstrating effective inhibition of Notch pathway activation. In certain embodiments, antibodies such as 8CT may target and/or deplete tumour cells that express CD133. The tumour cell that expresses CD133 may be a cancer stem cell (CSC).
[0110] Accordingly, it is proposed that, an antibody or antibody fragment disclosed herein may be suitable for administration to mammals, particularly humans, to treat or prevent cancer. As used herein, treating, treat or treatment refers to a therapeutic intervention, course of action or protocol that at least ameliorates a symptom of cancer after the cancer and/or its symptoms have at least started to develop. As used herein, preventing, prevent or prevention refers to therapeutic intervention, course of action or protocol initiated prior to the onset of cancer and/or a symptom of cancer so as to prevent, inhibit or delay or development or progression of the cancer or the symptom.
[0111] In particular embodiments, the invention may relate to treating, preventing, inhibiting or delaying tumour cell metastasis.
[0112] The antibody or antibody fragment suitably targets tumour cells that express proteolytically active ADAM, as hereinbefore described. Accordingly, the antibody or antibody fragment may be sufficient to suitably inhibit the ability of proteolytically active ADAM to activate downstream substrates or effectors such as one or members of the Notch, erbB and Eph signalling pathways, although without limitation thereto.
[0113] In other embodiments, the antibody or antibody fragment may be coupled or conjugated to a cytotoxic agent that facilitates killing or disabling tumour cells that express proteolytically active ADAM. The cytotoxic agent may be a radionuclide, a chemotherapeutic drug, a mutagen, a toxin, a mitosis inhibitor or other anti-proliferative agent, a pro-apoptotic agent, a DNA intercalating agent or any other agent that assists or causes killing or disabling of tumour cells. Non-limiting examples of radionuclides include .sup.211At, .sup.212B1, .sup.213Bi.sup., 125I, .sup.111In, .sup.193Pt and .sup.67Ga, although without limitation thereto.
[0114] Chemotherapeutic drugs, mutagens, toxins, mitosis inhibitors, pro-apoptotic agents and DNA intercalating agents may include doxorubicin, N-acetyl-?-calicheamicin, maytansinoids, taxoids, auristatins and duocarmycins, although without limitation thereto. Chemotherapeutic drugs, mutagens, toxins, mitosis inhibitors, pro-apoptotic agents and DNA intercalating agents may be coupled to the antibody or antibody fragment by a cleavable or non-cleavable linker to form an antibody-drug conjugate (ADC). Typically, the ADC is internalized by the tumour cell where the cleavable linker is cleaved to release the drug into the cell. In the case of non-cleavable linkers, these may be preferred where it is essential that the drug is entirely localized to the targeted tumour cell and there is no leakage of the drug from the targeted tumour cell into adjacent cells, tissues or fluids. In some embodiments, the chemotherapeutic drugs, mutagens, toxins, mitosis inhibitors, pro-apoptotic and DNA intercalating agents may be in the form of a pro-drug which is activated upon internalization inside a targeted tumour cell.
[0115] In other embodiments, the method and/or composition may include a combination therapy where the antibody or antibody fragment disclosed herein (e.g 8C7 mAb) is combined with another therapy including but mot limited to radiotherapy, chemotherapy, natural or holistic therapies or other immunotherapies that target cancers. By way of example, the antibody or antibody fragment disclosed herein (e.g 8C7 mAb) may be administered in combination with another therapeutic agent such as one or more chemotherapeutic drugs, antibodies, mutagens, toxins, mitosis inhibitors, pro-apoptotic agents and/or DNA intercalating agents, such as hereinbefore described. In these embodiments, the antibody or antibody fragment and said another therapeutic agent are not coupled or conjugated, but are administered as separate molecules together or sequentially. A non-limiting example is combination therapy with irenotecan, a chemotherapeutic agent used to treat colorectal cancer.
[0116] Suitably, the antibody or antibody fragment and optionally, said another therapeutic agent, is administered to a mammal as a pharmaceutical composition comprising a pharmaceutically-acceptable carrier, diluent or excipient.
[0117] By pharmaceutically-acceptable carrier, diluent or excipient is meant a solid or liquid filler, diluent or encapsulating substance that may be safely used in systemic administration. Depending upon the particular route of administration, a variety of carriers, well known in the art may be used. These carriers may be selected from a group including sugars, starches, cellulose and its derivatives, malt, gelatine, talc, calcium sulfate, liposomes and other lipid-based carriers, vegetable oils, synthetic oils, polyols, alginic acid, phosphate buffered solutions, emulsifiers, isotonic saline and salts such as mineral acid salts including hydrochlorides, bromides and sulfates, organic acids such as acetates, propionates and malonates and pyrogen-free water.
[0118] A useful reference describing pharmaceutically acceptable carriers, diluents and excipients is Remington's Pharmaceutical Sciences (Mack Publishing Co. N.J. USA, 1991), which is incorporated herein by reference.
[0119] Any safe route of administration may be employed for providing a patient with the composition of the invention. For example, oral, rectal, parenteral, sublingual, buccal, intravenous, intra-articular, intra-muscular, intra-dermal, subcutaneous, inhalational, intraocular, intraperitoneal, intracerebroventricular, transdermal and the like may be employed. Intra-muscular and subcutaneous injection is appropriate, for example, for administration of immunotherapeutic compositions, proteinaceous vaccines and nucleic acid vaccines.
[0120] Dosage forms include tablets, dispersions, suspensions, injections, solutions, syrups, troches, capsules, suppositories, aerosols, transdermal patches and the like. These dosage forms may also include injecting or implanting controlled releasing devices designed specifically for this purpose or other forms of implants modified to act additionally in this fashion. Controlled release of the therapeutic agent may be effected by coating the same, for example, with hydrophobic polymers including acrylic resins, waxes, higher aliphatic alcohols, polylactic and polyglycolic acids and certain cellulose derivatives such as hydroxypropylmethyl cellulose. In addition, the controlled release may be effected by using other polymer matrices, liposomes and/or microspheres.
[0121] Compositions of the present invention suitable for oral or parenteral administration may be presented as discrete units such as capsules, sachets or tablets each containing a pre -determined amount of one or more therapeutic agents of the invention, as a powder or granules or as a solution or a suspension in an aqueous liquid, a non-aqueous liquid, an oil-in-water emulsion or a water-in-oil liquid emulsion. Such compositions may be prepared by any of the methods of pharmacy but all methods include the step of bringing into association one or more agents as described above with the carrier which constitutes one or more necessary ingredients. In general, the compositions are prepared by uniformly and intimately admixing the agents of the invention with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product into the desired presentation.
[0122] The above compositions may be administered in a manner compatible with the dosage formulation, and in such amount as is pharmaceutically-effective. The dose administered to a patient, in the context of the present invention, should be sufficient to effect a beneficial response in a patient over an appropriate period of time. The quantity of agent(s) to be administered may depend on the subject to be treated inclusive of the age, sex, weight and general health condition thereof, factors that will depend on the judgement of the practitioner.
[0123] The methods and compositions of the invention may be applicable to any mammal in which an ADAM10 protease is expressed by tumour cells.
[0124] In some embodiments, the tumours comprise tumour cells that co-express relatively increased levels of a proteolytically active form of an ADAM protease and CD133. The tumour cells may further express one or more members of the Notch, Eph and/or erbB receptor families. Non-limiting examples of cancers or tumours that may be treated or prevented include leukemias and lymphomas, lung cancer, colon cancer, adenomas, neuroblastomas, brain, renal and kidney tumours, prostate cancers, sarcomas and melanoma.
[0125] In particular embodiments, the term mammal includes but is not limited to humans, performance animals (such as horses, camels, greyhounds), livestock (such as cows, sheep, horses) and companion animals (such as cats and dogs).
[0126] So that the present invention may be more readily understood and put into practical effect, the skilled person is referred to the following non-limiting examples.
EXAMPLES
Introduction
[0127] We previously defined the structure of the ADAM10 D+C domains and identified a substrate-binding pocket within the C domain that specifies ligand cleavage.sup.6. To further define the function of the substrate binding pocket, we raised antibodies against ADAM10, one of which, mAb8C7, specifically recognises the substrate binding domain, and inhibits ADAM10-mediated cleavage of Eph receptor ligands (ephrins) and ephrin/Eph-dependent signalling and cell segregation in vitro.sup.27. We thus sought to test 8C7 as a targeted therapeutic in tumour models. We find 8C7 treatment inhibits tumour growth of human colon xenografts, at least in part due to inhibition of Notch signalling, and down-regulation of Notch, EGFR and Eph receptor levels. In line with the critical role of Notch in maintenance of an undifferentiated cell phenotype, including that of tumour initiating colon cancer cells.sup.29,19, we find 8C7 selectively targets tumour cells expressing the putative cancer stem cell (CSC) marker CD133 and displaying active Notch-signalling within tumours.sup.30. CSCs are known to contribute to chemotherapy resistance, and accordingly, 8C7 reduces CSC levels and effectively inhibits tumour re-growth following chemotherapy. Importantly, we demonstrate that 8C7 selectively binds an active form of ADAM10, which we find to be over-expressed in mouse tumour models and in several human solid tumours, suggesting its potential as human cancer therapeutic and diagnostic.
Materials & Methods
[0128] Cell Culture and Reagents
[0129] Human colorectal carcinoma cell line LIM1250 (obtained from the Ludwig Institute for Cancer Research, Melbourne, Australia) was maintained in RPMI 1640/10% FCS in 10% CO.sub.2/90% air. ADAM10?/? mouse embryonic fibroblasts.sup.5 were maintained in DMEM 10% FCS in 5% CO.sub.2/95% air atmosphere.
[0130] Mutagenesis
[0131] The sequence encoding full length human (OriGene) ADAM10 was subcloned into pcDNA3.1 vector (Invitrogen), including an N-terminal prolactin signal sequence and a C -terminal thrombin cleavage site. AxxA point mutation to human ADAM10-turbo -myc(OriGene) was introduced by site-directed mutagenesis (Quickchange XL, Stratagene) by introducing Alanines at Cys594 and Cys597 respectively. Mutants were transfected into MEF ADAM10?/? using X-treme transfection reagent (Roche) to confirm its expression by Western blot and Immunofluorence.
[0132] Immunoprecipitation and Western Blotting
[0133] Frozen human tissue samples were obtained from surgical biopsies between 1995 and 2007, held at the Austin Health Tissue Bank, under approval from the Monash University Human Research Ethics Committee. For protein analysis of tumours and tissues, 50 mg tissue was homogenised in 1 ml RIPA buffer (50 mM Tris-HCL pH 7.4, 150 mM NaCl, 1% Triton-X -100, 0.5% Sodium Deoxycholate, 0.1% SDS, phosphatase and protease inhibitor cocktail); and protein concentration determined by BCA assay (Pierce). 20 ug of total lysates or immunoprecipitates from 100 ug of lysates were analysed by SDS-PAGE and Western blot. After various treatments, including exposure to 1 mM DTT, 40 mM H.sub.2O.sub.2, 1 ?g/mL EGF or 1.5 ?g/mL cross-linked EphrinA5-Fc{Lawrenson, 2002 #237}, and after 3 washes in PBS cell lysates were prepared in KALB lysis buffer (1.5 M NaCl, 0.5 M HEPES, 0.05 M EDTA, pH 7.4, 1% Triton X-100, phosphatase and protease inhibitor cocktail); loading levels for analysis were equalised on the basis of actin levels by performing Western blot analysis on cell lysates. Immunoprecipitation was done with mAb8C7 or with mAb4A11-coupled to Minileak beads (according to manufacturers instructions, KEM EN TEC, Denmark), or with soluble 8C7 or anti-ADAM10 polyclonal antibodies (pAb) (Abcam pAb 39177) followed by Protein A Sepharose. ADAM10 was detected on Western blots with Abcam pAb 39177 and anti-rabbit -HRP secondary antibodies and visualized using an ECL substrate (Supersignal; Thermo Fisher Scientific). Samples reduced in SDS-samples buffer with 20 mM Dithiothreitol (5 min, 95? C.) or left non-reduced were routinely analysed.
[0134] Maleimide-Biotinylation of Free Cysteine Residues
[0135] LIM1215 colon carcinoma cells were starved overnight in serum free RPMI and used at 80% confluency. Cells were treated with 2.5 mM Methyl-PEG12-maleimide (MPM, Thermo Scientific) in serum free RPMI for 30 min at 4? C. to label any free cell surface protein cysteines. After three washes (PBS) cells were treated at room temperature with 5 ?g/ml Protein Disulfide Isomerase (PDI, Sigma), or 10 ?M DTT for indicated times. Following washes (PBS), free cysteines that formed after PDI treatment was reacted with Maleimide -PEG2-biotin (MPB) (Thermo Scientific) in serum free RPMI for 1 hour at 4? C. For analysis, washed (PBS) cells were lysed in KALB lysis buffer containing 5 mM N-ethylmaleimide prior to IP and Western blot analysis.
[0136] In-vitro biotinylation of 8C7 and 4A11 immunoprecipitates was performed in a similar manner using total washed IPs from LIM1215 cells.
[0137] Furin cleavage
[0138] mAb8C7 and 4A11 IPs from LIM1215 cell lysates were treated with furin (1 unit/100 ?l, New England Biolabs) in a buffer specified by the supplier (100 mM HEPES, pH 7.5 @ 25? C., 0.5% Triton X-100, 1 mM CaCl2) for 2 hours at 37? C. Samples were washed three times with PBS, prior to treatment with SDS-PAGE sample buffer (95? C., 5 min) and Western blot analysis.
[0139] Activity Assay
[0140] ADAM10 was immunoprecipitated (IPed) by mixing 8C7 and 4A11 mAbs coupled to mini-leak beads with LIM1215 colon carcinoma cell lysates and human colorectal tumour lysates. IPs were treated with Mca-PLAQAV-Dpa-RSSSR-NH2 fluorogenic peptide substrate (R&D Systems, USA, cat No, ES003), 10 ?M at 37? C. for 1 hour, or using HPLC-purified monomeric ephrinA5-Fc{Vearing, 2005 #3050} at 50 ?g/mL at room temperature for 20 mins. Fluorescence substrate supernatants were analysed using a FLUOstar OPTIMA (BMG Labtech) plate reader at 320 nm excitation and 405 emission wavelengths, cleavage of ephrin -A5 Fc analysed by Western blot analysis with ?-ephrinA5 antibodies (R&D Systems, USA).
[0141] Tissue Immunohistochemistry and Immunofluorescence
[0142] Tissues were OCT-embedded (Tissue-TEK), sectioned (6-?m) and fixed (10 min, acetone). For IHC, Vector Labs ABC secondary antibody staining kit was used to detect the bound primary antibodies. Sections, counterstained with Haemotoxylin were imaged on an Olympus DotSlide system. For TUNEL, tumours were formalin fixed and paraffin-embedded. For IF, sections were incubated with directly conjugated primary or secondary antibodies, nuclei counterstained with Hoechst, and slides mounted with Fluoromount (Southern Biotech, Birmingham, Ala. USA) for imaging on a Leica confocal (SP5) microscope.
[0143] Flow Cytometry
[0144] Single cell suspensions were made from LIM1215 tumours by digesting tumour pieces with Collagenase Type 3/Deoxyribonuclease I (Worthington Biochemical Corp.) in HBBS (Gibco, Invitrogen, 1 h, 37? C.), filtering through successive 40 ?m and 20 ?m sieves and treatment with Red Blood cell lysing buffer (Sigma-Aldrich). Cells were labelled with conjugated anti-CD133 (Miltenyi Biotec) and FACS sorted on an Influx Cell Sorter (BD biosciences). Dead cells were detected with propidium iodide. For analysis of cell cultures, trypsinised cells were washed with FACS buffer (PBS, 1% FCS, 1 mM EDTA), and labelled for 30 min at 4? C. with fluorophore-conjugated mAbs as indicated, before analysis on a LSRII flow cytometer (Beckton Dickenson). Subsequent analysis was with FLOWJO software (TreeStar, Calif.).
[0145] Detection of Reactive Oxygen Species (ROS) in Tumour Cell Isolates
[0146] Tumours from mice injected with alexa-labelled 8C7 (100 ?ug) were recovered and cell suspensions prepared as above. FACS sorted 8C7 bound/unbound tumour cells were tested using a reaction mix that included 50 ?M Amplex Red (Invitrogen) and 0. 1U/ml HRP (Invitrogen) in Krebs Ringer Phosphate. 20 ?l of 8C7 bound tumour cells (a total of 5?10.sup.4) were added to 100 ?l of the pre-warmed reaction mixture and incubated 1 hour at 37? C. A microplate reader (CLARIOstar, BMG Labtech) was used to measure fluorescence (Excitation 530-560 nm and emission peak 590 nm).
[0147] Xenograft Experiments
[0148] Athymic nude mice (BALB/c, 4- to 6-week old; male) were from Animal Resources Centre, Canning Vale, WA, Australia. Animal procedures were conducted in accordance with guidelines of the Monash University Animal Ethics Committee. 7?10.sup.6 LIM1250 cells in 200 ul PBS/30% growth factor reduced Matrigel (BD Biosciences) were injected subcutaneously in the dorsal flanks of the mice. Once tumour volumes reached 75-150 mm.sup.3 (measured by callipers), mice were treated twice weekly by IP injection with either PBS, 8C7 or control antibody as indicated. Tumours and tissues were recovered for protein analysis, imaging by immunofluorescence microscopy or IHC, or flow cytometry.
[0149] Crystallization, Data Collection and Structure Determination
[0150] Expression and Purification of ADAM10 Disintegrin (D) and Cysteine (C) Rich Domain
[0151] The sequence encoding bovine ADAM10 disintegrin and cysteine-rich domains (residues 455-646) (ADAM10: D+C) was subcloned as Fc fusion into a pcDNA3.1 vector (Invitrogen), including an N-terminal prolactin signal sequence and a C-terminal thrombin cleavage site followed by the Fc domain of human IgG, for expression in human embryonic kidney 293 (HEK293) cells. A stable cell line expressing ADAM10:D+C was generated. Roller bottles were used for large-scale expression of the protein. The initial purification was performed on a Protein-A-Sepharose (Amersham) column and the protein was eluted with 100 mM glycine, 150 mM NaCl pH 3.0. The Fc tag was removed by thrombin cleavage, and ADAM10:D+C was further purified to homogeneity by gel filtration chromatography (SD -200, buffer 20mM HEPES, 150 mM NaCl, pH7.5). The protein eluted as a monomer (33 kDa). The two ADAM10:D+C bands on the SDS gels correspond to differently glycosylated forms of the recombinant protein and converge into a single band upon enzymatic deglycosylation.
[0152] Preparation of F(ab)2Fragment of the 8C7 Monoclonal Antibody
[0153] The F(ab).sub.2 fragment was prepared by digesting the whole IgG (8C7) with pepsin at pH 3.0 (enzyme: substrate ratio 1:100). The reaction was terminated after 2 hrs incubation at room temperature by raising the pH to 8.0. The final purification was performed using gel filtration chromatography (SD-200, buffer 20 mM HEPES, 150 mM NaCl, pH 7.5). The protein eluted as a monomer with molecular weight of approximately 110 kDa.
[0154] Crystallization and Structure Determination
[0155] For crystallization trials, ADAM10:D+C was mixed with F(ab)2 at 2:1 molar ratio (final concentration 20 mg/ml) in a buffer containing 20 mM HEPES, 150 mM NaCl, and pH 7.5. The complex was crystallized in a hanging drop by vapor diffusion at room temperature against a reservoir containing 0.1 M HEPES, 0.2 M NaCl, and 1.6M ammonium sulfate pH 7.5. Sizable crystals, (space group P2.sub.12.sub.12.sub.1; Unit cell: 53.2, 141.7, 268.1, 90.0, 90.0, 90.0) grew after 2 months but could be reproduced in 2 to 3 days using the additive 30% 1, 4 Dioxane. The structure was determined at 2.75 A resolution using molecular replacement.
Results
[0156] Systemic Treatment with the Anti-ADAM10 mAb 8C7 Inhibits Tumour Growth, Preferentially Targeting Notch-active CD133+Tumour Cells.
[0157] We sought to test the effect of anti-ADAM10 mAb8C7 on tumours which co -express high levels of the ADAM10-dependent Notch, Eph, and erbB receptor families. By screening a panel of human colorectal cancer (CRC) cell lines in which these pathways are commonly de-regulated.sup.31, we selected LIM1215 cells, which express high levels of EGFR, EphA2 and ADAM10, are known to be dependent on autocrine EGFR signalling in a mouse xenograft setting.sup.32, and also express high levels of Notch1 and 2, and the notch ligands Jagged 1 and 2.
[0158] Systemic treatment of mice bearing LIM1215 xenografts with mAb8C7 (8C7) caused a significant, dose-dependent inhibition of tumour growth, as measured by tumour volume and weight (
[0159] To analyse 8C7 targeting within the tumour, we injected LIM tumour xenograft -bearing mice with Alexa.sup.647-labelled 8C7 and, to label the vasculature, three days later with Rhodamine-labelled Ricininus Communis Agglutinin ([Rhodamine] RCA)-lectin, before tumours were resected and sections analysed by confocal microscopy. We observed mAb8C7 binding to the tumour tissue, particularly within the outer margin and around blood vessels, visible by [Rhodamine] RCA-lectin staining (
[0160] Recently, colon carcinoma initiating cells, marked by expression of the putative stem cell marker CD133 and by active notch signalling, have been found, selectively associated with Notch ligand Jagged-1-expressing vascular endothelial cells, in colon tumour xenografts.sup.30. We therefore co-stained 8C7-injected LIM1215 colon tumour xenografts with antibodies against CD133 and against the Notch intracellular domain (NICD), generated during active Notch signalling by serial cleavage by ?- and ?-secretases. Notably, mAb 8C7 preferentially targeted an anti-CD133-stained cell population, in addition to co-staining anti -NICD1 and NICD2 positive cells (
[0161] mAb 8C7 Binding to ADAM10 Prevents Notch Cleavage and Activation
[0162] Since our anti-ADAM10 mAb 8C7 preferentially targeted cells with active Notch signalling and inhibited tumour growth, and we previously showed its ability to inhibit ADAM10-mediated Eph receptor signalling.sup.27, we sought to determine if 8C7 also inhibits Notch signalling. We treated mice bearing LIM1215 tumours for 3 weeks (when tumour growth rate was most affected) before recovering tumours and analysing by Western blot with anti-NICD1 antibody. Comparison of 8C7 and control-treated tumours showed a significant decrease in levels of active Notch (
[0163] We also used a co-culture model in which Notch-dependent lymphoma survival and proliferation is afforded by contact with Jagged1-expressing vascular endothelial cell (HUVEC) feeder cells, which have been transduced with the adenoviral gene fragment E4ORF1 to drive Akt auto-activation and allow their serum-free propagation.sup.37 (
[0164] mAb 8C7 Preferentially Recognises a High Molecular Weight Form of ADAM10 Found Predominantly in Tumour Tissues.
[0165] The preferential binding of 8C7 to tumour cells containing elevated Notch signalling prompted us to further investigate the selectivity of 8C7 in tumour-bearing mice. While we previously demonstrated 8C7 binding to mouse ADAM10.sup.27, comparison of tumour and organ tissues from mice, injected 3 days prior with Alexa.sup.647-labelled 8C7, showed robust staining in tumours, as compared to undetectable staining in all other organs tested, apart from the liver (
[0166] To assess if 8C7 also recognises the ADAM10 HMW form in other tumour models, we analysed stomach tissue from GP130F knock-in mice.sup.38,39, a transgenic mouse strain that spontaneously forms stomach adenomas in 5-6 weeks old mice. While at 3.5 weeks the HMW ADAM10 was barely detectable in stomach tissue, at 5 and 6 weeks the HMW form was clearly elevated, both in stomach adenomas and in associated stomach tissue, but not in similarly aged wild-type (Wt) mice (
[0167] Considering the apparent diagnostic detection by 8C7 of the HMW form of ADAM10 in mouse tumours, we then went on to test human tumour tissues by immunoprecipitation (IP) with 8C7 or a control anti-human ADAM10 mAb (4A11). 4A11 IPs from colon tumour tissue showed a somewhat increased ratio of HMW/LMW ADAM10 compared to apparently normal colon tissue, while remarkably 8C7 specifically recognised the HMW form in human tumour tissue lysate (
[0168] The HMW Form of ADAM10 Recognised by 8C7 Represents the Active Protease.
[0169] The above data suggests that 8C7 preferentially targets an unprocessed form of ADAM10 that appears to be elevated in tumours, whereby conversion of full length unprocessed ADAM10 involves release by furin or other pro-protein convertases of the N -terminal prodomain, shown to control ADAM stability and protease activity.sup.40. We confirmed the HMW form as non-processed ADAM10, since incubation with furin resulted in conversion into LMW ADAM10 (
[0170] Pro-domain processing is generally considered to generate the active form of ADAMs by releasing the Pro domain, which in turn can interact with and inhibit the mature metalloprotease, although for ADAM10 and 17 this does not occur via the cysteine switch mechanism of other metalloproteases.sup.40. Indeed, in the case of ADAM10 and 17, the Pro domain may have a necessary chaperone function, since addition of recombinant Pro domain rescues the activity of an inactive, prodomain-deleted form of ADAM10.sup.41, while ADAM17 can be activated on the cell surface without requiring removal of the Pro domain.sup.42. We therefore tested if 8C7 targeted ADAM10 represents an active or inactive population. MAb 8C7 and 4A11 IP from LIM1215 cells again showed preferential binding of 8C7 to ADAM10 enriched in the BMW form, while 4A11, similar to a commercial pAb against the cytoplasmic domain.sup.27, appeared to bind non-discriminately to both HMW and LMW bands (
[0171] The 8C7 Binding Epitope Implicates the ADAM10 Thioredoxin CXXC Motif, Involved in Regulating ADAM10 Conformation and Activity
[0172] We previously demonstrated that 8C7 binds the Cysteine-rich (C) domain of ADAM10.sup.27, and earlier had elucidated its protein structure in context with the adjacent Disintegrin (D) domain, revealing a continuous, elongated, slightly curved structure harbouring a negatively charged pocket mediating ADAM10-substrate recognition.sup.6. To define the exact binding site of 8C7 we determined the protein crystal structure of the ADAM10-D+C domain fragment in complex with a F(ab).sub.2 fragment of 8C7 at 2.8 ? A resolution (Table 1). A model of? the structure of the complex is illustrated in
[0173] In view of these findings, we tested if 8C7 binding to ADAM10 was dependent on modulation of the CxxC motif. Alanine replacement mutation to AxxA clearly ablated binding of 8C7, but not of control antibodies (
[0174] We also found 8C7-bound cells recovered from tumours showed markedly higher production of reactive oxygen species (ROS) compared to unbound (8C7 negative) cells (
[0175] Together these observations supported the notion that the preferential binding of 8C7 to the active conformation of ADAM10 may be modulated by disulfide rearrangement within the CXXC motif. We therefore assessed if ADAM10 does contain PDI-modulated cysteines, as recently suggested from MS analysis of labile cysteins in leukocyte cell surface proteins.sup.46. Following blocking of free cysteines with Methyl-PEG12-maleimide (MPM), 8C7 and 4A11 IPs from LIM1215 lysates were treated first with PDI, followed by Maleimide -PEG2-biotin (MPB) to label the free cysteines that had been generated via PDI activity. Western blot analysis of IPs using anti-ADAM10 antibodies and Streptavidin-HRP to detect cysteine-biotinylated proteins, revealed that PDI caused a marked increase in biotin labelled ADAM10, especially from 8C7 IPs (
[0176] We then investigated if the 8C7-targeted, active ADAM10 displays distinct protein interactions in cells compared to the overall interactions of ADAM10 bound by the non -selective 4A11 antibody. We used 8C7 and 4A11 immunoprecipitates from LIM1215 cell lysates, equalised for ADAM10 levels by Western blot, and resolved by SDS-PAGE and Coomassie Blue staining. Excised bands of various MW were then analysed by Mass Spectrometry to generate an unbiased comparison of 8C7- and 4A11-co-immunoprecipiated proteins. This revealed some marked differences, including preferential association of 8C7-bound ADAM10 with notch and other ADAM-regulated receptors. We confirmed this by co -immunoprecipitation and Western blot (
[0177] Cancer stem-cells maintained by Notch signalling are thought to contribute to tumour chemoresistance, as well as metastasis and epithelial to mesenchymal transition (EMT).sup.56,57 Since 8C7 particularly targets these cells, as indicated by co-staining with the stem cell marker CD133 and active Notch (NICD) (
[0178] 8C7 clearly inhibits signalling by Notch (
[0179] Lastly, the association of 8C7-bound ADAM10 with erbB receptors lead us to test effects of 8C7 on proliferation of breast cancer cells over-expressing these receptors, in which they drive proliferation. Indeed, 8C7 was able to inhibit proliferation of breast cancer cell lines SKBR3 (high erbB2) and MDA-MB-231 (high EGFR/erbB1), as well as LIM1215 colon cancer cells (
DISCUSSION
[0180] Emerging evidence suggests that ADAM10 and 17 activities may be regulated by adopting latent and active conformations. This suggestion was first based on crystal structures of the related snake venom metalloproteinases, which adopt two different conformations that are stabilized by distinct disulphide connectivity of the D domain.sup.19,?: a closed, C-shaped conformation seen in Atragin, that positions the active site cleft towards the substrate-binding C domain, suggested to deny substrate access; and an open, I-shaped conformation, exemplified by K-like, suggested to allow substrate access and promote cleavage.sup.20. The ADAM10D+C structure does not correlate directly with either formwhile it shows sequence homology with Atragin it has a distinct disulfide bond pattern. However, the C-terminal part of the D domain and the N-terminal part of the C domain of the ADAM10 structure resembles the analogous region of the snake venom ADAM homologue VAP1 (termed the D.sub.a and C.sub.w domains), being super-imposable and having an analogous disulfide pattern.sup.19 . The structure differs however in orientation of the C-terminal part of the C domain (the C.sub.h domain) due to an additional sequence loop and differing disulfide bonds around it, leading to its reversed orientation relative to the C.sub.w/D.sub.a domains. Notably, the distinct disulfide linked Cysteines include the redoxin CxxC motif, which lies directly adjacent to the loop. Thus, while the VAP1 structure is C-shaped, disulfide isomerisation of bonds within the CxxC motif would be expected to alter the conformation, and thus potentially substrate access and cleavage.
[0181] Prior evidence that disulfide isomerisation of ADAMs indeed occurs and modulates activity comes from studies on ADAM17, which show that its activity is inhibited by mutation of the analogous CxxC motif, and is regulated by modulating redox conditions.sup.43. Furthermore, these redox effects were shown to occur through modulation of protein disulfide isomerase (PDI) activity, where PDI modulated both activity of ADAM17 and its recognition by conformation-dependent antibodies.sup.44. Oxidative conditions were shown to favour activity, and suggested to inhibit PDI from catalysing a shift from an active to an inactive conformation.
[0182] We now describe a novel antibody, 8C7, which recognises a specific conformation of the ADAM10 substrate binding domain dependent on CxxC bonding. 8C7 binding is blocked by mutation of the CxxC motif, and is altered by modulating the redox environment. Moreover, biotin-labelling of labile cysteines with Maleimide-PEG2-biotin (MPB) inhibited binding of 8C7, but not a control ADAM10 mAb, suggesting 8C7 indeed binds labile, redox -modulated cysteines. Furthermore, our determination of the structure of 8C7 in complex with ADAM10 shows binding next to C639, disulfide-bonded to C594 in the CxxC motif. Our evidence suggests the 8C7-recognised conformation is active, since 8C7-immunoprecipitates of ADAM10 showed highly significant enrichment of protease activity. Also, oxidative conditions, known to enhance ADAM activity, favoured 8C7 binding. Experiments are underway to define the disulfide bonding pattern and structure of the presumed alternate, inactive ADAM10 C domain conformation. Interestingly, a recent NMR study shows two distinct, PDI-regulated conformations of bacterially expressed ADAM17, with distinct CxxC linkages, supporting the notion of CxxC isomerisation, although the activities of the two forms or their relevance for mammalian-expressed ADAM17 was not assessed.sup.47. The analogous changes in ADAM10 would correspond to the C.sub.594-C.sub.639 linkage in our 8C7-bound structure swapping to C.sub.594-C.sub.632, accommodated by a further change from C.sub.632-C.sub.645 to C.sub.639-C.sub.645.
[0183] Importantly, the apparent selectivity of 8C7 for active ADAM10 translates to selectivity for ADAM10 in tumours compared to other, normal tissues in both mouse models (CRC xenograft model and the GP13OFF model of spontaneous gastric tumour formation), and in human tumour samples. This suggests 8C7 as a potentially powerful diagnostic for ADAM10 activity in tumours. Interestingly the 8C7-recognised form of ADAM10 that was specific to tumours was largely a HMW, unprocessed form, which we confirmed is present on the cell surface and is cleavable by furin. While the ADAM10 Pro domain is known to have an inhibitory function, it also has an essential chaperone function.sup.41, and ADAM10 Pro domain mutations which likely disrupt this function have recently been shown to attenuate ADAM10 activity in late onset Alzheimer's disease.sup.48. Moreover, reversible activation of unprocessed ADAM17 has recently been demonstrated.sup.42. Therefore, it is likely the unprocessed ADAM10 prevalent in tumours is similarly readily activated, and the high level of 8C7 binding indicates a high degree of activity in tumours. This activity is most likely supported by high levels of ROS in the tumour microenvironment.sup.49, favouring the active ADAM10 isomer.
[0184] As well as preferentially targeting tumours 8C7, significantly inhibited tumour growth. We previously found 8C7 inhibited ADAM10 mediated shedding of the Eph receptor ligand ephrin-A5, thus attenuating Eph receptor tyrosine phosphorylation and Eph-mediated cell segregation.sup.22. This is consistent with its targeting the substrate binding domain, which we previously showed is necessary for ephrin cleavage.sup.6. While the LIM1215 tumours expressed high levels of EphA2 we could not detect phosphorylation, consistent with known Eph kinase -independent function in tumours.sup.50-52, so a direct effect on Eph activity in tumours was not detectable. Rather we noted a dramatic down-regulation of EphA2 expression, and also of Notch receptors. A role for ADAM10 in Notch signalling is well established, and since Notch acts to modulate transcription of a variety of targets, including Eph receptors/ligands and Notch itself, we investigated effects of 8C7 on Notch activity. Treatment of tumour-bearing mice inhibited production of the cleaved active NICD in tumours, and there was also significant down-regulation of Notch-induced target genes (Hes1, Hey1). There was also decreased vascularity of 8C7-treated tumours consistent with inhibited Notch signalling. Treatment of isolated tumour cells also inhibited Notch activity, suggesting a direct effect on Notch. We further tested 8C7 in a separate in vitro assay of Notch-dependent lymphoma cell survival and proliferation, which confirmed a marked inhibition indicative of attenuated Notch signalling. Thus, 8C7-inhibition of tumour growth appears to be at least partially due to inhibition of Notch activity, although effects on other ADAM10-targets are also being investigated.
[0185] Notably, while 8C7 bound to the tumour mass, it was clearly most strongly bound to a distinct population of cells within tumours which were closely associated with blood vessels, and which expressed the putative tumour stem cell marker CD133. A recent study has described CD133+ cells in perivascular regions of human CRC, which display elevated Notch signalling due to ADAM17-mediated release of the ligand Jagged-1 from the endothelial cells.sup.30. In agreement we find 8C7-targeted CD133+ cells show high levels of NICD1 and 2, both by immunofluorescence staining of tumours and by analysis of CD133+sorted cells by Western blot. Treatment of these cells in vitro with 8C7 also inhibited Notch activity and down -regulated Notch target genes. This suggests that 8C7 inhibition of ADAM10 activity is particularly acting on a subpopulation of tumour cells previously identified as having a stem cell phenotype. Since stem cells are believed to initiate and sustain tumour growth, and to mediate chemoresistance due to their slow cycling, the specific targeting of this population by 8C7, and its inhibitory effects on tumour growth, combined with its selectivity for active conformation of ADAM10 in tumours, indicate considerable potential for therapy. In support, we find 8C7 effectively blocks tumour regrowth following chemotherapy, and specifically depletes CD133+cells.
[0186] Humanised Versions of Anti-ADAM10 mAb 8C7 and Effects on erbB Receptor Over-Expressing Breast Cancer Cells
[0187] We have produced a human and mouse chimerised version of mAb 8C7 (ch8C7), which retains the antigen-binding variable regions from murine 8C7 in a human IgG1-? light and heavy constant region framework, and demonstrated identical binding of mu8C7 and ch8C7 to immobilised recombinant huADAM10D+C domain protein (see
[0188] We also engineered a fully humanised version of 8C7 (hu8C7), as human IgG1-x subtype, due to its capacity for preferential activation of Fc?RIII receptors on phagocytes eliciting antibody-dependent cellular cytotoxicity (ADCC). Homology modelling was used to identify human heavy chain and light chain variable region sequences closest to antibody germline sequences (SEQ ID NOS:3 and 4;
[0189] The human immunoglobulin IgG1-? light and heavy constant region sequences used to produce hu8C7 with ch8C7 are shown in
[0190] We compared binding and activity of hu8C7 with ch8C7, which shares the same Fc region as hu8C7, allowing unbiased comparison of binding to ADAM10 in cells and cell lysates using identical Fc-binding reagents. Binding affinity measurements of hu8C7 to immobilised recombinant huADAM10D+C protein were comparable to ch8C7 (
[0191] Finally, we tested effects of our antibodies on HER/erbB receptor over-expressing breast cancer cells. ADAM10 is known to mediate erbB2 shedding, implicated in constitutive signalling, proliferation and Herceptin resistance [63, 64]. We have found that 8C7 treatment is able to inhibit constitutive shedding of the extracellular domain of erbB2 into cell -conditioned medium, and also unexpectedly of the erbB1/EGF receptor (
[0192] Throughout this specification, the aim has been to describe the preferred embodiments of the invention without limiting the invention to any one embodiment or specific collection of features. Various changes and modifications may be made to the embodiments described and illustrated herein without departing from the broad spirit and scope of the invention.
[0193] All computer programs, algorithms, patent and scientific literature referred to herein is incorporated herein by reference in their entirety.
REFERENCES
[0194] 1 Murphy, G. The ADAMs: signalling scissors in the tumour microenvironment. Nat Rev Cancer (2008) 8, 929-941 [0195] 2 Mochizuki, S et al. ADAMs in cancer cell proliferation and progression. Cancer Sci (2007) 98, 621-628 [0196] 3 Hartmann, M et al. Who decides when to cleave an ectodomain? Trends Biochem Sci (2013) 38, 111-120 [0197] 4 Saftig, P et al. The A Disintegrin And Metalloproteases ADAM10 and ADAM17: novel drug targets with therapeutic potential? Eur J Cell Biol (2011) 90, 527-535 [0198] 5 Hartmann, D et al. The disintegrin/metalloprotease ADAM 10 is essential for Notch signalling but not for alpha-secretase activity in fibroblasts. Hum Mol Genet (2002) 11, 2615-2624 [0199] 6 Janes, P W et al. Adam Meets Eph: An ADAM Substrate Recognition Module Acts as a Molecular Switch for Ephrin Cleavage In trans. Cell (2005) 123, 291-304 [0200] 7 Hattori, M et al. Regulated cleavage of a contact-mediated axon repellent. Science (2000) 289, 1360-1365 [0201] 8 Sahin, U et al. Distinct roles for ADAM10 and ADAM17 in ectodomain shedding of six EGFR ligands. J Cell Biol (2004) 164, 769-779 [0202] 9 Reiss, K et al. ADAM10 cleavage of N-cadherin and regulation of cell-cell adhesion and beta-catenin nuclear signalling. EMBO J (2005) 24, 742-752 [0203] 10 LaVoie, M J et al. The Notch Ligands, Jagged and Delta, Are Sequentially Processed by ?-Secretase and Presenilin/?-Secretase and Release Signaling Fragments. Journal of Biological Chemistry (2003) 278, 34427-34437 [0204] 11 Kopan, R et al. The Canonical Notch Signaling Pathway: Unfolding the Activation Mechanism. Cell (2009) 137, 216-233 [0205] 12 Ranganathan, P et al. Notch signalling in solid tumours: a little bit of everything but not all the time. Nat Rev Cancer (2011) 11, 338-351 [0206] 13 Roca, C et al. Regulation of vascular morphogenesis by Notch signaling. Genes Dev (2007) 21, 2511-2524 [0207] 14 Groth, C et al. Therapeutic approaches to modulating Notch signaling: Current challenges and future prospects. Semin Cell Dev Biol (2012) [0208] 15 Dikic, I et al. Notch: Implications of endogenous inhibitors for therapy. Bioessays (2010) 32, 481-487 [0209] 16 DasGupta, S et al. Current perspective of TACE inhibitors: A review. Bioorganic & Medicinal Chemistry (2009) 17, 444-459 [0210] 17 Smith, K M et al. The cysteine-rich domain regulates ADAM protease function in vivo. J. Cell Biol. (2002) 159, 893-902 [0211] 18 Janes, P W et al. Cytoplasmic relaxation of active Eph controls ephrin shedding by ADAM10. PLoS Biol (2009) 7, e1000215 [0212] 19 Takeda, S et al. Crystal structures of VAP1 reveal ADAMs' MDC domain architecture and its unique C-shaped scaffold. EMBO J (2006) 25, 2388-2396 [0213] 20 Guan, H-H et al. Structures of two elapid snake venom metalloproteases with distinct activities highlight the disulfide patterns in the D domain of ADAMalysin family proteins. Journal of structural biology (2010) 169, 294-303 [0214] 21 Takeda, S. Three-dimensional domain architecture of the ADAM family proteinases. Semin Cell Dev Biol (2009) 20, 146-152 [0215] 22 Benham, A M. The protein disulfide isomerase family: key players in health and disease. Antioxid Redox Signal (2012) 16, 781-789 [0216] 23 Wang, Y et al. Regulation of mature ADAM17 by redox agents for L-selectin shedding. J Immunol (2009) 182, 2449-2457 [0217] 24 Willems, S H et al. Thiol isomerases negatively regulate the cellular shedding activity of ADAM17. Biochem J (2010) 428, 439-450 [0218] 25 Fischer, O M et al. EGFR signal transactivation in cancer cells. Biochem Soc Trans (2003) 31, 1203-1208 [0219] 26 Seals, D F et al. The ADAMs family of metalloproteases: multidomain proteins with multiple functions. Genes Dev (2003) 17, 7-30 [0220] 27 Atapattu, L et al. Antibodies binding the ADAM10 substrate recognition domain inhibit Eph function. J Cell Sci (2012) 125, 6084-6093 [0221] 28 Sikandar, S S et al. NOTCH signaling is required for formation and self-renewal of tumor-initiating cells and for repression of secretory cell differentiation in colon cancer. Cancer Res (2010) 70, 1469-1478 [0222] 29 van Es, J H et al. Notch/gamma-secretase inhibition turns proliferative cells in intestinal crypts and adenomas into goblet cells. Nature (2005) 435, 959-963 [0223] 30 Lu, J et al. Endothelial cells promote the colorectal cancer stem cell phenotype through a soluble form of Jagged-1. Cancer Cell (2013) 23, 171-185 [0224] 31 Guilmeau, S et al. Heterogeneity of Jagged1 expression in human and mouse intestinal tumors: implications for targeting Notch signaling. Oncogene (2009) 29, 992-1002 [0225] 32 Yuan, Z et al. An A13 Repeat within the 3-Untranslated Region of Epidermal Growth Factor Receptor (EGFR) Is Frequently Mutated in Microsatellite Instability Colon Cancers and Is Associated with Increased EGFR Expression. Cancer Research (2009) 69, 7811-7818 [0226] 33 Bray, S et al. Notch targets and their regulation. Curr Top Dev Biol (2010) 92, 253-275 [0227] 34 Baumgart, A et al. ADAM17 Regulates Epidermal Growth Factor Receptor Expression through the Activation of Notch1 in Non-Small Cell Lung Cancer. Cancer Research (2010) 70, 5368-5378 [0228] 35 Hainaud, P et al. The Role of the Vascular Endothelial Growth Factor-Delta-like 4 Ligand/Notch4-Ephrin B2 Cascade in Tumor Vessel Remodeling and Endothelial Cell Functions. Cancer Research (2006) 66, 8501-8510 [0229] 36 Zhong, T P et al. Gridlock signalling pathway fashions the first embryonic artery. Nature (2001) 414, 216-220 [0230] 37 Butler, J M et al. Endothelial cells are essential for the self-renewal and repopulation of Notch-dependent hematopoietic stem cells. Cell Stem Cell (2010) 6, 251-264 [0231] 38 Ernst, M et al. STAT3 and STAT1 mediate IL-11-dependent and inflammation -associated gastric tumorigenesis in gp130 receptor mutant mice. J Clin Invest (2008) 118, 1727-1738 [0232] 39 Tebbutt, N C et al. Reciprocal regulation of gastrointestinal homeostasis by SHP2 and STAT-mediated trefoil gene activation in gp130 mutant mice. Nat Med (2002) 8, 1089-1097 [0233] 40 Edwards, D R et al. The ADAM metalloproteinases. Molecular Aspects of Medicine (2008) 29, 258-289 [0234] 41 Anders, A et al. Regulation of the alpha-secretase ADAM10 by its prodomain and proprotein convertases. Faseb J (2001) 15, 1837-1839 [0235] 42 Le Gall, S M et al. ADAM17 is regulated by a rapid and reversible mechanism that controls access to its catalytic site. J Cell Sci (2010) 123, 3913-3922 [0236] 43 Miao, H et al. EphA2 mediates ligand-dependent inhibition and ligand-independent promotion of cell migration and invasion via a reciprocal regulatory loop with Akt. Cancer Cell (2009) 16, 9-20 [0237] 44 Bass, R et al. ADAMs and protein disulfide isomerase: the key to regulated cell-surface protein ectodomain shedding? Biochem J (2010) 428, e3-5 [0238] 45 Finkel, T. From sulfenylation to sulfhydration: what a thiolate needs to tolerate. Science signaling (2012) 5, pe10 [0239] 46 Metcalfe, C et al. Labile disulfide bonds are common at the leucocyte cell surface. Open Biol (2011) 1, 110010 [0240] 47 Dusterhoft, S et al. Membrane-proximal domain of a disintegrin and metalloprotease -17 represents the putative molecular switch of its shedding activity operated by protein -disulfide isomerase. J Am Chem Soc (2013) 135, 5776-5781 [0241] 48 Suh, J et al. ADAM10 Missense Mutations Potentiate ?-Amyloid Accumulation by Impairing Prodomain Chaperone Function. Neuron (2013) 80, 385-401 [0242] 49 Benz, CC et al. Ageing, oxidative stress and cancer: paradigms in parallax. Nat Rev Cancer (2008) 8, 875-879 [0243] 50 Pasquale, E. Eph receptors and ephrins in cancer: bidirectional signalling and beyond. Nature Reviews Cancer (2010) 10, 165-180 [0244] 51 Nievergall, E et al. PTP1B regulates Eph receptor function and trafficking. J Cell Biol (2010) 191, 1189-1203 [0245] 52 Boyd, A W et al. Therapeutic targeting of EPH receptors and their ligands. Nat Rev Drug Discov (2013) 13, 39-62 [0246] 53. Fiaschi, T et al. Oxidative Stress, Tumor Microenvironment, and Metabolic Reprogramming: A Diabolic Liaison. International Journal of Cell Biology (2012) 2012, 8 [0247] 54. Schieber, M et al. ROS Function in Redox Signaling and Oxidative Stress. Current Biology (2014) 24, R453-R462 [0248] 55. Raha, D et al. The cancer stem cell marker aldehyde dehydrogenase is required to maintain a drug-tolerant tumor cell subpopulation. Cancer research (2014) 74, 3579-3590 [0249] 56. Espinoza, I et al. Notch signaling: targeting cancer stem cells and epithelial-to -mesenchymal transition. OncoTargets and therapy (2013) 6, 1249-1259 [0250] 57. Giancotti, Filippo G. Mechanisms Governing Metastatic Dormancy and Reactivation. Cell (2013) 155, 750-764 [0251] 58. Batlle, E et al. Molecular Mechanisms of Cell Segregation and Boundary Formation in Development and Tumorigenesis. Cold Spring Harbor Perspectives in Biology (2012) 4 [0252] 59. Atapattu, L et al. Antibodies binding the ADAM10 substrate recognition domain inhibit
[0253] Eph function. J Cell Sci (2012) [0254] 60. Janes, PW et al. Adam Meets Eph: An ADAM Substrate Recognition Module Acts as a Molecular Switch for Ephrin Cleavage In trans. Cell (2005) 123, 291-304 [0255] 61. Atapattu, L., et al., An activated form of ADAM10 is tumor selective and regulates cancer stem-like cells and tumor growth. Journal of Experimental Medicine, 2016. 213(9): p. 1741-1757. [0256] 62. Seegar, T. C . M., et al., Structural Basis for Regulated Proteolysis by the alpha-Secretase ADAM10. Cell, 2017. [0257] 63. Liu, P. C., et al., Identification of ADAM10 as a major source of HER2 ectodomain sheddase activity in HER2 overexpressing breast cancer cells. Cancer Biol Ther, 2006. 5(6): p. 657-64. [0258] 64. Feldinger, K., et al., ADAM10 mediates trastuzumab resistance and is correlated with survival in HER2 positive breast cancer. Oncotarget, 2014. 5(16): p. 6633-46. [0259] 65. Lackmann, M., et al., Purification of a ligand for the EPH-like receptor HEK using a biosensor-based affinity detection approach. Proc. Natl. Acad. Sci. U.S.A, 1996. 93(6): p. 2523-2527. [0260] 66. Panoussis, C et al., Engineering and characterization of chimeric monoclonal antibody 806 (ch806) for targeted immunotherapy of tumours expressing de2-7 EGFR or amplified EGFR. British J. Cancer, 2005. 92 1069-1077.
TABLE-US-00002 TABLE 1 Data collection and refinement statistics: crystal structure of the complex between ADAM10 D + C-domain and 8C7 F(Ab).sub.2. Adam/mAb Wavelength (?) 0.9792 Resolution range (?) 141.7-2.76 (2.91-2.76) Space group P 21 21 21 Unit cell 53.326 141.679 268.08 90 90 90 Total reflections 234255 Unique reflections 52800 Multiplicity 4.4 (4.4) Completeness (%) 98.63 (97.87) Mean I/sigma(I) 10.32 (2.10) Wilson B-factor 41.90 R-merge 0.125 (0.675) R-work 0.2028 (0.3273) R-free 0.2514 (0.3677) Number of atoms 9942 macromolecules 9485 ligands 123 water 334 Protein residues 1252 RMS (bonds) 0.009 RMS (angles) 1.26 Ramachandran favored (%) 98 Ramachandran outliers (%) 0 Clashscore 7.55 Average B-factor 32.60 macromolecules 32.60 ligands 52.60 solvent 27.30 Statistics for the highest-resolution shell are shown in parentheses.
TABLE-US-00003 TABLE 2 Residue contacts in the complex between ADAM10 D + C-domain and 8C7 F(Ab).sub.2. Adam/Light Chain Non-bonded contacts Atom Atom Res Res Atom Atom Res Res no. name name no. Chain no. name name no. Chain Distance 1. 12 CB VAL 451 A <--> 2056 CD1 ILE 72 B 3.72 2. 13 CG1 VAL 451 A <--> 2054 CG1 ILE 72 B 3.87 3. 13 CG1 VAL 451 A <--> 2056 CD1 ILE 72 B 3.58 4. 14 CG2 VAL 451 A <--> 2032 C ASP 70 B 3.80 5. 14 CG2 VAL 451 A <--> 2033 O ASP 70 B 3.62 6. 14 CG2 VAL 451 A <--> 2056 CD1 ILE 72 B 3.79 7. 782 CZ ARG 557 A <--> 2220 CD ARG 93 B 3.73 8. 782 CZ ARG 557 A <--> 2223 NH1 ARG 93 B 3.70 9. 783 NH1 ARG 557 A <--> 2223 NH1 ARG 93 B 3.60 10. 784 NH2 ARG 557 A <--> 2220 CD ARG 93 B 3.16 11. 1410 O VAL 641 A <--> 2231 CD1 TRP 94 B 3.11 12. 1410 O VAL 641 A <--> 2233 NE1 TRP 94 B 3.41 13. 1412 CG1 VAL 641 A <--> 2203 O SER 91 B 3.26 14. 1412 CG1 VAL 641 A <--> 2208 C ASN 92 B 3.82 15. 1412 CG1 VAL 641 A <--> 2209 O ASN 92 B 3.32 16. 1420 CD1 PHE 642 A <--> 2231 CD1 TRP 94 B 3.70 17. 1424 CZ PHE 642 A <--> 2255 CE2 PHE 96 B 3.84 18. 1424 CZ PHE 642 A <--> 2256 CZ PHE 96 B 3.84 Number of non-bonded contacts: 18 Adam/Heavy Chain Hydrogen bonds ATOM1 ATOM2 Atom Atom Res Res Atom Atom Res Res no. name name no. Chain no. name name no. Chain Distance 1. 1405 OD2 ASP 640 A <--> 3979 OH TYR 105 C 3.07 2. 1407 N VAL 641 A <--> 3951 O LEU 103 C 3.27 3. 1442 NH1 ARG 644 A <--> 3590 OD1 ASP 55 C 3.27 4. 1442 NH1 ARG 644 A <--> 3602 OD2 ASP 57 C 2.83 5. 1443 NH2 ARG 644 A <--> 3589 OD2 ASP 55 C 2.42 6. 1459 NH1 ARG 646 A <--> 3979 OH TYR 105 C 2.86 7. 1460 NH2 ARG 646 A <--> 3375 O ASN 31 C 3.26 Non-bonded contacts ATOM1 ATOM2 Atom Atom Res Res Atom Atom Res Res no. name name no. Chain no. name name no. Chain Distance 1. 1009 OD2 ASP 589 A <--> 3581 NH1 ARG 54 C 3.70 2. 1024 CG LYS 591 A <--> 3602 OD2 ASP 57 C 3.82 3. 1025 CD LYS 591 A <--> 3602 OD2 ASP 57 C 3.67 4. 1026 CE LYS 591 A <--> 3602 OD2 ASP 57 C 3.79 5. 1027 NZ LYS 591 A <--> 3601 OD1 ASP 57 C 3.73 6. 1311 C PRO 628 A <--> 3967 OH TYR 104 C 3.57 7. 1312 O PRO 628 A <--> 3967 OH TYR 104 C 3.46 8. 1313 CB PRO 628 A <--> 3964 CE2 TYR 104 C 3.59 9. 1313 CB PRO 628 A <--> 3966 CZ TYR 104 C 3.76 10. 1313 CB PRO 628 A <--> 3967 OH TYR 104 C 3.34 11. 1385 CB TYR 638 A <--> 3954 CD1 LEU 103 C 3.79 12. 1385 CB TYR 638 A <--> 3955 CD2 LEU 103 C 3.89 13. 1396 O CYS 639 A <--> 3954 CD1 LEU 103 C 3.76 14. 1400 CA ASP 640 A <--> 3951 O LEU 103 C 3.67 15. 1400 CA ASP 640 A <--> 3952 CB LEU 103 C 3.76 16. 1403 CB ASP 640 A <--> 3951 O LEU 103 C 3.36 17. 1403 CB ASP 640 A <--> 3977 CE2 TYR 105 C 3.76 18. 1403 CB ASP 640 A <--> 3979 OH TYR 105 C 3.50 19. 1404 CG ASP 640 A <--> 3979 OH TYR 105 C 3.62 20. 1405 OD2 ASP 640 A <--> 3979 OH TYR 105 C 3.07 21. 1407 N VAL 641 A <--> 3951 O LEU 103 C 3.27 22. 1412 CG1 VAL 641 A <--> 3962 CD2 TYR 104 C 3.57 23. 1413 CG2 VAL 641 A <--> 3951 O LEU 103 C 3.02 24. 1413 CG2 VAL 641 A <--> 3957 CA TYR 104 C 3.64 25. 1417 O PHE 642 A <--> 3615 CE LYS 59 C 3.22 26. 1417 O PHE 642 A <--> 3616 NZ LYS 59 C 3.47 27. 1418 CB PHE 642 A <--> 3401 CE2 TRP 33 C 3.67 28. 1418 CB PHE 642 A <--> 3403 CZ2 TRP 33 C 3.46 29. 1419 CG PHE 642 A <--> 3401 CE2 TRP 33 C 3.90 30. 1421 CD2 PHE 642 A <--> 3397 CG TRP 33 C 3.61 31. 1421 CD2 PHE 642 A <--> 3398 CD1 TRP 33 C 3.79 32. 1421 CD2 PHE 642 A <--> 3399 CD2 TRP 33 C 3.50 33. 1421 CD2 PHE 642 A <--> 3400 NE1 TRP 33 C 3.83 34. 1421 CD2 PHE 642 A <--> 3401 CE2 TRP 33 C 3.65 35. 1423 CE2 PHE 642 A <--> 3397 CG TRP 33 C 3.90 36. 1423 CE2 PHE 642 A <--> 3975 CD2 TYR 105 C 3.86 37. 1424 CZ PHE 642 A <--> 3421 OE1 GLN 35 C 3.83 38. 1438 CG ARG 644 A <--> 3403 CZ2 TRP 33 C 3.42 39. 1439 CD ARG 644 A <--> 3602 OD2 ASP 57 C 3.77 40. 1441 CZ ARG 644 A <--> 3559 CD2 TYR 52 C 3.71 41. 1441 CZ ARG 644 A <--> 3561 CE2 TYR 52 C 3.88 42. 1441 CZ ARG 644 A <--> 3589 OD2 ASP 55 C 3.15 43. 1442 NH1 ARG 644 A <--> 3559 CD2 TYR 52 C 3.53 44. 1442 NH1 ARG 644 A <--> 3588 CG ASP 55 C 3.56 45. 1442 NH1 ARG 644 A <--> 3590 OD1 ASP 55 C 3.27 46. 1442 NH1 ARG 644 A <--> 3589 OD2 ASP 55 C 3.09 47. 1442 NH1 ARG 644 A <--> 3599 CB ASP 57 C 3.24 48. 1442 NH1 ARG 644 A <--> 3600 CG ASP 57 C 3.47 49. 1442 NH1 ARG 644 A <--> 3602 OD2 ASP 57 C 2.83 50. 1443 NH2 ARG 644 A <--> 3559 CD2 TYR 52 C 3.87 51. 1443 NH2 ARG 644 A <--> 3561 CE2 TYR 52 C 3.79 52. 1443 NH2 ARG 644 A <--> 3588 CG ASP 55 C 3.47 53. 1443 NH2 ARG 644 A <--> 3590 OD1 ASP 55 C 3.87 54. 1443 NH2 ARG 644 A <--> 3589 OD2 ASP 55 C 2.42 55. 1455 CG ARG 646 A <--> 3979 OH TYR 105 C 3.53 56. 1456 CD ARG 646 A <--> 3979 OH TYR 105 C 3.66 57. 1457 NE ARG 646 A <--> 3564 OH TYR 52 C 3.90 58. 1458 CZ ARG 646 A <--> 3564 OH TYR 52 C 3.80 59. 1459 NH1 ARG 646 A <--> 3978 CZ TYR 105 C 3.81 60. 1459 NH1 ARG 646 A <--> 3979 OH TYR 105 C 2.86 61. 1460 NH2 ARG 646 A <--> 3375 O ASN 31 C 3.26 62. 1460 NH2 ARG 646 A <--> 3564 OH TYR 52 C 3.7062 Number of hydrogen bonds: 7 Number of non-bonded contacts:
TABLE-US-00004 TABLE 3 Binding affinity measurement of hu and ch8C7 binding to immobilised recombinant huADAM10D + C protein. K.sub.D (nM) k.sub.a (1/Ms) k.sub.d (1/s) ch8C7 6.71 1.57E+05 1.05E?03 hu8C7 7.33 1.66E+05 1.22E?03 Analysis of protein interactions by surface plasmon resonance was carried out on a BIAcore 3000 biosensor (BIAcore) as described previously [5]. K.sub.D, equilibrium dissociation constant; k.sub.a, association rate constant; k.sub.d, dissociation rate constant.