Anti-Her2 single chain antibody and coding sequence and use thereof

11517632 · 2022-12-06

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are an anti-Her2 nanobody and a coding sequence and the use thereof. In particular, provided is a nanobody combating human epidermal growth factor receptor-2 (Her2/ERBB2). Disclosed are the nanobody and the a gene sequence encoding the nanobody, a corresponding expression vector and a host cell capable of expressing the nanobody, and a method for producing the nanobody of the present invention and the related use thereof. The present invention may also provide an immunoconjugate of the nanobody and the use thereof, especially the use in the diagnosis and treatment of Her2 positive tumor.

Claims

1. A VHH chain of anti-Her2 single domain antibody, wherein amino acid sequence of the VHH chain is shown as any one of SEQ ID NOs: 1-40.

2. A polynucleotide, wherein the polynucleotide encodes a protein selected from the group consisting of the VHH chain of anti-Her2 single domain antibody of claim 1.

3. The polynucleotide of claim 2, wherein the polynucleotide has a nucleotide sequence as shown in any one of SEQ ID NOs: 41-80.

4. An immunoconjugate comprising: (a) the VHH chain of anti-Her2 single domain antibody of claim 1; and (b) a conjugating part selected from the group consisting of a detectable marker, drug, toxin, cytokine, radionuclide, enzyme, gold nanoparticle/nanorod, magnetic nanoparticle, viral coat protein or VLP, and a combination thereof.

5. The immunoconjugate of claim 4, wherein the radionuclide includes: (i) a diagnostics radioisotope selected from the group consisting of Tc-99m, Ga-68, F-18, 1-123, I-125, 1-131, In-111, Ga-67, Cu-64, Zr-89, C-11, Lu-177, Re-188, and a combination thereof; and/or (ii) a therapeutics radioisotope selected from the group consisting of Lu-177, Y-90, Ac-225, As-211, Bi-212, Bi-213, Cs-137, Cr-51, Co-60, Dy-165, Er-169, Fm-255, Au-198, Ho-166, 1-125, 1-131, Ir-192, Fe-59, Pb-212, Mo-99, Pd-103, P-32, K-42, Re-186, Re-188, Sm-153, Ra223, Ru-106, Na24, Sr89, Tb-149, Th-227, Xe-133 Yb-169, Yb-177, and a combination thereof.

6. The immunoconjugate of claim 4, wherein the drug is a cytotoxic drug.

7. The immunoconjugate of claim 6, wherein the cytotoxic drug is selected from the group consisting of: antitubulin drug, DNA sulcus binding reagent, DNA replication inhibitor, alkylation reagent, antibiotic, folic acid antagonist, antimetabolic drug, chemosensitizer, topoisomerase inhibitor, Catharanthus roseus alkaloid and a combination thereof.

8. The immunoconjugate of claim 4, wherein the toxin is selected from the group consisting of: an Auristatins, chlortetracycline, metotanol, ricin, ricin A chain, cobustatin, docamicin, adriamycin, daunorubicin, paclitaxel, cisplatin, cc1065, ethidium bromide, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, dihydroxyanthracnose diketone, actinomycin, diphtheria toxin, Pseudomonas exotoxin (PE) A, PE40, abrin, abrin A chain, modeccin A chain, gelonin, mitogellin, retstrictocin, phenomycin, enomycin, curicin, crotin, calicheamicins, Sapaonaria officinalis inhibitor, glucocorticoid and a combination thereof.

9. The immunoconjugate of claim 8, wherein the Auristatin is selected from the group consisting of Auristatin A, Auristatin F, MMAE and MMAF.

10. A detection reagent of Her2 protein or Her2 cancer, wherein the detection reagent comprises the immunoconjugate of claim 4 and a detection acceptable carrier.

11. The detection reagent of claim 4, wherein the detection reagent detectable marker is one or more markers selected from the group consisting of isotope tracer, contrast agent, flow detection reagent, cellular immunofluorescence detection reagent, magnetic nanoparticles and imaging agent.

12. A pharmaceutical composition comprising: (a) the VHH chain of anti-Her2 single domain antibody of claim 1, or an immunoconjugate comprising the VHH chain of the anti-Her2 single domain antibody; and (b) a pharmaceutically acceptable carrier.

13. The VHH chain of anti-Her2 single domain antibody of claim 1, wherein the amino acid sequence of the VHH chain is shown as any one of SEQ ID NOs: 8, 7, 15, 12, 27, 11, 32, and 13.

14. The VHH chain of anti-Her2 single domain antibody of claim 1, wherein the amino acid sequence of the VHH chain is shown as any one of SEQ ID NOs: 9, 10, 13, 17, 22, 23, and 26.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIG. 1 shows SDS-PAGE diagram of antigen protein purification. Three electrophoresis lanes from left to right in FIG. 1 are nucleic acid molecular for reference, purified human Her2 (ECD)-Fc protein and the human Her2 (ECD) protein digested by TEV enzyme. The proteins above are both expressed by HEK293F cell.

(2) FIG. 2 shows a map of library construction and its quality inspection. Figure A shows the product of first PCR amplification, and the target band with a size of about 700 bp was tapped and recycled. Figure B shows the product of second PCR amplification, and the obtained VHH gene fragment is approximately 400 bp. Figure C shows the size of the constructed phage display library. The constructed library was coated onto a plate with gradient dilution. ⅕ of the clones was gradiently diluted. They were 10.sup.3 fold, 10.sup.4 fold, 10.sup.5 fold and 10.sup.6 fold dilutions. The number of clones was counted, and the size of the library was determined to be 2×10.sup.9 CFU. Figure D shows the insertion rate of the library. 24 clones of the library were randomly selected for PCR identification. The DNA bands from left to right gel holes are indicated from the following: first is DNA molecular marker, and the rest are PCR products for detecting inserted fragments. The band of PCR product was about 500 bp and the detected VHH insertion rate of the library was 100%.

(3) FIG. 3 shows screening and enrichment process of Her2 nanobody. The library was not enriched in the first round of panning, enriched 3.75 times in the second round of panning and 110 times in the third round of panning.

(4) FIG. 4 shows purification result of Her2 nanobodies. Nanobodies was prepared and purified in one step by ion affinity chromatography with nickel column. Purity of the nanobodies are more than 95%.

(5) FIG. 5 shows affinity of Her2 nanobody to Her2 of different species. Nanobody reacted with human and mouse antigen protein Her2 at different gradient concentrations. Results showed that the nanobody only bound to human Her2.

(6) FIG. 6 shows SPECT-CT imaging results of 1-125 labeled HER-2 nanobody in tumor-bearing mice with high expression of Her2. Results showed that several nanobodies could effectively accumulate in highly expressed tumors of Her2, and non-binding antibodies could be quickly removed from the blood through kidney and bladder.

(7) FIG. 7 shows SPECT-CT imaging results of 99m-Tc labeled Her2 nanobody in tumor-bearing mice with high expression of Her2. The nanobodies could specifically accumulate in the highly expressed tumor of Her2. Non-binding antibodies could be quickly removed from the blood through the kidney and bladder. Moreover, the nanobody did not compete with Trastuzumab or Patozumab.

DETAILED DESCRIPTION

(8) Through extensive and in-depth research, the inventor successfully obtained a class of anti-Her2 nanobodies after numerous screening. Experimental results show that the Her2 nanobody obtained by the invention can effectively bind to Her2.

(9) In particular, the human Her2 antigen protein was used to immunize a camel, thereby obtaining a gene library of nanobodies with high quality. The Her2 protein molecules were coated onto an ESLIA plate and exhibited correct spatial structure of Her2 protein. The antigens in such configuration were used to screen the gene library of nanobodies using phage display technology (phage display of a gene library from camel heavy chain antibodies) thereby obtaining genes of nanobodies with Her2 specificity. Then the genes were transferred into E. coli thereby obtaining the strains which can be effectively expressed in E. coli with high specificity.

(10) The invention also discovered an immunoconjugate specifically suitable for detecting Her2 molecules for the first time. The immunoconjugate comprises a specific VHH chain of anti-Her2 nanobody and a radionuclide and can be used for non-invasive detection of Her2 expression in the subject to be tested. The immunoconjugate of invention has a small size and high specificity, making it suitable for systemic detection of primary and metastatic tumors. In addition, the immunoconjugate has high accuracy and low radiation dose.

(11) In addition, the invention also provides an immunoconjugate which can effectively treat Her2 positive tumor.

(12) As used herein, the terms “nanobody of the invention”, “anti-Her2 nanobody of the invention” and “Her2 nanobody of the invention” are interchangeable, and all refer to nanobody that specifically recognize and bind to Her2 (including human Her2). The more preferable nanobody is one comprising a VHH chain of amino acid sequence as shown in SEQ ID NOs:1-40.

(13) As used herein, the term “antibody” or “immunoglobulin” is a heterotetrameric glycosaminoglycan protein of about 150,000 Dalton with the same structural features, consisting of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to the heavy chain through a covalent disulfide bond, and the number of disulfide bonds between the heavy chains of different immunoglobulin isoforms is different. Each heavy and light chain also has intra-chain disulfide bonds which are regular spaced. Each heavy chain has a variable region (VH) at one end followed by a plurality of constant regions. Each light chain has a variable region (VL) at one end and a constant region at the other end; the constant region of the light chain is opposite to the first constant region of the heavy chain, and the variable region of the light chain is opposite to the variable region of the heavy chain. Special amino acid residues form an interface between the variable regions of the light and heavy chains.

(14) As used herein, the terms “single domain antibody (VHH)” and “nanobody” have the same meaning referring to a variable region of a heavy chain of an antibody, and construct a single domain antibody (VHH) consisting of only one heavy chain variable region. It is the smallest antigen-binding fragment with complete function. Generally, the antibodies with a natural deficiency of the light chain and the heavy chain constant region 1 (CH1) are first obtained. The variable regions of the heavy chain of the antibody are therefore cloned to construct a single domain antibody (VHH) consisting of only one heavy chain variable region.

(15) As used herein, the term “variable” refers that certain portions of the variable region in the nanobodies vary in sequences, which forms the binding and specificity of various specific antibodies to their particular antigen. However, variability is not uniformly distributed throughout the nanobody variable region. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions in the variable regions of the light and heavy chain. The more conserved part of the variable region is called the framework region (FR). The variable regions of the natural heavy and light chains each contain four FR regions, which are substantially in a β-folded configuration, joined by three CDRs which form a linking loop, and in some cases can form a partially β-folded structure. The CDRs in each chain are closely adjacent to the others by the FR regions and form an antigen-binding site of the nanobody with the CDRs of the other chain (see Kabat et al., NIH Publ. No. 91-3242, Volume I, pages 647-669. (1991)). The constant regions are not directly involved in the binding of the nanobody to the antigen, but they exhibit different effects or functions, for example, involving in antibody-dependent cytotoxicity of the antibodies.

(16) As known by those skilled in the art, immunoconjugates and fusion expression products include: conjugates formed by binding drugs, toxins, cytokines, radionuclides, enzymes, and other diagnostic or therapeutic molecules to the nanobodies or fragments thereof of the present invention. The invention also includes a cell surface marker or an antigen that binds to said anti-Her2 protein nanobody or the fragment thereof.

(17) As used herein, the term “heavy chain variable region” and “V.sub.H” can be used interchangeably.

(18) As used herein, the terms “variable region” and “complementary determining region (CDR)” can be used interchangeably.

(19) In another preferred embodiment, the heavy chain variable region of said nanobody comprises 3 complementary determining regions: CDR1, CDR2, and CDR3.

(20) In another preferred embodiment, the heavy chain of said nanobody comprises the above said heavy chain variable region and a heavy chain constant region.

(21) According to the present invention, the terms “nanobody of the invention”, “protein of the invention”, and “polypeptide of the invention” are used interchangeably and all refer to a polypeptide, such as a protein or polypeptide having a heavy chain variable region, that specifically binds to Her2 protein. They may or may not contain a starting methionine.

(22) The invention also provides other proteins or fusion expression products having the nanobodies of the invention. Specifically, the present invention includes any protein or protein conjugate and fusion expression product (i.e. immunoconjugate and fusion expression product) having a heavy chain containing a variable region, as long as the variable region are identical or at least 90% identical, preferably at least 95% identical to the heavy chain of the nanobody of the present invention.

(23) In general, the antigen-binding properties of a nanobody can be described by three specific regions located in the variable region of the heavy chain, referred as variable regions (CDRs), and the segment is divided into four frame regions (FRs). The amino acid sequences of four FRs are relatively conservative and do not directly participate in binding reactions. These CDRs form a loop structure in which the β-sheets formed by the FRs therebetween are spatially close to each other, and the CDRs on the heavy chain and the CDRs on the corresponding light chain constitute the antigen-binding site of the nanobody. The amino acid sequences of the same type of nanobodies can be compared to determine which amino acids constitute the FR or CDR regions.

(24) The variable regions of the heavy chains of the nanobodies of the invention become a particular interest because at least a part of them is involved in binding antigens. Thus, the present invention includes those molecules having a nanobody heavy chain variable region with a CDR, provided that their CDRs are 90% or more (preferably 95% or more, the most preferably 98% or more) identical to the CDRs identified herein.

(25) The present invention includes not only intact nanobodies but also fragment(s) of immunologically active nanobody or fusion protein(s) formed from nanobodies with other sequences. Therefore, the present invention also includes fragments, derivatives and analogs of the nanobodies.

(26) As used herein, the terms “fragment,” “derivative,” and “analog” refer to a polypeptide that substantially retains the same biological function or activity of a nanobody of the invention. Polypeptide fragments, derivatives or analogs of the invention may be (i) polypeptides having one or more conservative or non-conservative amino acid residues (preferably non-conservative amino acid residues) substituted. Such substituted amino acid residues may or may not be encoded by the genetic code; or (ii) a polypeptide having a substituent group in one or more amino acid residues; or (iii) a polypeptide formed by fusing a mature polypeptide and another compound (such as a compound that increases the half-life of the polypeptide, for example, polyethylene glycol); or (iv) a polypeptide formed by fusing an additional amino acid sequence to the polypeptide sequence (e.g., a leader or secretory sequence or a sequence used to purify this polypeptide or a proprotein sequence, or a fusion protein formed with a 6 His tag). According to the teachings herein, these fragments, derivatives, and analogs are within the scope of one of ordinary skill in the art.

(27) The nanobody of the present invention refers to a polypeptide including the above CDR regions having Her2 protein binding activity. The term also encompasses variant forms of polypeptides comprising the above CDR regions that have the same function as the nanobodies of the invention. These variations include, but are not limited to, deletion insertions and/or substitutions of one or several (usually 1-50, preferably 1-30, more preferably 1-20, optimally 1-10) amino acids, and addition of one or several (generally less than 20, preferably less than 10, and more preferably less than 5) amino acids at C-terminus and/or N-terminus. For example, in the art, the substitution of amino acids with analogical or similar properties usually does not alter the function of the protein. For another example, addition of one or several amino acids at the C-terminus and/or N-terminus usually does not change the function of the protein. The term also includes active fragments and active derivatives of the nanobodies of the invention.

(28) The variant forms of the polypeptide include: homologous sequences, conservative variants, allelic variants, natural mutants, induced mutants, proteins encoded by DNAs capable of hybridizing with DNA encoding the nanobody of the present invention under high or low stringent conditions, and polypeptides or proteins obtained using antiserum against the nanobodies of the invention.

(29) The invention also provides other polypeptides, such as a fusion protein comprising nanobodies or fragments thereof. In addition to almost full-length polypeptides, the present invention also includes fragments of the nanobodies of the invention. Typically, the fragment has at least about 50 contiguous amino acids of the nanobody of the invention, preferably at least about 50 contiguous amino acids, more preferably at least about 80 contiguous amino acids, and most preferably at least about 100 contiguous amino acids.

(30) In the present invention, “a conservative variant of a nanobody of the present invention” refers to the polypeptides in which there are up to 10, preferably up to 8, more preferably up to 5, and most preferably up to 3 amino acids substituted by amino acids having analogical or similar properties, compared to the amino acid sequence of the nanobody of the present invention. These conservative variant polypeptides are preferably produced according to the amino acid substitutions in Table 1.

(31) TABLE-US-00001 TABLE 1 Original Representative Preferable residue substitution substitution Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Lys; Arg Gln Asp (D) Glu Glu Cys (C) Ser Ser Gln (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe Leu Leu (L) Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Leu; Val; Ile; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala Leu

(32) The present invention also provides a polynucleotide molecule encoding the above nanobody or fragment or fusion protein thereof. Polynucleotides of the invention may be in the form of DNA or RNA. DNA forms include cDNA, genomic DNA, or synthetic DNA. DNA can be single-stranded or double-stranded. DNA can be a coding strand or a non-coding strand.

(33) Polynucleotides encoding the mature polypeptides of the invention include: coding sequences only encoding mature polypeptide; coding sequences for the mature polypeptide and various additional coding sequences; coding sequences (and optional additional coding sequences) and non-coding sequences for the mature polypeptide.

(34) The term “polynucleotide encoding a polypeptide” may include a polynucleotide that encodes the polypeptide, and may also include a polynucleotide that includes additional coding and/or non-coding sequences.

(35) The invention also relates to polynucleotides that hybridize to the sequences described above and that have at least 50%, preferably at least 70%, and more preferably at least 80% identity between the two sequences. The present invention specifically relates to polynucleotides that can be hybridized to the polynucleotides of the present invention under stringent conditions. In the present invention, “stringent conditions” refers to: (1) hybridization and elution at lower ionic strength and higher temperature, such as 0.2×SSC, 0.1% SDS, 60° C.; or (2) additional denaturants during hybridization, such as 50% (v/v) formamide, 0.1% fetal bovine serum/0.1% Ficoll, 42° C., etc.; or (3) hybridization occurs only under the identity between the two sequences at least over 90%, preferably over 95%. Also, polypeptides encoded by hybridizable polynucleotides have the same biological functions and activities as mature polypeptides.

(36) The full-length nucleotide sequence of the nanobody of the present invention or a fragment thereof can generally be obtained by a PCR amplification method, a recombination method, or an artificial synthesis method. One possible method is to synthesize related sequences using synthetic methods, especially when the fragment length is short. In general, a long sequence of fragments can be obtained by first synthesizing a plurality of small fragments and then connecting them. In addition, the coding sequence of the heavy chain and the expression tag (eg, 6His) can be fused together to form a fusion protein.

(37) Once the concerned sequences have been obtained, the concerned sequences can be obtained in large scale using recombinant methods. Usually, sequences can be obtained by cloning it into a vector, transferring it into cells, and then isolating the sequences from the proliferated host cells by conventional methods. Bio-molecules (nucleic acids, proteins, etc.) to which the present invention relates include bio-molecules that exist in isolated form.

(38) At present, DNA sequences encoding the protein of the present invention (or a fragment thereof, or a derivative thereof) can be obtained completely by chemical synthesis. The DNA sequence then can be introduced into various existing DNA molecules (or e.g. vectors) and cells known in the art. In addition, mutations can also be introduced into the protein sequences of the invention by chemical synthesis.

(39) The invention also relates to vectors comprising the above-mentioned suitable DNA sequences and suitable promoters or control sequences. These vectors can be used to transform an appropriate host cell so that it can express the protein.

(40) The host cell can be a prokaryotic cell, such as a bacterial cell; or a lower eukaryotic cell, such as a yeast cell; or a higher eukaryotic cell, such as a mammalian cell. Representative examples are: Escherichia coli, Streptomyces, bacterial cells such as Salmonella typhimurium, fungal cells such as yeast, insect cells of Drosophila S2 or Sf9, animal cells of CHO, COST, 293 cells, and the like.

(41) The transformation of the host cell with the recombinant DNA can be performed using conventional techniques well known to those skilled in the art. When the host is a prokaryotic organism such as E. coli, competent cells capable of absorbing DNA can be harvested after the exponential growth phase and treated with the CaCl.sub.2 method. The procedures used are well known in the art. Another method is to use MgCl.sub.2. If necessary, conversion can also be performed by electroporation. When the host is eukaryotic, the following DNA transfection methods can be used: calcium phosphate coprecipitation, conventional mechanical methods such as microinjection, electroporation, liposome packaging, and the like.

(42) The obtained transformants can be cultured in a conventional manner to express the polypeptide encoded by the gene of the present invention. Depending on the host cells used, the medium used in the culture may be selected from various conventional media. The culture is performed under conditions suitable for the host cells growth. After the host cells are grown to an appropriate cell density, the selected promoter is induced by a suitable method (such as temperature shift or chemical induction) and the cells are incubated for a further period of time.

(43) The recombinant polypeptide in the above method may be expressed intracellularly, or on the cell membrane, or secreted extracellularly. If necessary, the recombinant protein can be isolated and purified by various separation methods, utilizing its physical, chemical and other characteristics. These methods are well-known to those skilled in the art. Examples of these methods include, but are not limited to: conventional renaturation treatment, treatment with a protein precipitation agent (salting out method), centrifugation, osmotic disruption, super treatment, ultracentrifugation, molecular sieve chromatography (gel filtration), adsorption layer analysis, ion exchange chromatography, high performance liquid chromatography (HPLC), various other liquid chromatography techniques and the combinations thereof.

(44) The antibodies of the invention may be used alone, or in combination with each other or in conjugated with a detectable marker (for diagnostic purposes), a therapeutic agent, a PK (protein kinase) modification moiety, or a combination thereof.

(45) Detectable markers for diagnostic purposes include, but are not limited to: fluorescent or luminescent markers, radioactive markers, MRI (magnetic resonance imaging) or CT (computed tomography) contrast agents, or enzymes capable of producing detectable products.

(46) Therapeutic agents that can be binded or conjugated to the nanobodies of the present invention include, but are not limited to: 1. Radionuclides; 2. Biological poisons; 3. Cytokines such as IL-2, etc.; 4. Gold nanoparticles/nanorods; 5. Viruses Particles; 6. Liposome; 7. Nano magnetic particles; 8. Drug activating enzymes (for example, DT-diaphorase (DTD) or biphenyl hydrolase-like protein (BPHL)); 10. Chemotherapeutic agents (for example, cisplatin) or any form of nanoparticles, etc.

(47) Immunoconjugate

(48) The invention also provides an immunoconjugate comprising:

(49) (a) the VHH chain of the anti-Her2 nanobody as described in the first aspect of the invention, or the anti-Her2 nanobody as described in the second aspect of the invention; and

(50) (b) a conjugating part selected from the group consisting of radionuclides, enzyme antibodies, cells, and a combination thereof.

(51) In another preferred embodiment, the immunoconjugate is described in the seventh aspect of the invention.

(52) The immunoconjugate of invention can be used for non-invasive detection of Her2 expression of the object to be tested. The immunoconjugate has small size and high specificity and is suitable for systemic detection of primary and metastatic tumors with high accuracy and low radiation dose.

(53) Cytotoxic Agent

(54) The conjugating part of the antibody immunoconjugate of invention includes: toxins, such as small molecular toxins or enzyme active toxins from bacteria, fungi, plant or animal, including their fragments and/or variants. Examples of cytotoxic agents include, but are not limited to: Auristatins (for example, Auristatin E, Auristatin F, MMAE and MMAF), chlortetracycline, metotanol, ricin, ricin A-chain, cobustatin, dokamicin, Dora statin, adriamycin, daunorubicin, paclitaxel, cisplatin, cc1065, ethidium bromide, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, dihydroxyanthracnose diketone, actinomycin, diphtheria toxin, Pseudomonas exotoxin (PE) A, PE40, abrin, abrin A chain, modeccin A chain, α-Sarcina, gelonin, mitogellin, retstrictocin, phenomycin, enomycin, curicin, crocotin, calicheamicins, Sapaonaria officinalis inhibitor, as well as glucocorticoid and other chemotherapy agents. The conjugating part also includes radioisotopes such as At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212 or 213, P32 and Lu (including Lu177). Antibodies can also be conjugated to anticancer prodrug activating enzymes that can convert prodrugs into their active forms.

(55) The preferred small molecular drug is compound with high cytotoxicity, preferably is monomethylauristatin, galactomycin, medenin, and a combination thereof; more preferably is monomethylolastatin-E (MMAE), monomethylolastatin-D (MMAD), monomethylolastatin-F (MMAF), and a combination thereof.

(56) Pharmaceutical Composition

(57) The invention also provides a composition. Preferably, the composition is a pharmaceutical composition comprising the above antibody or active fragment or fusion protein or immunoconjugate thereof, and a pharmaceutically acceptable carrier. In general, these materials can be formulated in non-toxic, inert, and pharmaceutically acceptable aqueous carrier media wherein the pH is generally about 5-8, preferably about 6-8, although the pH can be varied with the nature of the formulation material and the condition to be treated. The formulated pharmaceutical compositions can be administered by conventional routes including, but not limited to, intratumoral, intraperitoneal, intravenous, or topical administration.

(58) The pharmaceutical composition of the present invention can be directly used to bind Her2 protein molecules and thus can be used to treat tumors. In addition, other therapeutic agents can also be used at the same time.

(59) The pharmaceutical composition of the present invention contains a safe and effective amount (for example, 0.001-99 wt %, preferably 0.01-90 wt %, and more preferably 0.1-80 wt %) of the above-mentioned nanobodies of the present invention (or their conjugates) and pharmaceutically acceptable carriers or excipients. Such carriers include, but are not limited to: saline, buffer, dextrose, water, glycerol, ethanol, and the combinations thereof. The drug formulation should be suitable for the mode of administration. The pharmaceutical composition of the present invention may be prepared in the form of injection, for example, by a conventional method using physiological saline or an aqueous solution containing glucose and other adjuvant. Pharmaceutical compositions such as injections and solutions are preferably made under aseptic conditions. The amount of active ingredient administered is a therapeutically effective amount, for example, about 10 ng/kg body weight to about 50 mg/kg body weight per day, more preferably about 50 ng/kg body weight to about 1 mg/kg body weight or 10 μg/kg body weight to about 10 mg/kg body weight. In addition, the polypeptide or its conjugate of the invention may also be used with another therapeutic agent, such as antineoplastic agent or immunomodulatory.

(60) When a pharmaceutical composition is used, a safe and effective amount of the immune-conjugate is administered to the mammal, wherein the safe and effective amount is usually at least about 10 ng/kg body weight, and in most cases, no more than about 50 mg/kg body weight, preferably the dose is about 50 ng/kg body weight to about 1 mg/kg body weight. Of course, factors such as the route of administration and the patient's health status should be considered to define the specific doses, all of which are within the skills of skilled physicians.

(61) Nanobody with Markers

(62) In a preferred embodiment of the invention, the nanobody carries detectable marker. More preferably, the marker is selected from the group consisting of isotope, colloidal gold marker, colored marker, and fluorescent marker.

(63) Colloidal gold markers can be performed using methods known to those skilled in the art. In a preferred embodiment of the invention, the anti-Her2 nanobody is marked with colloidal gold to obtain a colloidal gold-marketed nanobody.

(64) The anti-PD-L1 nanobody of the invention have very good specificity and high titer.

(65) CAR-T Cell

(66) As used herein, the terms “CAR-T cell”, “CAR-T” and “CAR-T cell of the invention” refer to the CAR-T cell described in the nineteenth aspect of the present invention.

(67) As used herein, chimeric antigen receptor (CAR) includes extracellular domain, optional hinge domain, transmembrane domain, and intracellular domain. Extracellular domain includes optional signal peptide and target-specific binding element (also known as antigen binding domain). Intracellular domain includes costimulatory molecules and zeta chain. Costimulatory signaling region comprises part of the intracellular domain of costimulatory molecules. Costimulatory molecules are the cell surface molecules needed for the effective response of lymphocytes to antigens, rather than antigen receptors or their ligands.

(68) As used herein, “antigen binding domain” and “single chain antibody fragment” refer to Fab fragment, Fab′ fragment, F (ab′).sub.2 fragment, or single Fv fragment with antigen binding activity. Fv antibody contains variable region of heavy chain and variable region of the light chain of the antibody. Fv antibody has the smallest antibody fragment with antigen binding sites with no constant region. In general, Fv antibody also contains peptide junctions between VH and VL domains and can form the structures required for antigen binding. Antigen binding domain is usually scFv (single-chain variable fragment), which is preferably an amino acid chain sequence encoded by a nucleoside chain. As a preferred embodiment of the invention, the scFv includes the VHH chain described in the first aspect of the invention, or the nanobody described in the second aspect of the invention.

(69) For both hinge domain and transmembrane region (transmembrane domain), CAR can be designed to comprise the transmembrane domain fused to the extracellular domain of CAR. In one embodiment, a transmembrane domain naturally associated with one of the domains in which the CAR is used. In some examples, transmembrane domains may be selected or modified by amino acid substitution to avoid binding such domains to the transmembrane domains of the same or different surface membrane proteins, thus minimizing interaction with other members of the receptor complex.

(70) Junction can be incorporated between the extracellular domain and transmembrane domain of CAR or between cytoplasmic domain and transmembrane domain of CAR.

(71) As used herein, the term “junction” usually refers to any oligopeptide or polypeptide that connects the transmembrane domain to the extracellular or cytoplasmic domain of the polypeptide chain. The junction may include 0-300 amino acids, preferably 2 to 100 amino acids and more preferably 3 to 50 amino acids.

(72) When CAR is expressed in T cells, the extracellular domain can recognize a specific antigen and transduce the signal through the intracellular domain, causing cell activation and proliferation, cytotoxicity and secretion of cytokines such as IL-2 and IFN-γ. This also affects tumor cells, inhibit the tumor cells and induce apoptosis, and this also reduces or eliminates the tumor load in patients. Antigen binding domain is preferably fused with one or more intracellular domains from costimulatory molecules and Zeta chains.

(73) Detection Method

(74) The invention also relates to a method for detecting Her2 protein. The steps of the method are basically as follows: obtaining cell and/or tissue samples; dissolving the samples in a medium; and detecting the level of Her2 protein in the dissolved samples.

(75) In the detection method of invention, the samples used do not have strict limitations, and a representative example is a cell-containing sample present in a cell preservation solution.

(76) Kit

(77) The invention also provides a kit containing an antibody (or a fragment thereof) or a detection board of invention. In a preferred embodiment of the present invention, the kit also includes a container, a usage manual, a buffer etc.

(78) This invention also provides a detection kit for detecting the Her2 level, which includes an antibody for identifying the Her2 protein, a lysis medium for dissolving the sample, a general reagent and a buffer needed for detection, such as various buffer, detection markers, and detection substrates and so on. The detection kit is an in vitro diagnostic device.

(79) The invention also provides a kit containing the immunoconjugate of invention. In a preferred embodiment of the present invention, the kit also includes a container, manual, isotope tracer and one or more reagents selected from the group consisting of: contrast agent, flow detection reagent, cellular immunofluorescence detection reagent, nanometer magnetic particle and imaging agent.

(80) The preferred kit of the invention is an in vivo diagnostic kit, which is used for non-invasive detection of Her2 expression of the object to be tested.

(81) Application

(82) As mentioned above, the nanobody of invention has extensive biological application value and clinical application value. Its application involves various fields such as diagnosis and treatment of diseases related to Her2, basic medical research, biological research and so on. One preferred application is for clinical diagnosis and targeted treatment of Her2.

(83) Major advantages of invention include:

(84) (a) The nanobody of the invention has high specificity against human Her2 protein with correct spatial structure.

(85) (b) The nanobody of the invention has a strong affinity.

(86) (c) The nanobody of the invention is simple to produce

(87) (d) The nanobody of invention can specifically bind to human Her2, and accumulate effectively in the tumor model with high expression of Her2 without competing with Trastuzumab or Pertuzumab. The nanobody of invention is very suitable for Her2 targeted cancer diagnosis and curative effect evaluation, as well as Her2 targeted in vivo radiotherapy for a new generation.

(88) The present invention is further described in combination with specific embodiments. It should be understood that these examples are only for illustrating the present invention and are not intended to limit the scope of the present invention. The experimental methods that do not specify the specific conditions in the following examples are generally performed according to conventional conditions such as those described in Sambrook et al., Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989), or according to the conditions recommended by the manufacturer. Unless otherwise indicated, percentages and parts are percentages by weight and parts by weight.

Embodiment 1: Expression and Purification of Human Her2 Protein

(89) (1) Nucleotide sequence of human Her2 was synthesized in pCDNA3.1 (-) vector, and its extracellular domain sequence was subcloned into pFUSE-IgG1 vector. TEV restriction site was introduced at the C-terminal of hHer2 (ECD) for the preparation of a hHer2 (ECD) protein without Fc tag.

(90) (2) The constructed pFUSE-IgG1-hHer2 (ECD) plasmid was extracted by an Omega plasmid Maxi kit.

(91) (3) HEK293F cell was cultured to OD of 2.0×10.sup.6 cells/mL.

(92) (4) The plasmid was mixed with transfection reagent PEI at a ratio of 1:5, incubated for 10 min and then added into HEK293F cells. The transfected cell was incubated at 37° C., 6% CO.sub.2 shaking bed incubator for 5-6 days.

(93) (5) The supernatant of cells was collected and mixed with Protein A beads at room temperature for 1 h.

(94) (6) The beads were washed with phosphate buffer (pH 7.0) and the protein was eluted with 0.1M pH 3.0 Glycine.

(95) (7) The eluted protein was ultrafiltered into PBS and sampled for an SDS-PAGE test after yield measurement (the test results are shown in FIG. 1). The purity of antigen was greater than 95% and could be used for subsequent immunization.

(96) (8) Then the Protein was digested with TEV enzyme and the untagged antigen protein Her2 (ECD) was obtained for subsequent antibody screening.

Embodiment 2: Construction of Anti-Her2 Nanobody Library

(97) (1) 1 mg hHer2 (ECD)-Fc antigen was mixed with Freund's adjuvant in equal volumes for the immunization of a Xinjiang camel once a week for a total of three times to stimulate B cells to express antigen-specific nanobody.

(98) (2) 100 mL camel peripheral blood was collected after immunization for three times. RNA was extracted from lymphocytes in blood sample.

(99) (3) The cDNA was synthesized and the VHH was amplified by nested PCR.

(100) (4) 20 ug pMECs phage display vector (supplied by Biovector) and 10 ug VHH were digested with restriction endonuclease Pst I and Not I, and two fragments were then ligated.

(101) (5) The ligation products were transformed into TG1 cells with electroporation. Her2 nanobody library was constructed and the size of library was determined. Results are shown in FIG. 2C, the library was coated onto a plate. ⅕ of the clones was gradiently diluted. They were 10.sup.3 fold, 10.sup.4 fold, 10.sup.5 fold and 10.sup.6 fold dilutions. The number of clones was calculated. Size of the library was determined to be 2×10.sup.9 CFU.

(102) (6) At the same time, 24 clones were randomly selected for colony PCR detection. FIG. 2D shows the result of colony PCR and demonstrated that the insertion rate of the constructed library was 100%.

Embodiment 3: Screening and Identification of Her2 Nanobody

(103) Screening of Antibody

(104) (1) 10 μg Her2 (ECD)-Fc antigen (10 μg Fc in NaHCO.sub.3 as control) dissolved in 100 mM NaHCO.sub.3 (pH 8.2) was coupled to a NUNC plate then incubated at 4° C. overnight.

(105) (2) 100 μL 0.1% BSA was added on the next day and blocked at room temperature for 2 h.

(106) (3) After 2 hours, 100 μL bacteriophage (2×10.sup.11 CFU nanobody phage display library from the immunized camel) was added and reacted at room temperature for 1 hour.

(107) (4) The plate was washed 5 times with 0.05% PBS+Tween-20 to remove non-specific bacteriophages.

(108) (5) 100 mM of triethanolamine was added to dissociate bacteriophages specifically bound to Her2. The bacteriophage was transformed to Escherichia coli TG1 cells in log phase and incubated at 37° C. for 1 h. The bacteriophages were generated and purified for the next round of screening. The screening process was repeated for 3 rounds. The enrichment results are shown in figure. 3. 110× enrichment occurs after three rounds of bio-panning process.

(109) Phage-based enzyme-linked immunosorbent assay (ELISA) was used to screen specific single positive clone.

(110) (1) From the cell culture dishes containing the bacteriophages obtained after above 2-3 rounds of screening, 600 individual colonies were selected and inoculated into TB medium containing 100 μg/mL ampicillin (1 L of TB medium contains 2.3 g KH.sub.2PO.sub.4, 12.52 g K.sub.2HPO.sub.4, 12 g peptone, 24 g yeast extract, 4 mL glycerol). After growth to log phase, IPTG was added to a final concentration of 1 mM and cultured at 28° C. overnight.

(111) (2) The crude antibodies were extracted by osmotic method, transferred to antigen coated ELISA plate and placed at room temperature for 1 hour.

(112) (3) The unbound antibodies were washed off with PBST. Mouse anti-HA antibodies (purchased from Beijing Kangwei Century Biotechnology Co., Ltd.) was added and placed at room temperature for 1 hour.

(113) (4) The unbound antibodies were washed off with PBST. Goat anti-mouse alkaline phosphatase labeled antibodies were added and placed at room temperature for 1 hour.

(114) (5) The unbound antibody was washed off with PBST. Alkaline phosphatase chromogenic solution was added and the absorption value of each sample was read at 405 nm wavelength with spectrometer.

(115) (6) When the OD value of the sample was over 3 times of the OD value of the control sample (Ratio+/−>3), the tested sample was determined to be a positive clone. A total of 486 positive clones were found from PE-ELISA and their ratios (Ratio: +/−) were between 3 and 30. Then all the positive clones were transferred to LA medium for plasmid extraction and sequencing. Because the number of sequencing results was large and most of the sequences were repetitive, only the corresponding ELISA results of the final 40 nanobodies were shown in Table 2.

(116) TABLE-US-00002 TABLE 2 Nanobody No. 1 2 3 4 5 6 7 8 A405+ 1.7152 1.5341 1.3097 1.9694 1.1044 2.143 2.2361 2.5615 A405− 0.0769 0.0794 0.1009 0.0929 0.0871 0.0914 0.0816 0.0915 Ratio(+/−) 22.30 19.32 12.98 21.20 12.68 23.45 27.40 27.99 Nanobody No. 9 10 11 12 13 14 15 16 A405+ 2.1524 1.6302 1.8819 2.1761 2.2359 1.9576 2.2728 1.7853 A405− 0.0886 0.0728 0.0739 0.0851 0.0891 0.0804 0.087 0.0761 Ratio(+/−) 24.29 22.39 25.47 25.57 25.09 24.35 26.12 23.46 Nanobody No. 17 18 19 20 21 22 23 24 A405+ 1.8811 1.5904 1.7713 1.4735 2.0862 1.7769 1.7703 2.6757 A405− 0.0791 0.0829 0.0906 0.1439 0.1029 0.0833 0.1034 0.1127 Ratio(+/−) 23.78 19.18 19.55 10.24 20.27 21.33 17.12 23.74 Nanobody No. 25 26 27 28 29 30 31 32 A405+ 1.9731 1.8971 1.6555 1.857 1.4811 2.3129 1.6545 2.3609 A405− 0.0879 0.09 0.0808 0.0798 0.079 0.0966 0.0774 0.0934 Ratio(+/−) 22.45 21.08 20.49 23.27 18.75 23.94 21.38 25.28 Nanobody No. 33 34 35 36 37 38 39 40 A405+ 2.0527 2.2628 1.99 2.2236 2.095 2.1419 1.8579 1.5695 A405− 0.0965 0.1129 0.0947 0.1029 0.1067 0.0981 0.094 0.0824 Ratio(+/−) 21.27 20.04 21.01 21.61 19.63 21.83 17.76 19.05 The nucleotide sequences of the 40 strains of nanobodies were shown in SEQ ID NO.: 1-40, respectively. The amino acid sequence of the VHH having number n is SEQ ID NO.: n, and the corresponding coding sequence is SEQ ID NO.: 40 + n.

(117) TABLE-US-00003 TABLE 3 Amino Acid Nucleotide 3 CDR locations Number Sequences Sequences (based on amino acid sequences) No. SEQ ID NO.: SEQ ID NO.: CDR1 CDR2 CDR3 1 1 41 26-35 51-57 96-112 2 2 42 26-35 51-57 96-112 3 3 43 26-35 51-57 96-112 4 4 44 26-35 51-57 96-112 5 5 45 26-35 51-57 96-107 6 6 46 26-35 51-57 96-114 7 7 47 26-35 51-57 96-114 8 8 48 26-35 51-57 96-112 9 9 49 26-35 51-57 96-112 10 10 40 26-35 51-57 96-112 11 11 41 26-35 51-57 96-112 12 12 42 26-35 51-57 96-112 . . . . . . . . . . . . . . . . . . n n 40 + n See See See sequence sequence sequence The sequences of 40 strains of nanobodies are as follows, where the three CDR regions of 40 strains of nanobodies are underlined.

(118) TABLE-US-00004 SEQ ID NO. 1: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAAHPLHYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 2: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNAVYLQMNSLKPEDTAVYYCAAHPLHYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 3: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDSDVRWYRQAPGRECKLVSSISSDRSAYYEDSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAAHPLHYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 4: QVQLQESGGGLVQPGGSLRLSCTASRFTFDDSDMAWYRQAPGNECELVSIISSDGSTYYADSVKGRFT ISLDNTKSTVYLQMNSLKPEDTAVYYCAAHPLHYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 5: QVQLQESGGGSVQAGGSLRLSCTVSGFSFDDSDMGWYRRAPGNECELVSGISRDGSTYYADSVKGR FTISQDNAKNWVYLQMNSLKPEDTAVYYCAAATYSDYVCDYWTQGTQVTVSS SEQ ID NO. 6: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSHISSDGSTYYADSVKGRF TISQDNAKNTVFLQMNSLKPEDTAVYYCAADKDARGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 7: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADKDARGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 8: QVQLQESGGGSVQAGETLRLSCTASGFTFDESVMGWYRQAPGNECELVSTISSDGSTYYSNSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADDHTYELGTCEALNYWGRGTQVTVSS SEQ ID NO. 9: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGSECELVSTISSDGNTYYSNSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADDQHYELGTCEALDYWGRGTQVTVSS SEQ ID NO. 10: QVQLQESGGGSVQAGETLKLSCTASGFTFDDSTMAWYRQAPGNECKLVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADDQNYELGTCEALDYWGRGTQVTVSS SEQ ID NO. 11: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSHISSGGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADGSNYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 12: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADGHKYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 13: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISADGSTFYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCASPENEYELGTCEALDYWGQGTQVTVSS SEQ ID NO. 14: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSRISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAALEWEYELGTCEALDYWGQGTQVTVSS SEQ ID NO. 15: QVQLQESGGGSVQAGGSLRLSCTASRFTFDDSDMGWYRQAPGNECELVSTISSDGATYYANSVKGRF TISQDNAANTVYLQMNSLKPEDTAVYYCAALEWEYELGTCEALDYWGQGTQVTVSS SEQ ID NO. 16: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDSDMVWYRQAPGNECELVSRISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAALEWEYELGTCEALDYWGQGTQVTVSS SEQ ID NO. 17: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCADVQIPYGLGTCESLDYWGRGTQVTVSS SEQ ID NO. 18: QVQLQESGGGSVQAGQTLRLSCTASGFTFDDSDMAWYRQAPGNECELVSKMRSDGSTYYADSVKG RFTISQDNAKNTVYLQMNSLKPEDTAVYYCAEDLPYGLGTCTSLDYWGRGTQVTVSS SEQ ID NO. 19: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDSDSDMGWYRQAPGNECELVSSISSDGSTYYADSVKG RFTISQDNAKNTVYLQMNSLKPEDTAVYYCAAINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 20: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDSVMGWFRKAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNNLKPEDTAVYYCAAINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 21: QVQLQESGGGLVQPRGSLRLSCTASGFTFDDSDSDMGWYRQAPGNECELVSSISSDGSTYYADSVKG RFTISQDNAKNTVYLQMNSLKPEDTAVYYCAAINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 22: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDSDMGWYRQAPGNECELVSRISRDGTTYYADSVKGR FTISQDNAKNTVYLQMNSLKPEDTAVYYCADINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 23: QVQLQESGGGSVQAGGSLKLSCSASGFTFDDTDMGWYRQAPGNECELVSTISSDGTTYYTDSVKGR FTISQDNAKNTVYLQMNSLKPEDTAVYYCAAINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 24: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDSDMGWYRQAPGNECELVSSISSDGSTYYADSVKG RFTISQDNAKNTVYLQMNSLKPEDTAVYYCAAINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 25: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDSDMGWYRQAPGNECELVSSISSDGSTYYADSVKG RFTISQDNAKNTVYLQMNSPKPEDTAVYYCAAINSGYELGTCESLDYWGRGTQVTVSS SEQ ID NO. 26: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSSISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTGVYYCAAEGHRYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 27: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAVYYCAADHGGGYELGTCAALDYWGRGTQVTVSS SEQ ID NO. 28: QVQLQESGGGLVQPGGSLRLSCAASGFTFGDSGMGWYRQAPGNECELVSSVSSDGSTYYADSVKGR FTISQDNAKNTVYLRMNSLKPEDTAVYYCAADDHKYELGTCEALDYWGRGTQVTVSS SEQ ID NO. 29: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDLDMRWYRQAPGNECELVSIINSDGRTYYADSVKGRF AISQNNAKNTVYLQMNSLKPEDTAVYYCAADQHRYGLGTCEALDYWGRGTQVTVSS SEQ ID NO. 30: QVQLQESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGRTYYADSVKGRF AISQNNAKNTVYLQMNSLKPEDTAVYYCAADQHRYGLGTCEALDYWGRGTQVTVSS SEQ ID NO. 31: QVQLQESGGGSVQAGETLRLSCTASGFTFNDSNMGWYRQAPGHECELVSTISSDGSTYYADSVKGRF TISQNNARNTVYLQMNSLKPEDTAVYYCAGDWGYELGICTSLDYWGQGTQVTVSS SEQ ID NO. 32: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDVDMGWYRQASGNECELVSTISSDGSTYYADSVKGR FTISQDNAKNTVYLQMNSLKPEDTAMYYCAAARYSDYEGMCGYWSQGTQVTVSS SEQ ID NO. 33: QVQLQESGGGSVQAGGSLRLSCTASGFTFDDVDMGWYRQAPGNECELVSTISSDGSTYYADSVKGR FTISQDNAKNTVYLQMNSLKPEDTAMYYCAAARYSDYEGMCGYWSQGTQVTVSS SEQ ID NO. 34: QVQLQESGGGSVQAGGSLRLSCTVSGFTFDDVDMGWYRQAPGNECELVSTISSDGSTYYADSVKGR FTISQDNAKNTVYLQMNSLKPEDTAMYYCAAARYSDYEGMCGYWSQGTQVTVSS SEQ ID NO. 35: QVQLQESGGGLVQPGGSLRLSCAASGFTFDDVDMGWYRQAPGNECELVSTISSDGSTYYADSVKGR FTISQDNAKNTVYLQMNSLKPEDTAMYYCAAARYSDYEGMCGYWSQGTQVTVSS SEQ ID NO. 36: QVQLQESGGGSVQAGESLRLSCRTSGFSFDDVDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRF TISQDNAKNTVYLQMNSLKPEDTAMYYCAAARYSDYEGMCGYWSQGTQVTVSS SEQ ID NO. 37: QVQLQESGGGSVQAGETLRLSCTVSGFTFDDADMGWYRQAPGNQCELVSTISSDGITYYADSVKGRF TVSQDNAKNTVYLQMNSLKPEDTAMYYCAAARYSDYEGMCGYWSQGTQVTVSS SEQ ID NO. 38: QVQLQESGGGSVQAGGSLRLSCAASGFTYTGYCMGWERQAPGKEREGVATVDSDGDTSYADSVKG RFTISKDNAKNTLYLQMNSLKPEDTAMYYCAADFSRWHLCSTSLATLGYWGQGTQVTVSS SEQ ID NO. 39: QVQLQESGGGSVQAGGSLRLSCAASGYTYTGYCMGWERQAPGKEREGVATIDSDGDTSYADSVKGR FTISKDNAKNTLYLQMNSLKPEDTAMYYCAADFRRWHLCSSSFREDGMDYWGKGTQVTVSS SEQ ID NO. 40: QVQLQESGGGSVQAGETLRLSCAASGYTYTGYCMGWFRQATGKEREGVATIDSDGDTTYADSVKGR FTISKDNGKNTLYLQMNSLKPEDTAMYYCAADFRRWHLCSSSFQEYDMDYWGKGTQVTVSS SEQ ID NO. 41: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCACATCCCCTCCACTACGAGTTGGGTACGTGCGCGGCACTGGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 42: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACGCGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCACATCCCCTCCACTACGAGTTGGGTACGTGCGCGGCACTGGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 43: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGATGTGCGCTGGTACCGCCAGGCTCCAGGGCGTGAGT GCAAGTTGGTCTCAAGTATTAGTAGTGACCGTAGCGCATACTATGAAGACTCCGTGAAGGGCCGATTC ACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACA CAGCCGTGTATTACTGTGCGGCACATCCCCTCCACTACGAGTTGGGTACGTGCGCGGCACTGGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 44: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCGCATATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTCTTTCTGCAAATGAACAGCCTGAAACCTGAAGACAC AGCCGTATATTACTGTGCGGCAGATAAAGACGCCCGCGGTTACGAGTTGGGTACGTGTGAGTCCCTGG ACTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 45: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGTCTCTGGATTCAGTTTCGATGATTCTGACATGGGCTGGTACCGCCGGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAGGTATCAGTAGAGATGGCAGCACATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCCAAGACAACGCCAAGAACTGGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACA CGGCCGTGTATTACTGTGCGGCAGCGACTTATAGCGACTATGTCTGTGACTACTGGACACAGGGGACC CAGGTCACCGTCTCCTCA SEQ ID NO. 46: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCGCATATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTCTTTCTGCAAATGAACAGCCTGAAACCTGAAGACAC AGCCGTATATTACTGTGCGGCAGATAAAGACGCCCGCGGTTACGAGTTGGGTACGTGTGAGTCCCTGG ACTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 47: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATAAAGACGCCCGTGGCTACGAGTTGGGTACGTGTGAGTCCCTGG ACTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 48: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGAATCTGTCATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GTGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATTCAAACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCCGATGATCACACCTACGAATTGGGTACCTGCGAGGCTCTCAACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 49: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAGTGAG TGCGAGTTGGTCTCAACTATTAGTAGTGATGGTAACACCTACTATTCAAACTCCGTGAAGGGCCGATTC ACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACA CAGCCGTGTATTACTGTGCGGCAGATGATCAGCACTACGAGTTGGGTACCTGCGAGGCTCTCGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 50: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAAACTCTCCT GTACAGCCTCTGGATTCACGTTTGATGATTCTACCATGGCCTGGTACCGCCAGGCTCCAGGGAATGAGT GCAAGTTGGTGTCAACTATTAGTAGTGATGGGAGCACATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACA CAGCCGTGTATTACTGTGCGGCAGATGATCAGAACTACGAGTTAGGTACCTGCGAGGCTCTCGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 51: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCACATATTAGTAGTGGTGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATGGGAGTAACTACGAATTGGGTACGTGCGCTGCCTTAGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 52: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATGGGCATAAGTACGAGTTGGGTACGTGCGCTGCCTTAGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 53: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGATATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTGCTGATGGTAGCACATTCTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGTCCCCAGAGAATGAGTACGAATTGGGTACTTGCGAGGCCCTAGATTACTG GGGCCAGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 54: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATCATGGCGGGGGGTACGAGTTGGGTACTTGTGCGGCCCTTGATTA CTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 55: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTAGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCGACTATTAGTAGTGATGGTGCCACATACTATGCAAACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCGCGAACACGGTATATCTACAAATGAACAGCCTGAAACCTGAGGACACA GCCGTTTATTACTGTGCGGCGTTAGAATGGGAATACGAATTGGGTACGTGCGAAGCCCTGGATTACTGG GGCCAGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 56: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGTCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCACGTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTATATCTACAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTTTATTACTGTGCGGCGTTAGAATGGGAATACGAATTGGGTACGTGCGAAGCCCTGGATTACTG GGGCCAGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 57: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC GGCCGTGTATTACTGTGCGGACGTTCAGATCCCCTATGGGTTGGGTACCTGTGAGTCGTTGGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 58: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGACAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGCCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAAAAATGCGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGCTTC ACCATCTCCCAAGACAACGCGAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACA CAGCCGTGTATTACTGTGCGGAGGATTTGCCCTACGGGTTGGGTACTTGCACTTCCCTGGACTACTGGG GCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 59: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCCGGATTCACTTTTGATGATTCTGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGA ACGAGTGCGAGTTGGTCTCATCTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCC GATTCACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGA GGACACAGCCGTGTATTACTGTGCAGCCATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGA CTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 60: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGCGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGTGATGGGCTGGTTCCGGAAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAACCTGAAACCTGAGGACAC GGCCGTGTATTACTGTGCAGCCATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 61: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTTGGTCCAGCCTAGGGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGA ACGAGTGCGAGTTGGTCTCATCTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCC GATTCACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGA GGACACAGCCGTGTATTACTGTGCAGCCATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGA CTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 62: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCACGTATTAGTCGTGATGGTACCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGACATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 63: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAAACTCTCCT GTTCAGCCTCTGGATTCACTTTTGATGATACTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTACCACATACTATACAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCAGCCATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 64: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCCGGATTCACTTTTGATGATTCTGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGA ACGAGTGCGAGTTGGTCTCATCTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCC GATTCACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGA GGACACAGCCGTGTATTACTGTGCAGCCATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGA CTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 65: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCCGGATTCACTTTTGATGATTCTGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGA ACGAGTGCGAGTTGGTCTCATCTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCC GATTCACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCCGAAACCTGA GGACACAGCCGTGTATTACTGTGCAGCCATTAATTCTGGGTACGAGTTGGGTACTTGCGAGTCGTTGGA CTACTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 66: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAAGTATCAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGGCGTGTATTACTGTGCGGCAGAGGGGCACCGTTACGAGTTGGGTACGTGTGCAGCGTTAGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 67: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATGGGCATAAGTACGAGTTGGGTACGTGCGCTGCCTTAGACTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 68: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGGGGGTCTCTGAGACTCTCCT GTGCAGCCTCTGGATTCACTTTTGGTGATTCTGGCATGGGCTGGTACCGCCAGGCTCCAGGGAATGAG TGCGAGTTGGTCTCAAGTGTGAGTAGTGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATT CACCATCTCCCAAGACAACGCCAAGAACACGGTGTATCTGCGAATGAACAGCCTGAAACCTGAGGAC ACAGCCGTGTATTACTGTGCGGCAGATGATCACAAGTACGAATTGGGTACCTGCGAGGCTCTCGACTA CTGGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 69: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATCTTGACATGCGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAATTATTAATAGTGATGGTAGAACATACTATGCAGACTCCGTGAAGGGCCGATTCG CCATCTCCCAGAACAACGCCAAAAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATCAACACCGCTACGGATTGGGTACGTGCGAGGCCTTAGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 70: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATTCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCTACTATTAGTAGTGATGGTAGAACATACTATGCAGACTCCGTGAAGGGCCGATTCG CCATCTCCCAGAACAACGCCAAAAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGCAGATCAACACCGCTACGGATTGGGTACGTGCGAGGCCTTAGACTACT GGGGCCGGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 71: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTAATGATTCTAACATGGGGTGGTACCGCCAGGCTCCAGGGCATGAGT GCGAATTGGTCTCAACTATTAGTAGCGATGGTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAAACAACGCCAGGAACACCGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACAC AGCCGTGTATTACTGTGCGGGAGACTGGGGCTACGAGTTGGGTATTTGCACCTCACTAGACTACTGGG GCCAGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 72: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATGTTGACATGGGCTGGTACCGCCAGGCTTCAGGGAATGAGT GCGAGTTGGTCTCGACTATTAGTAGTGATGGTAGTACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTATATCTGCAAATGAACAGCCTGAAACCTGAGGACAC GGCCATGTATTACTGTGCGGCAGCCCGCTATAGCGACTATGAAGGGATGTGCGGTTACTGGAGCCAGG GGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 73: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGCCTCTGGATTCACTTTTGATGATGTTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGTACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTATATCTGCAAATGAACAGCCTGAAACCTGAGGACAC GGCCATGTATTACTGTGCGGCAGCCCGCTATAGCGACTATGAAGGGATGTGCGGTTACTGGAGCCAGG GGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 74: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTACAGTCTCTGGATTCACTTTTGATGATGTTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGTACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCATCTCCCAAGACAACGCCAAGAACACGGTATATCTGCAAATGAACAGCCTGAAACCTGAGGACAC GGCCATGTATTACTGTGCGGCAGCCCGCTATAGCGACTATGAAGGGATGTGCGGTTACTGGAGCCAGG GGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 75: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGGGGGTCTCTGAGACTCTCCT GTGCAGCCTCTGGATTCACTTTTGATGATGTTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAG TGCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGTACATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCCAAGACAACGCCAAGAACACGGTATATCTGCAAATGAACAGCCTGAAACCTGAGGACA CGGCCATGTATTACTGTGCGGCAGCCCGCTATAGCGACTATGAAGGGATGTGCGGTTACTGGAGCCAG GGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 76: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGAGTCTGAGACTCTCCT GTAGAACCTCTGGATTCAGTTTTGATGATGTTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATGAG TGCGAGTTGGTCTCAACTATTAGTAGTGATGGTAGTACATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCCAAGACAACGCCAAGAACACGGTATATCTGCAAATGAACAGCCTGAAACCTGAGGACA CGGCCATGTATTACTGTGCGGCAGCCCGCTATAGCGACTATGAAGGGATGTGCGGTTACTGGAGCCAG GGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 77: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTACAGTCTCTGGATTCACTTTTGATGATGCTGACATGGGCTGGTACCGCCAGGCTCCAGGGAATCAGT GCGAGTTGGTCTCAACTATTAGTAGTGATGGTATCACATACTATGCAGACTCCGTGAAGGGCCGATTCA CCGTCTCCCAAGACAACGCCAAGAACACGGTATATCTGCAAATGAACAGCCTGAAACCTGAGGACAC GGCCATGTATTACTGTGCGGCAGCCCGCTATAGCGACTATGAAGGGATGTGCGGTTACTGGAGCCAGG GGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 78: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGGGTCTCTGAGACTCTCCT GTGCAGCCTCTGGATTTACCTACACTGGCTACTGCATGGGCTGGTTCCGCCAGGCTCCAGGGAAGGAG CGCGAGGGGGTCGCAACGGTTGATAGTGATGGTGACACAAGCTACGCAGACTCCGTGAAGGGCCGAT TCACCATCTCCAAAGACAACGCCAAGAACACTCTGTATCTGCAAATGAACAGCCTGAAACCTGAGGA CACTGCCATGTACTACTGTGCGGCAGATTTTTCGCGGTGGCACCTATGTTCAACAAGCCTAGCTACCTT GGGTTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCTCA SEQ ID NO. 79: CAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTCGGTGCAGGCTGGAGGATCTCTGAGACTCTCCT GTGCAGCCTCTGGATACACCTACACTGGCTACTGCATGGGCTGGTTCCGCCAGGCTCCAGGGAAGGAG CGCGAGGGGGTCGCAACTATTGATAGTGATGGTGACACAAGCTACGCAGACTCCGTGAAGGGCCGATT CACCATCTCCAAAGACAACGCCAAGAACACTCTGTATCTGCAAATGAACAGCCTGAAACCTGAGGAC ACTGCCATGTACTACTGTGCGGCAGACTTTCGCCGCTGGCACCTATGTAGTAGTTCGTTTCGGGAAGAC GGCATGGACTACTGGGGCAAAGGAACCCAGGTCACCGTCTCCTCA SEQ ID NO. 80: CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGAGAGACTCTGAGACTCTCCT GTGCAGCCTCTGGATACACCTACACTGGCTACTGCATGGGCTGGTTCCGCCAGGCTACAGGGAAGGAG CGCGAGGGGGTCGCAACTATTGATAGTGATGGAGACACAACCTACGCAGACTCCGTGAAGGGCCGATT CACCATCTCCAAAGACAACGGCAAGAACACTCTGTATCTGCAAATGAACAGCCTGAAACCTGAGGAC ACTGCCATGTACTACTGTGCGGCAGACTTTCGCCGCTGGCACCTATGTAGTAGCTCGTTTCAGGAGTAC GACATGGACTACTGGGGCAAAGGAACCCAGGTCACCGTCTCCTCA

Embodiment 4: Expression and Purification of Nanobodies in Host Strain Escherichia coli

(119) (1) For the clones obtained by sequencing analysis in embodiment 3 (7 nanobodies were randomly selected), the corresponding plasmids were electrotransformed into E. coli WK6 and coated on LA+glucose (i.e., containing ampicillin and glucose) culture plate. The plates were incubated overnight at 37° C.

(120) (2) Single colony was selected and inoculated in 5 mL of LB medium containing ampicillin and cultured overnight at 37° C. on shaker.

(121) (3) 1 mL overnight cultured strain was inoculated to 330 mL TB culture medium and incubated at 37° C. IPTG was added when OD value reached 0.6-1 and the culture was cultured overnight at 28° C. on shaker.

(122) (4) The culture was centrifuged and the strains were collected.

(123) (5) The crude extract of antibody was extracted by osmotic method.

(124) (6) Purified nanobody was prepared by nickel column ion affinity chromatography.

(125) The purification results were shown in FIG. 4. Through the purification process, the purity of anti-Her2 nanobody reached more than 95%.

Embodiment 5: Identification of Nanobody Affinity to Her2 of Different Species by Enzyme-Linked Immunosorbent Assay (ELISA)

(126) (1) The human and mouse HER2 antigen protein was coated and added, then incubated overnight at 4° C.

(127) (2) Next day, samples were washed with PBST for 3 times. 1% BSA was then added and blocked at room temperature for 2 hours.

(128) (3) Purified nanobody was gradiently diluted and placed at room temperature with the coated Her2 antigen for 1 hour.

(129) (4) Unbound antibodies were washed off with PBST. Mouse anti-HA antibody was then added, and samples were placed at room temperature for 1 hour.

(130) (5) Unbound antibodies were washed off with PBST. Goat anti-mouse alkaline phosphatase labeled antibodies was then added. Samples were placed at room temperature for 1 hour.

(131) (6) Unbound antibodies were washed off with PBST and alkaline phosphatase chromogenic solution was added. The absorption value was read at 405 nm wavelength via ELISA instrument, and the specificity of the nanobody was judged according to the absorption value.

(132) The detection results are shown in FIG. 5. The nanobody of the current invention only binds to human Her2.

Embodiment 6: Detection of Nanobody Binding to Cells Via Flow Cytometry

(133) (1) Cell types: BT474 and MDA-MB-231. Cells were washed twice with PBS.

(134) (2) Nanobody was diluted to 0.1 ug/ul with PBS

(135) (3) Cells were divided into 96-well plates after washing, where number of cells per sample was 3×10.sup.5. The dilute nanobodies were then added to each well, mixed and placed at 4° C. for 20 min.

(136) (4) Cells were washed twice with PBS and resuspended with 100 uL PBS. 1 mL Mouse anti-HA Alexa Fluor488 labeled antibody was then added to each sample, mixed and placed at 4° C. for 20 min.

(137) (5) Cells were washed twice with PBS and then resuspended to the flow tube with 300 uL PBS. Samples were kept on ice in dark condition. Detection was held via machine.

(138) The results show that in the cell line with high expression of Her2 (BT474), the positive rate of nanobody of the invention is >99%, and in the cell line with low expression of Her2 (MDA-MB-231), the positive rate of nanobody is 6-14%. The difference between the two is at least about 6 times. This further suggests that the nanobody of invention has very excellent specificity against Her2. The results of some nanobodies are shown in Table 4.

(139) TABLE-US-00005 TABLE 4 Antibody no. BT474 MDA-MB-231 9 99.8%  9.5% 10 99.7% 10.6% 13 99.9% 14.2% 17 99.9% 12.3% 22 99.7%  5.8% 23 99.9% 11.5% 26 99.9% 16.7%

Embodiment 7: Biacore 3K Affinity and Competitive Determination of Trastuzumab and Pertuzumab

(140) (1) Immobilization: the stationary phase antigen protein Her2 was immobilized on the surface of CM-5 sensor chip by carboxyl amino reaction.

(141) (2) Binding: The nanobody was diluted into different concentrations using HBS buffer. Binding process of nanobody with Trastuzumab or Pertuzumab monoclonal antibody or with antigen alone was observed.

(142) (3) Chip regeneration: when next antibody was determined, the chip was washed with 10 mM Glycine. Results show that the affinity of the nanobody of the invention to Her2 is above the level of nanomole concentration and does not compete with Trastuzumab or Pertuzumab to bind Her2. The data of some nanobodies is shown in Table 5.

(143) TABLE-US-00006 TABLE 5 Competition Competition with with Antibody no. K.sub.on(1/Ms) Kat.sub.off (1/s) KD (M) Trastuzumab Pertuzumab 9 1.11E+06 3.97E-03 3.60E-09 — — 10 7.06E+05 4.57E-03 6.47E-09 — — 13 1.27E+06 1.50E-03 1.18E-09 — — 17 6.31E+05 4.21E-03 6.68E-09 — — 22 9.57E+05 1.90E-03 1.98E-09 — — 23 6.82E+05 2.55E-03 3.73E-09 — — 26 8.57E+05 1.12E-03 1.31E-09 — —

Embodiment 8. Isolation, Purification and SPECT Imaging Scanning of 1-125 Labeled Nanobody

(144) (1) 150 μL of nanobody was added into 100 μL of 0.02 mol/L pH7.4 phosphate buffer solution and 50 μL of Na125I solution. The solution was mixed and 20 μL of 5 mg/mL chloramine T solution was added. The solution was incubated on a mixer for 70 s at room temperature. 200 μL sodium metabisulfite solution (5 mg/mL) was then added and incubated for 5 minutes.

(145) (2) Nanobody was isolated with PD10 column and eluted using 0.02 mol/L pH7.4 phosphate buffer solution. 10 drops were collected per tube. The radiopurity of 1-125 labeled nanobody was identified by paper chromatography.

(146) (3) Estrogen tablets were implanted subcutaneously on the right back of NOD/SCID mice the day before cell inoculation. 1×10.sup.7 Her2 high expression tumor cells (BT474) were inoculated in right mammary fat pad. The tumor was used for formal experimental study when the size grown to 150-200 mm.sup.3.

(147) (4) Tumor-bearing mice were anesthetized with isoflurane. 1125 labeled nanobody (˜50 ug, 5 MBq) was intravenously injected into the tail of the mice.

(148) (5) Scanning was performed 30 min after administration with acquisition method of static 15 min SPECT and medium resolution systemic CT.

(149) Result shows that a plurality of nanobodies of invention can effectively accumulate in the tumor model with high expression of Her2 and can be applied to the diagnosis and treatment of cancer. At the same time, non-binding antibodies can be quickly removed from the blood through the kidneys and bladder, reducing the radiation dose of the body.

(150) The 30 min SPECT scan images and biodistribution data in vivo of some nanobodies in tumor-bearing mice are shown in FIG. 6 and Table 6.

(151) TABLE-US-00007 TABLE 6 ID %/g Organ 9 10 13 17 22 23 26 Heart 6.7 ± 0.1 7.1 ± 0.9 8.3 ± 0.2 6.9 ± 0.4 5.6 ± 0.7 6.5 ± 0.4 6.2 ± 0.5 Lung 2.8 ± 0.1 3.5 ± 0.3 4.8 ± 0.8 3.1 ± 0.4 3.5 ± 0.1 4.1 ± 0.4 2.3 ± 0.3 Liver 4.0 ± 0.2 4.9 ± 0.1 4.7 ± 0.7 4.4 ± 0.5 4.9 ± 0.4 4.3 ± 0.6 3.8 ± 0.3 Kidney 26.6 ± 3.7  39.0 ± 3.2  30.4 ± 1.3  28.3 ± 2.4  35.9 ± 6.3  33.1 ± 4.5  27.8 ± 2.8  Bladder 130.6 ± 9.5  161.6 ± 21.0  90.0 ± 40.3 86.8 ± 44.3 144.4 ± 27.9  199.4 ± 46.4  191.2 ± 57.6  Muscle 1.8 ± 0.2 2.0 ± 0.3 2.0 ± 0.7 2.6 ± 0.2 3.2 ± 0.4 2.9 ± 0.1 0.8 ± 0.1 Tumor 12.8 ± 0.9  12.8 ± 2.4  10.7 ± 2.0  12.4 ± 1.5  9.7 ± 1.7 14.3 ± 2.9  9.0 ± 1.2 Tumor/Heart 1.9 ± 0.2 1.9 ± 0.6 1.3 ± 0.2 1.8 ± 0.2 1.7 ± 0.2 2.2 ± 0.3 1.4 ± 0.1 Tumor/Muscle 7.2 ± 0.3 6.4 ± 0.6 5.8 ± 1.1 4.7 ± 0.2 3.2 ± 0.7 4.8 ± 0.8 11.5 ± 2.6 

Embodiment 9. Isolation, Purification and SPECT Imaging Scanning of Tc-99m Labeled Nanobody

(152) (1) 5.5 mg of Na.sub.2CO.sub.3, 15.2 mg of potassium sodium tartrate and 20.5 mg of NaBH.sub.4 were added to 10 mL sterile bottle, respectively. CO was aerated, and 1 mL (35 mCi) Na [99mTcO4] was then added. Bottle was sealed and left to react for 30 min at 80° C.

(153) (2) 50 μL of antibody solution was added to 500 μL 99mTc (CO).sub.3(H.sub.2O).sub.3 reaction solution (6.56 mCi) to react for 90 min at 45-50° C.

(154) (3) The 99mTc labeled nanobody was isolated with PD10 column and elute with 0.02 mol/L pH7.4 phosphate buffer solution. The radiochemical purity was identified by thin layer chromatography (TLC),

(155) (4) Estrogen tablets were implanted subcutaneously on the right back of NOD/SCID mice the day before cell inoculation. 1×10.sup.7 Her2 high expression tumor cells (BT474) were inoculated in right mammary fat pad. The tumor was used for experimental study when the size grown to 150-200 mm.sup.3.

(156) (5) Tumor-bearing mice were anesthetized with isoflurane. Tc-99m labeled nanobody (-10 ug, 5 MBq) only or combined with 20× unlabeled nanobody was intravenously injected into the tail of the mice. Alternatively, 20× Trastuzumab or 20× Pertuzumab was intravenously injected into the tail for pretreatment 72 hours in advance.

(157) (6) Scanning was performed 30 min after administration with acquisition method of static 15 min SPECT and medium resolution systemic CT.

(158) Result showed that nanobody of invention could specifically accumulate in the tumor model with high HER2 expression, and did not compete with Trastuzumab or Pertuzumab. The Nanobodies of the invention could be used in Her2 targeted cancer diagnosis and curative effect evaluation as well as used for developing a new mechanism for Her2 targeted therapy.

(159) The 30 min SPECT scan pictures and biodistribution data in vivo of some nanobodies in tumor-bearing mice were shown in FIG. 7 and Table 7.

(160) TABLE-US-00008 TABLE 7 ID %/g 20x 20x 20x nanobody Trastuzumab Pertuzumab Organ Nanobody inhibition inhibition inhibition Heart  1.4 ± 0.6   1.6 ± 0.7   1.6 ± 0.2   2.2 ± 0.4  Lungs  2.6 + 0.7   3.5 ± 3.2   3.0 ± 0.4   4.8 ± 1.2  Liver  4.8 ± 0.6   4.8 ± 0.2   7.4 ± 0.3   7.9 ± 0.5  Kidney 75.2 ± 8.3   65.0 ± 9.3  95.7 ± 4.0  81.6 ± 7.2  Bladder 41.8 ± 25.2 159.1 ± 62.0 20.5 ± 10.8 26.4 ± 12.5 Muscle  0.3 ± 0.1   0.5 ± 0.0   0.4 ± 0.1   0.3 ± 0.0  Tumor  8.9 ± 0.5   2.1 ± 0.8   9.7 ± 1.8   9.4 ± 1.2  Tumor/ 11.5 ± 4.5   2.5 ± 1.0   6.5 ± 1.6   4.3 ± 1.4  Heart Tumor/ 27.0 ± 7.6   4.1 ± 1.5  21.8 ± 5.6  28.6 ± 3.6  Muscle

(161) All references mentioned in the present invention are incorporated herein by reference, as each of them is individually cited herein by reference. Further, it should be understood that, after reading the above contents, the skilled person can make various modifications or amendments to the present invention. All these equivalents also fall into the scope defined by the pending claims of the subject application.