METHOD FOR ISOLATION OF SOLUBLE POLYPEPTIDES
20190092840 ยท 2019-03-28
Assignee
Inventors
Cpc classification
A61P29/00
HUMAN NECESSITIES
C07K16/1271
CHEMISTRY; METALLURGY
G01N33/6845
PHYSICS
C07K2317/94
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C12N15/1037
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
C07K16/00
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
Abstract
Polypeptides with desirable biophysical properties such as solubility, stability, high expression, monomericity, binding specificity or non-aggregation, including monomeric human V.sub.Hs and V.sub.Ls, are identified using a high throughput method for screening polypeptides, comprising the steps of obtaining a phage display library, allowing infection of a bacterial lawn by the library phage, and identifying phage which form larger than average plaques on the bacterial lawn. Sequences of monomeric human V.sub.Hs and V.sub.Ls are identified, which may be useful for immunotherapy or as diagnostic agents. Multimer complexes of human V.sub.Hs and V.sub.Ls are also identified. The V.sub.Hs and V.sub.Ls identified may be used to create further libraries for identifying additional polypeptides. Further, the V.sub.Hs and V.sub.Ls may be subjected to DNA shuffling to select for improved biophysical properties.
Claims
1. An antigen-binding V.sub.L comprising a FR1 sequence of DIQMTQSPSSLSASVGDRVTITC (amino acids 1-23 of SEQ ID NO:48), a FR2 sequence of WYQQKPGKAPKLLIF (amino acids 35-49 of SEQ ID NO:48), a FR3 sequence of GVPSRFSGSGSGTDFTLTISNLQPEDFATYYC (amino acids 57-88 of SEQ ID NO:48), and a FR4 sequence of FGHGTKVTVL (amino acids 98-107 of SEQ ID NO:48).
2. An antigen-binding V.sub.L comprising the FR1, FR2, FR3, and FR4 portion of SEQ ID NO:48 and one or more randomized CDR sequences, wherein one or more of CDR1, CDR2 and CDR3 of SEQ ID NO:48 is replaced, respectively, with a randomized CDR1, CDR2 and CDR3.
3. The antigen-binding V.sub.L of claim 1, wherein the V.sub.L is in a multimeric form.
4. The antigen-binding V.sub.L of claim 1, wherein the V.sub.L is in a dimeric form.
5. The antigen-binding V.sub.L of claim 1, wherein V.sub.L is in a trimeric form.
6. The antigen-binding V.sub.L of claim 1, wherein the V.sub.L is in a pentameric form.
7. A display library constructed by preparing nucleic acid sequences coding for the antigen-binding V.sub.L of claim 1 or 2 and expressing the V.sub.L so as to display the antigen-binding V.sub.L sequence of claim 1 or 2.
8. The display library of claim 7, wherein the library is a phage display library.
9. The display library of claim 7, wherein the library is a ribosome display, ARM ribosome display, yeast display, bacterial cell display, or in vitro compartmentalization library.
10. A method for producing a V.sub.L library, comprising: a) providing a nucleotide sequence encoding the antigen-binding V.sub.L of claim 1; b) providing oligonucleotide sequences with randomized codons; c) incorporating the randomized oligonucleotides into the nucleotide sequence encoding the V.sub.L, such that one or more than one of the complementary determining regions is randomized, wherein one or more of CDR1, CDR2 and CDR3 of SEQ ID NO.: 48 is replaced, respectively, with a randomized CDR1, CDR2 and CDR3; d) expressing the nucleotide sequences produced in step c); and e) screening the expressed sequences for binding to a target polypeptide.
11. The method of claim 10, wherein the screening comprises panning against a target molecule.
12. A method of screening the display library of claim 7, comprising panning the displayed V.sub.L against a target molecule.
13. The antigen-binding V.sub.L of claim 2, wherein CDR3 of SEQ ID NO:48 is replaced with a randomized CDR3, and the randomized CDR3 comprises 10 amino acid residues.
14. The antigen-binding V.sub.L of claim 1, which is aggregation resistant.
Description
DETAILED DESCRIPTION OF THE DRAWINGS
[0026] Figure legends
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
DETAILED DESCRIPTION OF THE INVENTION
[0037] It is desirable to identify polypeptides, especially antibody fragments, that are of human origin, soluble, stable, resistant to aggregation, refoldable, highly expressed, easily manipulated at the DNA level, ideal for library construction and for 3-D structural determinations. Such antibody fragments are useful for a wide variety of immunotherapeutical applications, and also as diagnostic and detection agents. Human monomeric V.sub.H and V.sub.L antibodies are of particular interest, as they are likely to have many of the above-mentioned properties.
[0038] Polypeptides with the above-mentioned properties may be identified by high throughput screening of libraries capable of expressing a variety of polypeptide sequences. For example, phage display libraries (preferably filamentous phage such as M13 or fd) may be screened by infecting a field of bacteria susceptible to the phage (a bacterial lawn) with the phage, then determining which phages have successfully lysed the bacteria by looking for clear, bacteria-free areas known as plaques. Phages displaying monomeric laminated V.sub.Hs and V.sub.Ls form larger plaques on bacterial lawns than phages displaying fully human V.sub.Hs with aggregation tendencies. Thus, plaque size may be used as a means of identifying rare, naturally-occurring monomer V.sub.Hs and V.sup.Ls from the human V.sub.H repertoire.
[0039] The method disclosed herein is also useful in identifying soluble, stable (stability covers a number of characteristics, including but not limited to high thermal refolding efficiency, high melting temperature, maintaining functionality after long (several days) incubation at 37? C., resistant to chemical denaturants, resistant to proteases, having a long shelf life at below 0? C., and 4? C., and at room temperature, maintaining functionality in intracellular environments, and maintaining functionality inside the human body, such as in the bloodstream) and high expressing proteins of differing origins, including: [0040] 1. V.sub.Hs, V.sub.Ls, Fabs, scFvs and whole antibodies such as IgGs, more specifically human ones [0041] 2. Protein variants based on non-antibody scaffolds single-chain T-cell receptors, T-cell receptor domains, transferin, lipocalins, kunitz domains, ankyrin repeats, and cytotoxic T-lymphocyte-associated antigen (CTLA-4), including human ones [0042] 3. Vaccines such as viral and bacterial protein vaccines [0043] 4. Therapeutic proteins, e.g., insulin, growth hormone, arythropoietin [0044] 5. Proteinacious diagnostic and biochemical reagents, e.g., protein A, protein G.
[0045] Once polypeptides have been identified by this method, they can be used to construct additional libraries. This is done by selecting a nucleic acid sequence of, for example, a VH. Oligonucleotides with randomized codons are created and incorporated into the VH sequence. Thus, each unique oligonucleotide is incorporated into a VH gene, and the modified VH genes constitute a library of sequences with slight variations. Typically, the oligonucleotides are designed such that the CDRs or loops of the VH are randomized. For example, one, two or all three of VH CDRs may be randomized. The VH library is then cloned into an appropriate vector, depending on the type of library to be used, and the nucleic acid sequences are expressed as polypeptides. The library is screened for molecules that bind to the library polypeptides, typically by panning. The libraries may be phage display libraries, or other display libraries such as ribosome display and yeast display.
[0046] Polypeptides identified by the method discussed herein may be used for immunotherapy by, for example, the cross-linking of monomers to form dimers, trimers, pentamers and other multimers. This may result in better affinity for antigen molecules and slower dissociation rates for some antigens. Another possible approach is to link or fuse polypeptides to a variety of molecules with various functions. For example, antibody fragments may be linked to radionuclides, cytotoxic drugs, toxins, peptides, proteins, enzymes, liposomes, lipids, T-cell superantigens or viruses in order to target and destroy or modify specific cells or molecules.
[0047] Once the V.sub.Hs or V.sub.Ls identified by the selection method described herein have been isolated, they can be further manipulated to select for improved biophysical properties such as solubility, stability, monomericity, binding specificity, human origin or high expressability. This can be achieved by in vitro recombination techniques such as DNA shuffling or a staggered extension process. DNA shuffling involves cutting the nucleic acid sequence of first (donor) and second (acceptor) polypeptides, such as antibody fragments, into random fragments, then reassembling the random fragments by a PCR-like reaction. The reassembled fragments are then screened to select for the desired properties.
[0048] For example, one or more VHs with high stability (donors) can be mixed with one or more VHs lacking sufficient stability (acceptors) and subjected to DNA shuffling. This generates mutants of the acceptor VHs which have incorporated stability residues from the donor VHs. The newly stable mutants can be identified by the methods described herein, or through other evolutionary protein screening systems such as ribosome display, yeast display, bacterial cell display and phage display. Similarly, this technique can be used to transfer desirable traits such as solubility, monomericity, and high expression.
[0049] This technique may be used where both donor and acceptor V.sub.Hs have desirable properties, to produce a V.sub.H with both properties. For example, an unstable donor V.sub.H which binds to an important therapeutic or diagnostic ligand can be shuffled with a stable acceptor V.sub.H. In order to ensure that new generated stable V.sub.Hs also have the ability to bind to the ligand, the screening system may involve a ligand binding step.
[0050] DNA shuffling may also be useful for humanizing non-human V.sub.Hs such as camelid heavy chain antibody variable domains and nurse shark and wobbegong shark variable domains, or non-human V.sub.Ls which bind to therapeutic targets. Human V.sub.Hs and V.sub.Ls with desirable properties such as solubility, stability, monomericity and high expressability may be used as donors. For example, one or more human V.sub.Hs with good stability (donors) can be mixed with one or more non-human therapeutic V.sub.Hs (acceptors) and subjected to DNA shuffling. This generates mutants of the acceptor V.sub.Hs which are both stable and humanized. The newly generated humanized and stable mutants can be identified by the methods described herein, or through other evolutionary protein screening systems such as ribosome display, yeast display, bacterial cell display and phage display. In a further example, the acceptor V.sub.H could be a therapeutic V.sub.HH (camelid heavy chain antibody variable domain).
[0051] Further, this technique is also useful for selecting desirable properties of polypeptides other than V.sub.Hs and V.sub.Ls. As discussed above, the donor polypeptide and the acceptor polypeptide may be both human, or the donor may be human and the acceptor non-human.
[0052] A possible approach for imparting solubility, monomericity, high expressability or stability to V.sub.Hs and V.sub.Ls may be through grafting complementarity determining regions (CDRs) onto acceptor V.sub.Hs and V.sub.Ls. Since CDRs are known to be involved in the solubility and stability of single-domain antibodies, and accordingly the grafting of these regions, such as the CDRs from V.sub.Hs and V.sub.Ls isolated by the methods described herein, may impart solubility and/or stability to acceptor V.sub.Hs and V.sub.Ls.
[0053] Human Monomeric V.sub.Hs and V.sub.Ls
[0054] Several monomeric human V.sub.Hs with different germline and overall sequences were identified (see
[0055] In addition, several monomeric human V.sub.Ls were identified (see
[0056] Such properties will also be manifested by V.sub.Hs from synthetic libraries that utilize the above V.sub.Hs as scaffolds. Thus, such libraries may yield therapeutic or diagnostic V.sub.Hs which would have good efficacy at physiological temperature, extended shelf life and a cost-effective production. High thermal refolding efficiency characteristic would further extend the biotechnological applications of these libraries to situations where V.sub.H binders are required to maintain their activity after exposure to transient high temperatures. The V.sub.Hs should also be very suitable for intrabody applications because of their desirable biophysical properties. The protein A binding property will simplify V.sub.H purification and detection in diagnostic tests, immunoblotting and immunocytochemistry and can be exploited to enhance library performance by removing nonfunctional V.sub.Hs from the libraries. Similarly, libraries that utilize V.sub.Ls as scaffolds will yield therapeutic or diagnostic V.sub.Ls which have similarly desirable properties. Since V.sub.Ls bind with protein L, V.sub.L purification and detection is simplified by taking advantage of this protein L binding property.
[0057] Display libraries built on the present V.sub.Hs and V.sub.Ls may also be a useful source of diagnostics and detection agents.
[0058] Previously reported fully human V.sub.Hs with favorable biophysical properties were based on a single V germline sequence: DP-47 ((Jespers, L. et al., 2004b; Jespers, L. et al., 2004a). The observation that the monomeric human V.sub.Hs in this study stem from six different germline sequences including DP-47, demonstrates that stable V.sub.Hs are not restricted in terms of germline gene usage. In fact, it is very likely that we would have isolated monomeric V.sub.Hs of family and germline origins different from the ones we describe here had we not restricted our selection to a subset of V.sub.H3 family V.sub.Hs with protein A binding activity. It is not possible to pinpoint amino acid mutations (Table 1) responsible for the observed biophysical behavior of the present V.sub.Hs due to the occurrence of multiple mutations in V.sub.Hs and the fact that CDR3 is also known to be involved in shaping the biophysical profiles of sdAbs. It may be, however, that mutations at positions known to be important for sdAbs stability and solubility, eg., V37F in HVHP423 and HVHP44B, or mutations occurring multiple times at the same position, e.g., L5V/Q and V5Q in nine V.sub.Hs, have a role in determining V.sub.Hs biophysical properties. In terms of library construction, it would be desirable that the monomericity of the present V.sub.Hs not be dependent on CDRs, in particular CDR3, so that CDR randomization be performed without the worry of jeopardizing library stability. In this regard, the V.sub.Hs with smaller CDR3, e.g, HVHB82, may be preferred scaffolds since there would be less dependence on CDR3 for stability.
[0059] The diversity of the present V.sub.Hs and V.sub.Ls in terms of overall sequence and CDR3 length should allow the construction of better-performing libraries. Synthetic V.sub.H libraries have been constructed on single scaffolds. Such an approach to repertoire generation is in sharp contrast to the natural, in vivo approach which utilizes a multiplicity of scaffolds. Based on the sequences reported here one can take advantage of the availability of the diverse set of V.sub.Hs and V.sub.Ls and create libraries which are based on multiple V.sub.H and V.sub.L scaffolds. Such libraries would be a better emulation of in vivo repertoires and therefore, would have a more optimal complexity. Of the three CDRs in sdAbs, CDR3 generally contributes most significantly to repertoire diversity and for this reason CDR3 randomization on V.sub.H and V.sub.L scaffolds are typically accompanied by concomitant varying of CDR3 length. While this significantly improves library complexity, it may also compromise library stability by disrupting the length of the parental scaffold CDR3. The heterogeneity of the V.sub.Hs and V.sub.Ls disclosed herein in terms of CDR3 length permit the creation of libraries with both good complexity, good stability and good biophysical characteristics. Such libraries would preferably consist of sub-libraries, where each sub-library is created by CDR3 randomization (and CDR1 and/or CDR2 randomization, if desired) on a single V.sub.H or V.sub.L scaffold without disrupting the parental CDR3 length.
[0060] The versatility of the present V.sub.Hs and V.sub.Ls is also beneficial in terms of choosing an optimal V.sub.H or V.sub.L framework for humanizing V.sub.HHs, V.sub.Hs and V.sub.Ls which are specific to therapeutic targets. High affinity camelid V.sub.HHs against therapeutic targets can be obtained from immune, non-immunized or synthetic V.sub.HH libraries with relative ease and be subsequently subjected to humanization (CDR grafting, resurfacing, deimmunization) to remove possible V.sub.HH immunogenicity, hence providing an alternative to human V.sub.H library approach for production of therapeutic V.sub.Hs. Generating high affinity therapeutic V.sub.Hs by the latter approach may often require additional tedious and time consuming in vitro affinity maturation of the lead binder(s) selected from the primary synthetic human V.sub.H libraries.
[0061] Nonhuman V.sub.Hs against therapeutic targets can be obtained from immune, non-immunized or synthetic V.sub.H libraries with relative ease and be subsequently subjected to humanization (CDR grafting, resurfacing, deimmunization) to eliminate nonhuman V.sub.H immunogenicity, hence providing an alternative to human V.sub.H library approach for production of therapeutic V.sub.Hs.
[0062] Nonhuman V.sub.Ls against therapeutic targets can be obtained from immune, non-immunized or synthetic V.sub.HH libraries with relative ease and be subsequently subjected to humanization (CDR grafting, resurfacing, deimmunization) to eliminate V.sub.HH immunogenicity, hence providing an alternative to human V.sub.L library approach for production of therapeutic V.sub.Ls.
[0063] A number of evolutionary approaches for selection of proteins with improved biophysical properties have been described (Forrer, P. et al., 1999; Waldo, G. S., 2003); (Jespers, L. et al., 2004a; Jung, S. et al., 1999; Matsuura, T. et al., 2003). Typically, stability pressure is required to ensure preferential selection of stable variants over unstable or less stable ones from a library population. For example, in a related work, heat treatment of V.sub.H phage display libraries was required to select aggregation resistant V.sub.Hs (Jespers, L. et al., 2004a). Examples of evolutionary selection approaches involving phage display include conventional phage display, selectively infective phage and the proteolysis approaches. In the first two approaches affinity selection is used to select stable species from a library, based on the assumption that stable proteins possess better binding properties for their ligand than the unstable ones. However, even with the additional inclusion of a stability selection step, these approaches may primarily enrich for higher affinity rather than for higher stability (Jung, S. et al., 1999). A binding step requirement also limits the applicability of these approaches to proteins with known ligands. The third, proteolysis approach is based on the fact that stable proteins are generally compact and therefore are resistant to proteases whereas the unstable ones are not. The phage display format is engineered in such a way that the protease stability of the displayed protein translates to phage infectivity. Thus, when a variant phage display library is treated with a protease, only the phages displaying stable proteins retain their infectivity and can subsequently be selected by infecting an E. coli host. Since this approach is independent of ligand binding, it has general utility. However, even stable and well folded proteins have protease sensitive sites, e.g., loops and linkers, and this could sometimes hinder the selection of stable species in a proteolysis approach (Bai, Y. et al., 2004).
[0064] By contrast, in the present evolutionary approach, proteins with superior biophysical properties are simply identified by the naked eye. The approach does not require ligand binding, proteolysis or destabilization steps, and thus, avoids complications which may be encountered in the reported selection approaches. No requirement for a binding step also means that this approach has general utility. As an option, a binding step may be included to ensure that the selected proteins are functional. However, the dependency of the present approach on plating (for plaque visualization) introduces a possible logistical limitation in terms of the number of plates that can be handled and thus limits its application to smaller libraries. Nonetheless, the utility of the current approach can be extended to large libraries, if the library is first reduced to a manageable size. This can be done, for example, by incorporating into the selection system a step which would remove large populations of unstable species, e.g., library adsorption on a protein A surface, or on a hydrophobic interaction column to remove poorly folded proteins with exposed hydrophobic surfaces (Matsuura, T. et al., 2003). Here, the approach was used to select V.sub.Hs and V.sub.Ls of good biophysical properties in a background of very unstable V.sub.Hs and V.sub.Ls. However, it may be more difficult to select the best species from a mutant library which is populated with proteins with reasonably good stabilities. In this case, the lead variants may be identified based on the rate of plaque formation by using shorter incubation times, or based on plaque size and frequency criteria.
[0065] The present selection approach can be extended to identification of stable and well-folded antibody fragments such as scFvs and Fabs with the optional inclusion, in the selection system, of a binding step involving protein L, A or any ligand, as well as stable non-antibody scaffolds and variants thereof. Moreover, the observed correlation between phage plaque size and V.sub.H expression yield means that one can utilize the present approach for acquiring high-expressing versions of proteins with otherwise poor or unsatisfactory expression from mutant phage display libraries. This application would be particularly appealing in the case of therapeutic proteins or expensive poor-expressing protein reagents where boosting protein expression would significantly offset protein production cost.
[0066] Binding Analyses of Pentamers
[0067] Both V.sub.Ls and V.sub.Hs are amenable to pentamerization and the pentamerization can be used to quickly convert a low affinity V.sub.L or V.sub.H monomer to a high affinity V.sub.L or V.sub.H pentamer. Such pentamers are invaluable diagnostics and detection agents. In such applications, the binding of a V.sub.L or V.sub.H pentamer to its target can be detected by a reporter molecule such as an enzyme (for example, horse radish peroxidase or alkaline phosphatase), or a fluorescent molecule conjugated to the pentamer. Alternatively, the binding of the pentamer can be detected by a secondary molecule which is conjugated to a reporter molecule. The secondary molecule can be specific to the pentamer itself or to a tag thereof, such as a 6His tag (SEQ ID NO.: 55) or c-Myc tag. For example, a typical secondary molecule is an immunoglobulin.
[0068] The interactions between the V.sub.Hs and protein A and V.sub.Ls with protein L are fundamentally different from those between V.sub.Hs and V.sub.Ls with their target antigens. The antigen binding of a V.sub.H or a V.sub.L involves three antigen binding loops which form the combining site of an antibody domain. The protein A binding of a V.sub.H with protein A binding activity and a V.sub.L with protein L binding activity involve binding sites and residues on the antibody domains that are totally distinct from the antibody combining site. Thus, a V.sub.H with protein A binding activity can simultaneously bind to protein A and its target antigen and a V.sub.L with protein L binding activity can simultaneously bind to protein L and its target antigen. Since the present V.sub.Hs and V.sub.Ls have affinity for protein A and L, respectively, protein A and L can be used as the secondary molecule for detection and diagnostic applications mentioned above. The human V.sub.H and V.sub.L pentamers can also be used for therapy.
[0069] Pathogen Detection by the Pentamers
[0070] The protein A and L binding activity of the V.sub.Hs and V.sub.Ls can be used to detect bacteria which have protein A and/or L on their surfaces. Protein A is present on the surface of the pathogenic bacteria, Staphylococcus aureus. Thus, the V.sub.Hs with protein A binding activity such as the ones described here can be used to detect S. aureus. Similarly, the V.sub.L monomers and V.sub.L pentamers with protein L binding activity can be used for the detection of bacteria, in particular pathogenic bacteria such as Peptostreptococcus magnus, which have protein L on their cell surface.
[0071] Protein L is implicated as a virulent factor in the pathogenesis of P. magnus (Ricci, S. et al., 2001) in humans. In vaginosis, protein L is thought to exert its effect by cross-linking surface associated IgE. V.sub.L monomers and/or pentamers with protein L binding activity have potential as therapeutics since they could interfere with the IgE cross-linking action of protein L.
[0072] Protein A is implicated as a virulent factor in the pathogenesis of S. aureus in humans (Fournier, B. et al., 2004). Its virulence has been attributed to its ability to interact with host components including binding to antibodies. V.sub.H monomers and/or pentamers with protein A binding activity have potential as therapeutics since they could interfere with the interaction of of protein A with host components.
EXAMPLES
[0073] Identification and sequence analysis of monomeric human V.sub.Hs
[0074] During the course of the construction of fully human and laminated human V.sub.H libraries, it was learned that the phages displaying monomeric laminated V.sub.Hs formed larger plaques on bacterial lawns than phages displaying fully human V.sub.Hs with aggregation tendencies. Thus, plaque size was used as a means of identifying rare, naturally-occurring monomer V.sub.Hs from the human V.sub.H repertoire (
[0075] Following a few rounds of panning, the library became enriched for phage producing large plaques, and PCR and sequencing of more than 110 such plaques showed that all had complete V.sub.H open reading frames. The size of the large plaques which were picked for analysis is represented in
[0076] Biophysical Characterization of the Human V.sub.Hs
[0077] All V.sub.Hs except HVHP44B, which was essentially the same as HVHP423, were expressed in one-litre-culture volumes in E. coli strain TG1 in fusion with c-Myc-His.sub.5 tag and purified to homogeneity from periplasmic extracts by immobilized metal affinity chromatography (IMAC). The expression yields ranged from 1.8 to 62.1 mg of purified protein per liter of bacterial culture in shaker flasks with majority of V.sub.Hs having yields in several milligrams (Table 2). In the instance of HVHP423 and HVHP430, another trial under apparently the same expression conditions gave yields of 2.4 and 6.4 mg as opposed to 62.1 and 23.7 mg, respectively. This implies that for many of the V.sub.Hs described here optimal expression conditions should be achieved, without much effort, resulting in expression yields significantly higher than the reported values in Table 2. As expected, all the V.sub.Hs bound to protein A in surface plasmon resonance (SPR) analyses, with K.sub.D s of 0.2-3 ?M, a range and magnitude comparable to the ones reported previously for llama V.sub.HH variants with protein A binding activity. None of the VHs bound to the Fab reference surface.
[0078] The aggregation tendency of the human V.sub.Hs was assessed in terms of their oligomerization states by gel filtration chromatography and NMR (Table 2). All V.sub.Hs were subjected to Superdex 75 gel filtration chromatography. Similar to a llama V.sub.HH, i.e., H11C7, all V.sub.Hs gave a symmetric single peak at the elution volume expected for a monomer, and were substantially free of any aggregates (see the example for HVHP428 in
[0079] The stability of the V.sub.Hs was further investigated in terms of their resistance to trypsin at 37? C. integrity following long incubations at 37? C. Trypsin cleaves polypeptide amide backbones at the C-terminus of an Arg or a Lys residue. There are 9-13 Arg and Lys residues in the human V.sub.Hs (
[0080] Eleven V.sub.Hs ranging in concentration from 0.32 mg/ml (HVHP428) to 3.2 mg/ml (HVHP420) were incubated at 37? C. for 17 days. Their stability was subsequently determined in terms of oligomerization state and protein A binding. As shown by gel filtration chromatography, treatment of V.sub.Hs at 37? C. did not induce any aggregate formation: all V.sub.Hs gave chromatogram profiles which were virtually identical to those of untreated V.sub.Hs and stayed essentially as monomers (see the example for HVHP420;
[0081] The refolding efficiency (RE) of the human V.sub.Hs was investigated by comparing the K.sub.Ds of the binding of the native (K.sub.Dn) and heat-treated, refolded (K.sub.Dref) V.sub.Hs to protein A (Tanha, J. et al., 2002). When a fraction of the V.sub.H is inactivated by heat treatment the measured K.sub.D would be higher, since this parameter is based on the concentration of folded, i.e., active, antibody fragment. Thus, the ratio of K.sub.Dn to K.sub.Dref gives a measure of V.sub.H RE.
[0082] Human V.sub.H Phage Display Library Construction and Panning.
[0083] cDNA was synthesized from human spleen mRNA (Ambion Inc., Austin, Tex.) using random hexanucletide primers and First Strand cDNA? kit (GE Healthcare, Baie d'Urf?, QC, Canada). Using the cDNAs as template, V.sub.H genes with flanking C.sub.H sequences were amplified by polymerase chain reaction (PCR) in nine separate reactions using V.sub.H framework region 1 (FR1)-specific primers and an immunoglobin M-specific primer (de Haard, H. J. et al., 1999). The products were gel-purified and used as the template in the second round of PCR to construct V.sub.H genes using the FR1- and FR4-specific primers (de Haard, H. J. et al., 1999) that also introduced flanking Apal I and Not I restriction sites for cloning purposes. The resultant V.sub.H repertoire DNAs were cloned into fd-tetGIIID phage vector and a V.sub.H phage display library was constructed (Tanha, J. et al., 2001). Panning against protein A (Amersham Biosciences Inc.) was performed as described (Tanha, J. et al., 2001). Germline sequence assignment of the selected V.sub.Hs was performed using DNAPLOT software Version 2.0.1 and V BASE version 1.0. Llama V.sub.HHs H11C7, H11F9 and H11B2 were isolated from a llama V.sub.HH phage display library by panning against H11 scFv as described (Tanha, J. et al., 2002).
[0084] V.sub.H Expression and Purification.
[0085] V.sub.Hs were cloned into pSJF2 expression vectors by standard cloning techniques (Sambrook, J. Fritsch E. F. and Maniatis T, 1989). Periplasmic expression of sdAbs and subsequent purification by immobilized metal affinity chromatography (IMAC) were performed as described (Muruganandam, A. et al., 2002). Protein concentrations were determined by A.sub.280 measurements using molar absorption coefficients calculated for each protein (Pace, C. N. et al., 1995). Gel filtration chromatography of the purified V.sub.Hs was performed on a Superdex 75 column (GE Healthcare) as described (Deng, S. J. et al., 1995).
[0086] Binding and Refolding Efficiency Experiments.
[0087] Equilibrium dissociation constants (K.sub.Ds) and refolding efficiencies (REs) of V.sub.Hs/V.sub.HHs were derived from surface plasmon resonance (SPR) data collected with BIACORE 3000 biosensor system (Biacore Inc., Piscataway, N.J.). To measure the binding of V.sub.Hs to protein A, 2000 resonance units (RUs) of protein A or a reference antigen-binding fragment (Fab) were immobilized on research grade CM5 sensor chips (Biacore Inc.). Immobilizations were carried out at concentrations of 25 ?g/ml (protein A) or 50 ?g/ml (Fab) in 10 mM sodium acetate buffer pH 4.5, using the amine coupling kit provided by the manufacturer. To measure the binding of the anti-idiotypic llama V.sub.HHs to H11 scFv, 4100 RUs of 50 ?g/ml H11 scFv or 3000 RUs of 10 ?g/ml Se155-4 IgG reference were immobilized as described above. In all instances, analyses were carried out at 25? C. in 10 mM HEPES, pH 7.4, containing 150 mM NaCl, 3 mM EDTA and 0.005% P20 at a flow rate of 40 ?l/min, and surfaces were regenerated by washing with the running buffer. To determine the binding activities of the refolded proteins, V.sub.Hs or V.sub.HHs were denatured by incubation at 85? C. for 20 min at 10 ?g/ml concentrations. The protein samples were then cooled down to room temperature for 30 min to refold and were subsequently centrifuged in a microfuge at 14,000 rpm for 5 min at room temperature to remove any protein precipitates. The supernatants were recovered and analyzed for binding activity by SPR as described above. For both folded and refolded proteins data were fit to a 1:1 interaction model simultaneously using BIAevaluation 4.1 software (Biacore Inc.) and K.sub.D s were subsequently determined. REs were determined from
Where K.sub.Dn is the K.sub.D of the native protein and K.sub.Dref is the K.sub.D of the refolded protein.
[0088] Tryptic Digest Experiments.
[0089] 3 ?l of a freshly prepared 0.1 ?g/?l sequencing grade trypsin (Hoffmann-La Roche Ltd., Mississauga, ON, Canada) in 1 mM HCl was added to 60 ?g V.sub.H in 100 mM Tris-HCl buffer pH 7.8. Digestion reactions were carried out in a total volume of 60 ?l for 1 h at 37? C. and stopped by adding 5 ?l of 0.1 ?g/?l trypsin inhibitor (Sigma, Oakville, ON, Canada). Following completion of digestion, 5 ?l was removed and analyzed by SDS-PAGE; the remaining was desalted using ZipTip.sub.C4 (Millipore, Nepean, ON, Canada), eluted with 1% acetic acid in 50:50 methanol:water and subjected to V.sub.H mass determination by MALDI mass spectrometry.
[0090] Protein Stability Studies at 37? C.
[0091] Single-domain antibodies (sdAbs) at 0.32-3.2 mg/ml concentrations were incubated at 37? C. in PBS buffer for 17 days. Following incubation, the protein samples were spun down in a microfuge at maximum speed for 5 min even in the absence of any visible aggregate formation. The samples were then applied onto a Superdex 75 size exclusion column (GE Healthcare) and the monomeric peaks were collected for SPR analysis against protein A. SPR analyses were performed as described above except that 500 RUs of protein A or reference Fab was immobilized and that immobilizations were carried out at concentration of 50 ?g/ml.
[0092] NMR Experiments
[0093] V.sub.H samples for NMR analysis were dissolved in 10 mM sodium phosphate, 150 mM NaCl, 0.5 mM EDTA, and 0.02% NaN.sub.3 at pH 7.0. The protein concentrations were 40 ?M-1.0 mM. All NMR experiments were carried out at 298 K on a Bruker Avance-800 or a Bruker Avance-500 NMR spectrometer. One-dimensional (1D).sup.1H NMR spectra were recorded with 16,384 data points and the spectral widths were 8,992.81 Hz at 500 MHz and 17,605.63 Hz at 800 MHz, respectively. Two-dimensional .sup.1H-.sup.1H NOESY spectra of 2,048?400 data points were acquired on a Bruker Avance-800 NMR spectrometer with a spectral width of 11,990.04 Hz and a mixing time of 120 ms. In all NMR experiments, water suppression was achieved using the WATERGATE method implemented through the 3-9-19 pulse train (Piotto, M. et al., 1992; Sklenar, V. et al., 1993). NMR data were processed and analyzed using the Bruker XWINNMR software package. All PFG-NMR diffusion measurements were carried out with the water-suppressed LED sequence (Altieri, A. S. et al., 1995), on a Bruker Avance-500 NMR spectrometer equipped with a triple-resonance probe with three-axis gradients. One-dimensional proton spectra were processed and analyzed using Bruker Xwinnmr software package. NMR signal intensities were obtained by integrating NMR spectra in the methyl and methylene proton region (2.3 ppm to ?0.3 ppm) where all NMR signals were attenuated uniformly at all given PFG strengths.
[0094] Human V.sub.L Phage Display Library Construction and Panning.
[0095] cDNAs were synthesized from human spleen mRNA as described above for the human V.sub.Hs. The cDNA was used as template in PCR to amplify V.sub.L genes in 50 ?l reaction volumes using six V.sub.? back primers, 11 V.sub.? back primers (de Haard, H. J. et al., 1999), four V.sub.? For primers and two V.sub.? For primers (Sblattero, D. et al., 1998). The back and forward primers were modified to have flanking Apa LI and Not I restriction sites, respectively, for subsequent cloning purposes. Forward primers were pooled together in ratios which reflected their degree of degeneracy. V.sub.? genes were PCRed in 11 separate reactions using the pooled V.sub.? For primers and 11 individual V.sub.? back primers. Similarly, V.sub.? genes were amplified in 6 separate reactions using the pooled V.sub.? For primers and 6 individual V.sub.? back primers. The PCR products were pooled, gel purified and digested with Apa LI and Not I restriction endonucleases. The library was constructed as described for human V.sub.Hs. Plaque PCR was performed on individual library colonies and the amplified V.sub.L genes were sequenced as described (Tanha, J. et al., 2003). Panning against protein L (Biolynx Inc., Brockville, ON, Canada) and germline sequence assignment of the selected V.sub.Ls were performed as described above for human V.sub.H library.
[0096] V.sub.L Expression and Purification.
[0097] V.sub.L expression, purification, concentration determination and gel filtration chromatography were carried out as described for V.sub.Hs in V.sub.H expression and purification..
[0098] Expression and Purification of V.sub.L and V.sub.H Pentamers.
[0099] Specific primers were used in a standard PCR to amplify HVHP328 V.sub.H and HVLP335 V.sub.L genes. Standard cloning techniques were used to clone the HVHP328 and HVLP335 genes in fusion with VT1B pentamerization domain gene in an expression vector to yield HVHP328PVT2 and HVLP335PTV2 pentamers, (Zhang, J. et al., 2004). Pentamers were expressed and purified as described (Zhang, J. et al., 2004). Protein concentrations were determined as above.
[0100] Surface Plasmon Resonance of V.sub.Ls.
[0101] The binding kinetics for the interaction of the V.sub.Ls to protein L were determined by SPR using BIACORE 3000 biosensor system (Biacore, Inc., Piscataway, N.J.). 680 RUs of protein L or 870 RUs of a Fab reference were immobilized on research grade CM5 sensor chips (Biacore). Immobilizations were carried out at a protein concentration of 50 ?g/ml in 10 mM acetate buffer pH 4.5 using the amine coupling kit supplied by the manufacturer. All measurements were carried out at 25? C. in 10 mM HEPES buffer pH 7.4, containing 150 mM NaCl, 3 mM EDTA and 0.005% P20 at a flow rate of 50 ?l/min or 100 ?l/min. Surfaces were regenerated by washing with the running buffer. Data were evaluated using the BIAevaluation 4.1 software (Biacore, Inc.).
[0102] Surface Plasmon Resonance of the Pentameric V.sub.L and V.sub.H.
[0103] The binding kinetics for the interaction of HVHP328PVT2 with protein A and HVLP335PTV2 with protein L were also determined by SPR. 520 RUs of protein A or a Fab reference were immobilized as above. For the V.sub.L pentamer, the same surfaces prepared above were used. Measurements were carried out as above but at a flow rate of 20 ?l/min. Surfaces were regenerated by washing with 50 mM HCl for 3 s. Data were evaluated as described for the monomers.
[0104] Cell Microagglutination
[0105] A single S. aureus colony from a BHI plate was used to inoculate 15 mL of BHI media. The bacteria were grown overnight at 37? C. at 200 rpm. In the morning, the culture was spun down in a swinging bucket, Sorvall RT6000B refrigerated centrifuge at 4000 rpm for 10 min, the supernatant was removed and the cell pellet was re-suspended in PBS buffer. The cells were re-spun, the supernatant was removed and the cell pellet was re-suspended again in PBS buffer. The cells were diluted to an A.sub.600 of 1.0, and serial dilutions of the cells were spread on BHI plates at 37? C. for overnight growth. The cell titer was determined in the morning. An A.sub.600 of 1.0 corresponded to 1.5?10.sup.9 cells ml.sup.?1. Identical steps were taken to prepare E. coli starin TG1 cells for subsequent microagglutination assays, except that the growth media was 2xYT. The viable counts were similar, A.sub.6001.0=2.1?10.sup.9 cells ml.sup.?1.
[0106] To perform microagglutination assays, two fold dilutions of HVHP328PVT2 in PBS were performed from wells 1 to 11 in a microtiter plate. Well 12 (blank) had only PBS. The total volume in each well was 50 ?l. Subsequently, 1?10.sup.8 S. aureus cells in 50 ?l PBS was added to all wells and the plate was incubated overnight at 4? C. To have a permanent record of the results, a picture was taken from the plate in the morning. For the pentamer control experiment, HVHP328PVT2 was replaced with the V.sub.L pentamer, HVLP335PTV2. In the cell control experiments, the same two sets of experiments were repeated with E. coli TG1 cells.
[0107] Identification and Sequence Analysis of Monomeric Human V.sub.Ls
[0108] Essentially the same selection method which was employed to isolate soluble V.sub.Hs from a human V.sub.H phage display library was applied to a human V.sub.L library for isolating soluble, monomeric V.sub.Ls. A human V.sub.L library with a size of 3?10.sup.6 was constructed. Twenty four plaques from the library titer plates were picked and their V.sub.L genes were PCRed and sequenced. The sequences were diverse in terms of germ-line origin although 75% of the V.sub.Ls were of V? origin (data not shown). Three rounds of panning against protein L resulted in enrichment for large plaques. Thirty-nine of large plaques were sequenced and 32 unique sequences were identified (
[0109] Eighteen V.sub.Ls of the kappa class had their last three residues (105-107) replaced with amino acids Thr, Val and Leu which are only found in lambda V.sub.Ls. These substitutions may have had a role in improving the biophysical properties of the kappa V.sub.Ls, resulting in the selection of the aforementioned V.sub.Ls over the parental clones with the original kappa residues at position 105-107.
[0110] Characterization of the Human V.sub.Ls
[0111] Eight of the selected V.sub.Ls with different V germline origins were expressed in E. coli in one-liter cultures and purified: HVLP324, HVLP325, HVLP335, HVLP342, HVLP351, HVLP364, HVLP389 and HVLP3103 (Table 6). All were expressed in good yields ranging from 6.2 mg for HVLP324 to around 75 mg for HVLP335 and HVLP364.
[0112] The aggregation tendency of the human V.sub.Ls was assessed in terms of their oligomerization state by gel filtration chromatography. V.sub.Ls were subjected to Superdex 75 gel filtration chromatography at a concentration of 0.6 mg/ml. All except HVLP325 were essentially free of aggregates and gave symmetric single peaks with the mean apparent molecular mass of 12.7 kDa (range, 6.2-19.2 kDa) (
[0113] V.sub.Ls were subjected to Superdex-75 chromatography prior to BIACORE analysis and purified monomer peaks collected even in the absence of any evidence of aggregated material. In SPR analysis, all selected V.sub.Ls bound to protein L (
[0114] Binding Analyses of Pentamers
[0115] Bindings of HVHP328PVT2 pentamer to protein A and HVLP335PTV2 pentamer to protein L were determined by surface plasmon resonance (
[0116] Pathogen Detection by V.sub.Ls and V.sub.Hs
[0117] The protein A and L binding activity of the V.sub.Hs and V.sub.Ls can be used to detect bacteria which have protein A and/or L on their surfaces. This is possible if the V.sub.Hs and V.sub.Ls are soluble and monomeric (lack of tendency to aggregate) such as the V.sub.Hs and V.sub.Ls here. Variable domains derived from antibodies which lack light chains such as camelid heavy chain antibodies or nurse shark and wobbegong shark IgNARs are naturally soluble and monomeric. From these, those with protein A and L binding activity. can also be used to detect bacteria which have protein A and/or L on their surfaces. Protein A is present on the surface of the pathogenic bacteria, Staphylococcus aureus. Thus, the V.sub.Hs with protein A binding activity such as the ones described here can be used to detect S. aureus. We performed a microagglutination assay to detect the ability of HVHP328PVT2 V.sub.H pentamer to bind to S. aureus. A constant number of bacterial cells were incubated with two-fold dilutions of HVHP328PVT2 in microtiter wells (wells 1-11) (
[0118] It is understood that the examples described above in no way serve to limit the true scope of this invention, but rather are presented for illustrative purposes.
REFERENCE LIST
[0119] Bai, Y. and Feng, H. (2004). Selection of stably folded proteins by phage-display with proteolysis. Eur. J. Biochem. 271: 1609-1614. [0120] Davies, J. and Riechmann, L. (Feb. 21, 1994). Camelising human antibody fragments: NMR studies on VH domains. FEBS Lett 339: 285-290. [0121] Davies, J. and Riechmann, L. (1995). Antibody VH domains as small recognition units. Biotechnology N.Y. 13: 475-479. [0122] de Haard, H. J., van Neer, N., Reurs, A., Hufton, S. E., Roovers, R. C., Henderikx, P., de Bruine, A. P., Arends, J. W., and Hoogenboom, H. R. (Jun. 25, 1999). A large non-immunized human Fab fragment phage library that permits rapid isolation and kinetic analysis of high affinity antibodies. J. Biol. Chem. 274: 18218-18230. [0123] Deng, S. J., MacKenzie, C. R., Hirama, T., Brousseau, R., Lowary, T. L., Young, N. M., Bundle, D. R., and Narang, S. A. (May 23, 1995). Basis for selection of improved carbohydrate-binding single-chain antibodies from synthetic gene libraries. Proc. Natl. Acad. Sci U.S.A 92: 4992-4996. [0124] Forrer, P., Jung, S., and Pluckthun, A. (1999). Beyond binding: using phage display to select for structure, folding and enzymatic activity in proteins. Curr. Opin. Struct. Biol. 9: 514-520. [0125] Fournier, B. and Klier, A. (2004). Protein A gene expression is regulated by DNA supercoiling which is modified by the ArlS-ArlR two-component system of Staphylococcus aureus. Microbiology 150: 3807-3819. [0126] Hamers, C. C., Atarhouch, T., Muyldermans, S., Robinson, G., Hamers, C., Songa, E. B., Bendahman, N., and Hamers, R. (Jun. 3, 1993). Naturally occurring antibodies devoid of light chains. Nature 363: 446-448. [0127] Jespers, L., Schon, O., Famm, K., and Winter, G. (2004a). Aggregation-resistant domain antibodies selected on phage by heat denaturation. Nat. Biotechnol. 22: 1161-1165. [0128] Jespers, L., Schon, O., James, L. C., Veprintsev, D., and Winter, G. (Apr. 2, 2004b). Crystal Structure of HEL4, a Soluble, Refoldable Human V(H) Single Domain with a Germ-line Scaffold. J. Mol. Biol. 337: 893-903. [0129] Jung, S., Honegger, A., and Pluckthun, A. (Nov. 19, 1999). Selection for improved protein stability by phage display. J. Mol. Biol. 294: 163-180. [0130] Matsuura, T. and Pluckthun, A. (Mar. 27, 2003). Selection based on the folding properties of proteins with ribosome display. FEBS Lett. 539: 24-28. [0131] Muruganandam, A., Tanha, J., Narang, S., and Stanimirovic, D. (2002). Selection of phage-displayed llama single-domain antibodies that transmigrate across human blood-brain barrier endothelium. FASEB J. 16: 240-242. [0132] Pace, C. N., Vajdos, F., Fee, L., Grimsley, G., and Gray, T. (1995). How to measure and predict the molar absorption coefficient of a protein. Protein Sci. 4: 2411-2423. [0133] Ricci, S., Medaglini, D., Marcotte, H., Olsen, A., Pozzi, G., and Bjorck, L. (2001). Immunoglobulin-binding domains of peptostreptococcal protein L enhance vaginal colonization of mice by Streptococcus gordonii. Microb. Pathog. 30: 229-235. [0134] Sambrook, J. F. E. F. a. M. T. (1989). Molecular Cloning: A laboratory Manual (2.sup.nd ed.), Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. [0135] Sblattero, D. and Bradbury, A. (1998). A definitive set of oligonucleotide primers for amplifying human V regions. Immunotechnology. 3: 271-278. [0136] Tanha, J., Dubuc, G., Hirama, T., Narang, S. A., and MacKenzie, C. R. (May 1, 2002). Selection by phage display of llama conventional V(H) fragments with heavy chain antibody V(H)H properties. J. Immunol. Methods 263: 97-109. [0137] Tanha, J., Muruganandam, A., and Stanimirovic, D. (2003). Phage Display Technology for Identifying Specific Antigens on Brain Endothelial Cells. Methods Mol. Med. 89: 435-450. [0138] Tanha, J., Xu, P., Chen, Z. G., Ni, F., Kaplan, H., Narang, S. A., and MacKenzie, C. R. (Jul. 6, 2001). Optimal design features of camelized human single-domain antibody libraries. J. Biol. Chem 276: 24774-24780. [0139] van der Linden, R. H., Frenken, L. G., de Geus, B., Harmsen, M. M., Ruuls, R. C., Stok, W., de Ron, L., Wilson, S., Davis, P., and Verrips, C. T. (Apr. 12, 1999). Comparison of physical chemical properties of llama VHH antibody fragments and mouse monoclonal antibodies. Biochim. Biophys. Acta 1431: 37-46. [0140] Waldo, G. S. (2003). Genetic screens and directed evolution for protein solubility. Curr. Opin. Chem. Biol. 7: 33-38. [0141] Ward, E. S., Gussow, D., Griffiths, A. D., Jones, P. T., and Winter, G. (Oct. 12, 1989). Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli [see comments]. Nature 341: 544-546. [0142] Zhang, J., Li, Q., Nguyen, T. D., Tremblay, T. L., Stone, E., To, R., Kelly, J., and MacKenzie, C. R. (Jul. 30, 2004). A pentavalent single-domain antibody approach to tumor antigen discovery and the development of novel proteomics reagents. J. Mol. Biol. 341: 161-169.
TABLE-US-00001 TABLE 1 V.sub.H sequence deviations from parental germline sequences V/J Amino acid deviation from V.sub.H germlines V and FR4 germline sequences HVHP44 DP47/JH4b L5V, Q105R HVHB82 DP47/JH6c E1Q, L5Q HVHP421 DP47/JH4b E1Q, V2L, L5Q, L11V, G16R HVHP419 DP47/JH4b E1Q, V2L, L5Q, T77S, R83G, K94R HVHP430 DP47/JH3b E1Q, L5V, V12I, Q13K, S31N, G52AS, L78V, A93V, K94R HVHP429 DP47/JH4 L5V, G10T, S30I, S31N, G42D, E46D, A50T, G52aN, S53N, S56A K75N, A84P, E85D HVHM41 DP47/JH3a E1Q, L5V, E6Q, G16R, T28A, S53G, G55D, S56H, M108L HVHM81 DP47JH3a L5V, E6Q, G16R, S30D, S31D, S35H, A50G, G55A, E85G, V89L, K94R HVHP428 V3-49/JH4b E1Q, V2L, V5Q, R16G, T23A, G30S, D31S, T60A, G73D, K83R, T84A, V89M, T93A HVHP420 DP-38/JH4b E1Q, S35T, S52aT HVHP414 DP-38/JH3b E1D, E6Q, A23T, T28P, K52T, A60V HVHP423 V3-53/JH1 E1Q, V2M, E6Q, L11V, I12V, N32S, Y33R, V37F, K43M, K64R, T68S, V89L HVHP44B V3-53/JH1 E1Q, E6Q, N32S, Y33R, V37F, K43M, Y58S, K64R, T68S, V89L HVHP413 YAC-5/JH3b E1Q, E6Q, Q13K, V29F, S31D, N32Y, V50F HVHP426 8-1B/JH3b E1Q, E6Q, L11V, G16R, T28I, S30D, S31G, N32Y, Y33A, S35H, K43Q, I51T, Y52N, S53N, Y58S, L78V
TABLE-US-00002 TABLE 2 Biophysical characteristics of the human V.sub.Hs Exp.# K.sub.D Trypsin RE V.sub.H/V.sub.HH (mg) (?M) resistance (%) HVHP44 8.2 1.3 ? 93 HVHB82 5.9 0.2 ? 71 HVHP421 5.5 1.0 ? 14 HVHP419 3.4 1.6 ? 84 HVHP430 6.4, 23.7 2.3 ? 88 HVHP429 3.4 1.3 ? 86 HVHM41 1.8 0.5 X 92 HVHM81 4.3 1.3 ? 87 HVHP428 3.1 1.8 ? 95 HVHP420 59.0 1.2 ? 92 HVHP414 11.8 1.6 ? 73 HVHP423 2.4, 62.1 3.0 ? 86 HVHP413 5.8 0.3 ? 52 HVHP426 6.3 0.8 ? 70 H11F9* ND 3.5 ND 95 H11B2* ND 2.0 ND 100 #expression yield per liter of bacterial culture *K.sub.D s and RE s were determined against H11 scFv.
TABLE-US-00003 TABLE 3 Characteristics of the human V.sub.Ls Expression.sup.a K.sub.D Oligomerization V.sub.L Subgroup mg ?M state.sup.b HVLP324 V?I 6.9 0.2, 0.01.sup.c Monomer HVLP325 V?III 6.2 1 Monomer/Aggregate HVLP335 V?III 73.5 2 Monomer HVLP342 V?I 7.7 0.6, 0.04.sup.c Monomer HVLP351 V?III 8.9 2 Monomer HVLP364 V?III 77.1 3 Monomer HVLP389 V?I 16.7 1 Monomer HVLP3103 V?III 19.0 1 Monomer .sup.aExpression yield per liter of bacterial culture. .sup.bOligomerization state was determined by gel filtration chromatography. .sup.cThe smaller K.sub.D values correspond to the binding of the of HVLP324 and HVLP342 to the high affinity sites on protein L.
TABLE-US-00004 TABLE 4 Kinetic and equilibrium constants for the bindings of HVHP328PTV2 and HVLP335PTV2 to protein A and L, respectively Pentabody HVHP328PTV2 HVLP335PTV2 k.sub.a (M.sup.?1s.sup.?1) 4.3 ? 10.sup.5 1.7 ? 10.sup.6 k.sub.d (s.sup.?1) <1 ? 10.sup.?3 <4 ? 10.sup.?4 K.sub.D (M) <2 ? 10.sup.?9 .sup.<2 ? 10.sup.?10