T-CELL RECEPTOR MIMIC (TCRM) ANTIBODIES
20190092876 ยท 2019-03-28
Inventors
Cpc classification
C07K2317/32
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61K51/1045
HUMAN NECESSITIES
G01N33/57492
PHYSICS
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
A61K51/10
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention provides an antibody which binds to human p53 tumour suppressor protein residues 65-73 (human p53.sub.65-73), as shown in SEQ ID NO: 1, when presented by the MHC class I protein Human Leukocyte Antigen-A*0201 (HLA-A*0201).
Claims
1. An antibody which binds to human p53 tumour suppressor protein residues 65-73 (human p53.sub.65-73), as shown in SEQ ID NO: 1, when presented by the MHC class I protein Human Leukocyte Antigen-A*0201 (HLA-A*0201).
2. An antibody according to claim 1, which binds to human p53.sub.65-73 when presented by HLA-A*0201 with a dissociation constant (K.sub.D) of 200 M or less, preferably 150 M or less, preferably 0.005-110 M, preferably 0.01-110 M, preferably 0.8-30 M, more preferably 0.90-5.5 M; wherein said dissociation constant has been determined by quartz crystal microbalance assay.
3. An antibody according to claim 1, which exhibits greater cell surface binding to T2 lymphoblast cells presenting the sequence of human p53.sub.65-73 by HLA-A*0201, than a non-specific peptide, preferably consisting of the amino acid sequence of SEQ ID NO: 22.
4. An antibody according to claim 1, which binds to the cell surface of an HLA-A2+/p53+ cancer cell line; preferably any cell line selected from the group consisting of NCI-H2087 (lung), NCI-H1395 (lung), Hs-695T (melanoma), 143B (osteosarcoma), SW480 (colon), AU565 (breast), MDA-MB-231 (breast), MO-1043 (chronic lymphocytic leukaemia), FL-18 (follicular lymphoma), Granta-519 (mast cell leukaemia), OCI-Ly1 (diffuse large B-cell lymphoma) and OCI-Ly8 (diffuse large B-cell lymphoma).
5. An antibody according to claim 1, which, when applied in vitro to the surface of human B cell lymphoma cells at 10 g/ml and subsequently incubated at 37 C., is internalised; preferably wherein the cells are of the cell line OCI-Ly8.
6. An antibody according to claim 1, which is able to elicit antibody-dependent cellular phagocytosis, antibody-dependent cellular cytotoxicity and complement-dependent cytotoxicity immune effector mechanisms.
7. An antibody according to claim 1, comprising a CDR-L1, L2 and L3 having the amino acid sequence of SEQ ID NO: 2, 3 and 4 respectively, or a CDR-L1, L2 and L3 having variant amino acid sequence of SEQ ID NO: 2, 3 and 4 respectively with no more than 4 substitutions, insertions and/or deletions relative to said sequences; further comprising (1) a CDR-H1, H2 and H3 having the amino acid sequence of SEQ ID NO: 7, 8 and 9 respectively, or a CDR-H1, H2 and H3 having variant amino acid sequences of SEQ ID NO: 7, 8 and 9 respectively with no more than 4 substitutions, insertions and/or deletions relative to said sequences; or (2) a CDR-H1, H2 and H3 having the amino acid sequence of SEQ ID NO: 7, 11 and 9 respectively, or a CDR-H1, H2 and H3 having variant amino acid sequences of SEQ ID NO: 7, 11 and 9 respectively with no more than 4 substitutions, insertions and/or deletions relative to said sequences; or (3) a CDR-H1, H2 and H3 having the amino acid sequence of SEQ ID NO: 10, 11 and 9 respectively, or a CDR-H1, H2 and H3 having variant amino acid sequences of SEQ ID NO: 10, 11 and 9 respectively with no more than 4 substitutions, insertions and/or deletions relative to said sequences; preferably; (i) wherein the antibody of (1) comprises a light chain variable domain (V.sub.L) having the amino acid sequence of SEQ ID NO: 12 or a variant amino acid sequence of SEQ ID NO: 12 having at least 70% identity thereto, and a heavy chain variable domain (V.sub.H) having the sequence of SEQ ID NO: 17 or a variant amino acid sequence of SEQ ID NO: 17 having at least 70% identity thereto; or (ii) wherein the antibody of (1) comprises a V.sub.L having the sequence of SEQ ID NO: 13 or a variant amino acid sequence of SEQ ID NO: 13 having at least 70% identity thereto, and a V.sub.H having the sequence of SEQ ID NO: 18 or a variant amino acid sequence of SEQ ID NO: 13 having at least 70% identity thereto; or (iii) wherein the antibody of (1) comprises a V.sub.L having the sequence of SEQ ID NO: 13 or a variant amino acid sequence of SEQ ID NO: 13 having at least 70% identity thereto, and a V.sub.H having the sequence of SEQ ID NO: 19 or a variant amino acid sequence of SEQ ID NO: 19 having at least 70% identity thereto; or (iv) wherein the antibody of (2) comprises a V.sub.L having the sequence of SEQ ID NO: 13 or a variant amino acid sequence of SEQ ID NO: 13 having at least 70% identity thereto, and a V.sub.H having the sequence of SEQ ID NO: 20 or a variant amino acid sequence of SEQ ID NO: 20 having at least 70% identity thereto; or (v) wherein the antibody of (3) comprises a V.sub.L having the sequence of SEQ ID NO: 13 or a variant amino acid sequence of SEQ ID NO: 13 having at least 70% identity thereto, and a V.sub.H having the sequence of SEQ ID NO: 21 or a variant amino acid sequence of SEQ ID NO: 21 having at least 70% identity thereto.
8. A pharmaceutical composition comprising an antibody according to claim 1, or the means for its expression, and a pharmaceutically acceptable diluent, excipient and/or adjuvant; optionally together with at least one additional therapeutic agent.
9. An antibody according to claim 1, or the means for its expression, or a pharmaceutical composition according to claim 8, for use in therapy; preferably of a subject having the haplotype HLA-A*0201.
10. An antibody, means for expression, or composition for use according to claim 9, wherein said therapy is a combination therapy; preferably comprising administration of said antibody, means for expression or composition; and administration of at least one chemotherapeutic agent, at least one additional antibody, radiotherapy and/or at least one cytokine
11. An antibody, means for expression, or composition for use according to claim 9, in the therapy of a tumour/cancer; preferably selected from the group consisting of lung cancer, melanoma, osteosarcoma, colon cancer, breast cancer, chronic lymphocytic leukaemia, follicular lymphoma, mast cell leukaemia, diffuse large B-cell lymphoma, prostate cancer, pancreatic cancer, ovarian cancer and mantle cell lymphoma; more preferably selected from the group consisting of lung cancer, melanoma, osteosarcoma, colon cancer, breast cancer, chronic lymphocytic leukaemia, follicular lymphoma, mast cell leukaemia, diffuse large B-cell lymphoma, pancreatic cancer and mantle cell lymphoma.
12. An antibody or composition for use according to claim 11, as a delivery means for a drug, radioisotope, nanoparticle or further antibody to the cells of the tumour/cancer; wherein the antibody is conjugated to the drug, radioisotope, nanoparticle or further antibody respectively.
13. An antibody or composition for use according to claim 12, wherein the antibody is conjugated to a radioisotope and the subject is to undergo in vivo positron emission tomography (PET) imaging; or wherein the antibody is conjugated to an iron nanoparticle and the subject is to undergo in vivo magnetic resonance imaging (MRI); wherein said imaging is for the assessment of tumour cell and/or off-target binding of said antibody.
14. An antibody or composition for use according to claim 11, as a delivery means for an immune effector cell to the cells of the tumour/cancer, wherein the immune effector cell expresses a chimeric receptor comprising the antibody as a single chain variable fragment; preferably wherein the immune effector cell is a T cell.
15. A T cell expressing a chimeric receptor comprising, in the extracellular domain thereof, an antibody according to claim 1 as a single chain variable fragment.
16. A hybridoma comprising and/or secreting an antibody according to claim 1.
17. A cell or cell line expressing an antibody according to claim 1 in recombinant form.
18. A recombinant expression vector, capable of expressing an antibody according to claim 1.
19. Use of an antibody according to claim 1, in an in vitro method for determining the level of cellular antigen presentation of human p53.sub.65-73 by HLA-A*0201.
20. An in vitro method for determining the suitability of a subject having a tumour/cancer to undergo immunotherapy; comprising contacting one or more cells obtained from the subject with an antibody according to claim 1, and determining the presence, absence or level of binding of said antibody to the surface of said one or more cells; wherein (1) said one or more cells comprise tumour cells of the tumour/cancer; and wherein cell surface binding is a positive indication of the suitability of the subject to undergo said immunotherapy; or (2) said one or more cells comprise non-malignant cells, and wherein cell surface binding is a negative indication of the suitability of the subject to undergo said immunotherapy; wherein said immunotherapy is to be specific for human p53.sub.65-73 presented by HLA-A*0201.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
DETAILED DESCRIPTION OF THE INVENTION
[0059] The present invention provides antibodies which bind to the p53.sub.65-73 peptide derived from the tumour suppressor p53 protein, presented within the context of the human MHC haplotype HLA-A*0201 (an exemplary antibody according to the invention is herein designated T1-116C).
[0060] MF1 or BALB/c mice were immunised with human or chimeric (human/murine) tetramers containing peptides N-terminal to the common R196X and R231X mutations which causes premature termination of translation. After elimination of antibodies which cross-reacted with a tetramer containing a non-target peptide (SEQ ID NO:22), four hybridoma clones (T1-116C, T1-29D, T2-108A and T2-2A as denoted herein) were confirmed to exhibit specific recognition of their target P53 peptide, when presented on the cell surface of T2 cells in the context of HLA-A2*0201. However, only an antibody according to the invention (T1-116C) was able to immunolabel a wide range of cancer cell lines (
[0061] The present inventors investigated the ability of T1-116C to both be internalised by, and engage immune effector mechanisms against human lymphoma cells. T1-116C internalisation was detected within three hours of antibody incubation, indicating the potential for use of the antibody as a targeting moiety for antibody-drug conjugates (
[0062] Furthermore, a mlgG2A format antibody was tested for its ability to prevent the engraftment of MBA-MB-231 tumours in vivo, which significantly reduced their growth rate (p<0.0001
[0063] The term antibody refers to an immunoglobulin which specifically recognises an epitope on a target, as determined by the binding characteristics of the immunoglobulin variable domains of the heavy and light chains (V.sub.Hs and V.sub.Ls), more specifically the complementarity-determining regions (CDRs). The terms monoclonal antibody and antibody are herein used interchangeably, unless otherwise stated. Many potential antibody forms are known in the art, and are included within the above definition; these may include, but are not limited to, a plurality of intact monoclonal antibodies or polyclonal mixtures comprising intact monoclonal antibodies, antibody fragments (for example F.sub.ab, F.sub.ab.sup., F(.sub.ab).sub.2 and F.sub.v fragments, linear antibodies, single chain antibodies and multispecific antibodies comprising antibody fragments), single chain variable fragments (scF.sub.vs), multispecific antibodies, chimeric antibodies, humanised antibodies and fusion proteins comprising the domains necessary for the recognition of a given epitope on a target. Antibodies may also be conjugated to various moieties for a therapeutic effect, including but not limited to drugs (especially cytotoxic drugs) and radioisotopes. An antibody may comprise , , , and type heavy chain constant domains, wherein an antibody comprising said domains is designated the class IgG, IgD, IgA, IgM or IgE respectively. Classes may be further divided into subclasses according to variations in the sequence of the heavy chain constant domain (for example IgG1-4). Light chains are designated either K or A class, depending on the identity of the constant region.
[0064] The term variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable regions of the heavy and light chains each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions. The CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of the antibody. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability [69]; and (2) an approach based on crystallographic studies of antigen-antibody complexes [70]. In addition, combinations of these two approaches are sometimes used in the art to determine CDRs.
[0065] The term monoclonal antibodies refers to a homogenous population of antibodies (including the forms previously described, for example antibody fragments), which recognise a single epitope on a target. This is in contrast to polyclonal antibodies that typically include a mixture of different antibodies directed against different antigenic determinants. Furthermore, monoclonal antibodies includes such antibodies generated by any number of techniques including, but not limited to, hybridoma production, phage selection, recombinant expression, and transgenic animals.
[0066] The term humanised antibody refers to forms of non-human (e.g., murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences.
[0067] The term de-immunised antibody refers to antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal sequences encoding potential T-cell epitopes.
[0068] The term chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. Typically, the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and/or capability while the constant regions are homologous to the sequences in antibodies derived from another species (usually human) to avoid eliciting an immune response in that species.
[0069] According to the present invention, the target is a complex formed by non-covalent interaction between a Major Histocompatability Complex (MHC) class I protein (HLA-A*0201) and a small, linear peptide, human p53.sub.65-73 having the sequence RMPEAAPPV (SEQ ID NO: 1). As such, the antibody of the present invention interacts with a composite of specific residues from the linear peptide that is presented by the MHC class I protein, and residues of the MHC class I protein itself (notably, residues from the a helices of the .sub.1 and .sub.2 domains which create the binding site for, and flank the linear peptide when presented).
[0070] The term binds to, in the context of antibody-target interactions, refers to an interaction wherein the antibody and target associate more frequently or rapidly, or with greater duration or affinity, or with any combination of the above, than when either antibody or target is substituted for an alternative substance, for example an unrelated protein. Generally, but not necessarily, reference to binding means specific recognition. Techniques known in the art for determining the specific recognition of a target by a monoclonal antibody, or lack thereof, include but are not limited to, FACS analysis, immunocytochemical staining, immunohistochemistry, immunofluorescence, western blotting/dot blotting, ELISA, affinity chromatography. By way of example and not limitation, specific recognition, or lack thereof, may be determined by comparative analysis with a control comprising the use of an antibody which is known in the art to specifically recognise said target and/or a control comprising the absence of, or minimal, specific recognition of said target (for example wherein the control comprises the use of a non-specific antibody). Said comparative analysis may be either qualitative or quantitative.
[0071] The terms polypeptide, peptide and protein are used interchangeably herein and have their conventional meaning in the art. The terms amino acid and residue are herein used interchangeably and have their conventional meanings in the art. Specific amino acids are herein referred to by their conventional one and three letter codes. Furthermore, human p53 residues are numbered in accordance with Uniprot entry P04637 (http://www.uniprot.org). As used herein, when reference is made to the [amino acid] sequence of a peptide, protein or part thereof (for example, p53.sub.65-73), this includes, but is not limited to, the sequence of amino acids in question having been derived from a source other than said peptide, protein or part thereof. For example, the [amino acid] sequence of p53.sub.65-73 includes said sequence when generated by intracellular proteolytic processing of human p53 tumour suppressor protein. However, the term also encompasses, for example, a peptide of the same sequence which has been obtained via in vitro synthesis (which has not been derived from full-length p53). Such a peptide may be presented by HLA-A*0201 in a cell line (for example, T2 lymphoblast cells) in vitro after pulsing of the cells with the peptide (see Example).
[0072] The terms identical or percent identity, in the context of two or more polypeptides, refer to two or more sequences or sub-sequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity may be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software are known in the art that may be used to obtain alignments of amino acid or nucleotide sequences. These include, but are not limited to, BLAST and ALIGN.
[0073] The terms cancer and cancerous refer to or describe the physiological condition in mammals in which a population of cells are characterised by unregulated cell growth, proliferation and/or survival.
[0074] The terms tumour and cancer refer to any mass of tissue that results from excessive cell growth, proliferation and/or survival, and that is of a malignant nature, including pre-cancerous lesions.
[0075] The term subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, rodents, and the like, which is to be the recipient of a particular therapy. The terms subject and patient are used interchangeably herein in reference to a human subject, which is especially envisaged according to the present invention.
[0076] The phrase pharmaceutically acceptable excipient, carrier or adjuvant refers to an excipient, carrier or adjuvant that can be administered to a subject, together with at least one antibody of the present disclosure, and which does not destroy the pharmacological and/or biological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the antibody.
[0077] The phrase therapeutically effective amount refers to an amount of an agent effective to treat a disease or disorder in a subject or elicit an effect on one or more cells in vitro. In the case of a subject having a tumour/cancer, the therapeutically effective amount of the agent (e.g., an antibody) can reduce the number of cancer cells; reduce the tumour size; inhibit and/or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and/or stop tumour metastasis; inhibit and/or stop tumour growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; decrease tumourigenicity, tumourigenic frequency, or tumourigenic capacity of a tumour; reduce the number or frequency of cancer stem cells in a tumour; differentiate tumourigenic cells to a non-tumourigenic state; or a combination of such effects. To the extent the agent prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic. In the case of an effect on one or more cells in vitro, a therapeutically effective amount of agent may inhibit tumour cell growth when an immortalized cell line or a cancer cell line, or tumour cells isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, bone marrow aspirate or blood sample is/are cultured in a medium containing said agent.
[0078] The term therapy encompasses both treatment and prevention; thereby referring to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus, those in need of therapy include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented. In certain embodiments, a subject is successfully treated for a tumour/cancer according to the present invention if the subject shows one or more of the following: a reduction in the number of, or complete absence of, cancer cells; a reduction in the tumour size; inhibition of, or an absence of, cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of, or an absence of, tumour metastasis; inhibition of, or an absence of, tumour growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumourigenicity, tumourigenic frequency, or tumourigenic capacity of a tumour; reduction in the number or frequency of cancer stem cells in a tumour; differentiation of tumourigenic cells to a non-tumourigenic state; or some combination of effects.
[0079] According to a first aspect, the present invention provides an antibody which binds to human p53 tumour suppressor protein residues 65-73 (human p53.sub.65-73), as shown in SEQ ID NO: 1, when presented by the MHC class I protein Human Leukocyte Antigen-A*0201 (HLA-A*0201). As detailed above, the target will inherently further comprise residues contributed by HLA-A*0201 (notably those of the .sub.1 and .sub.2 domains thereof).
[0080] The antibody preferably exhibits greater cell surface binding to T2 lymphoblast cells (ATCC CRL-1992) presenting the sequence of human p53.sub.65-73 by HLA-A*0201, than a non-specific peptide. More preferably, said non-specific peptide consists of the amino acid sequence GILGFVFTL derived from influenza A virus (SEQ ID NO: 22). For the avoidance of doubt, T2 cells presenting either the sequence of human p53.sub.65-73 or the non-specific peptide by HLA-A*0201 are to be prepared in accordance with the methods detailed in the Example (T2 cell binding assay). Analysis of cell surface binding (or lack thereof) may be performed via fluorescence-activated cell sorting (FACS) or suitable derivative methods thereof known to the skilled person, or via immunocytochemistry or suitable derivative methods thereof known to the skilled person; preferably in accordance with the methods detailed in the Example (FACS Analysis and Immunocytochemistry).
[0081] Comparatively greater cell surface binding to T2 cells presenting the sequence of human p53.sub.65-73 by HLA-A*0201, than a non-specific peptide, may be confirmed by either method. It is especially preferred that said analysis further comprises incubation of T2 cells with a positive control antibody for HLA-A*0201, for example BB7.2 (as detailed in the Example), to confirm the presence of cell-surface HLA-A*0201.
[0082] The antibody preferably binds to the cell surface of an HLA-A2.sup.+/p53.sup.+ cancer cell line; more preferably any cell line selected from the group consisting of NCI-H2087 (lung) (ATCC CRL-5922), NCI-H1395 (lung) (ATCC CRL-5868), Hs-695T (melanoma) (ATCC HTB-137), 143B (osteosarcoma) (ATCC CRL-8303), SW480 (colon) (ATCC CCL-228), AU565 (breast) (ATCC CRL-2351), MDA-MB-231 (breast) (ATCC HTB-26), MO-1043 (chronic lymphocytic leukaemia) (see [78]), FL-18 (follicular lymphoma) (see [79]), Granta-519 (mast cell leukaemia) (DSMZ ACC 342), OCI-Ly1 (diffuse large B-cell lymphoma) (DSMZ ACC 722) and OCI-Ly8 (diffuse large B-cell lymphoma) (see [80]); even more preferably any cell line selected from the group consisting of NCI-H2087 (lung), NCI-H1395 (lung), Hs-695T (melanoma), 143B (osteosarcoma), SW480 (colon), AU565 (breast), MDA-MB-231 (breast), Granta-519 (mast cell leukaemia) and OCI-Ly1 (diffuse large B-cell lymphoma). It is most preferred that the antibody binds to all of the above cell lines from either selection (above). Binding may be confirmed via FACS or suitable derivative methods thereof known to the skilled person. For the avoidance of doubt, this is to be performed in accordance with the methods detailed in the Example (FACS analysis). It is especially preferred that binding is confirmed relative to a negative control, non-specific, antibody; for example an anti-mouse-APC antibody (as detailed in the Example), for which no cell surface binding would be observed.
[0083] The antibody preferably has a dissociation constant (K.sub.D), with respect to the sequence of human p53.sub.65-73 when presented by HLA-A*0201, of 200 M or less, preferably 150 M or less, preferably 0.005-110 M, preferably 0.01-110 M, more preferably 0.8-30 M, even more preferably 0.90-5.5 M; wherein said dissociation constant has been determined by a quartz crystal microbalance assay. For the avoidance of doubt, this is to be performed in accordance with the methods detailed in the Example (Quartz crystal Microbalance (QCM) analysis). An exemplary antibody according to the invention (T1-116C) demonstrates a K.sub.D (as defined above) of 0.977 M. A chimeric human IgG1 format T1-116C antibody demonstrates a K.sub.D of 1.25-1.76 M, while humanised variants 1-4 demonstrate K.sub.D of 3.76 M, 5.32 M, 29.30 M or 108 M, respectively.
[0084] It is preferred that the antibody, when applied in vitro to the surface of human B cell lymphoma cells at 10 g/ml and subsequently incubated at 37 C., is internalised. More preferably, the cells are of the cell line OCI-Ly8. For the avoidance of doubt, internalisation is confirmed, in accordance with the methods detailed in the Example (Antibody internalisation assay). It is especially preferred that internalisation is confirmed relative to a positive or negative control antibody for such internalisation (for example, BB7.2 (from hybridoma ATCC HB-82) or OKT3 (from hybridoma ATCC CRL-8001), respectively, as detailed in the Example); most preferably both.
[0085] Further, the antibody is able to elicit antibody-dependent cellular phagocytosis (ADCP), antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) immune effector mechanisms. Preferably, said activities are confirmed in vitro against a B-cell lymphoma cell line (more preferably OCI-Ly8) wherein antibody-induced ADCP is mediated by bone marrow-derived macrophages, ADCC is mediated by peripheral blood mononuclear cells, and CDC is mediated by serum comprising complement. For the avoidance of doubt, said activities may be confirmed in accordance with the methods detailed in the Example (Complement Dependent Cytotoxicity (CDC) Assay; Antibody Dependent Cellular Phagocytosis (ADCP) Assay; Antibody Dependent Cellular Cytotoxicity (ADCC) Assay). It is especially preferred that said activities are confirmed relative to a positive control antibody capable of eliciting said immune effector mechanisms, for example Rituximab when assaying against CD20+B cells (for example, OCI-Ly8 as detailed in the Example). ADCP by the antibody may be confirmed in accordance with the protocols described above by achieving at least 50%, preferably at least 60%, more preferably at least 70% of the % cell death achieved by Rituximab (both antibodies at 10 g/ml) (see, for example,
[0086] An antibody of the invention may preferably comprise a CDR-L1 having the amino acid sequence of SEQ ID NO: 2; a CDR-L2 having the amino acid sequence of SEQ ID NO: 3; and a CDR-L3 having the amino acid sequence of SEQ ID NO: 4. In combination with the above light chain CDR sequences, the antibody may comprise:
[0087] (1) a CDR-H1 having the amino acid sequence of SEQ ID NO: 7; a CDR-H2 having the amino acid sequence of SEQ ID NO: 8; and a CDR-H3 having the amino acid sequence of SEQ ID NO: 9; or
[0088] (2) a CDR-H1 having the amino acid sequence of SEQ ID NO: 7; a CDR-H2 having the amino acid sequence of SEQ ID NO: 11; and a CDR-H3 having the amino acid sequence of SEQ ID NO: 9; or
[0089] (3) a CDR-H1 having the amino acid sequence of SEQ ID NO: 10; a CDR-H2 having the amino acid sequence of SEQ ID NO: 11; and a CDR-H3 having the amino acid sequence of SEQ ID NO: 9.
[0090] Combination (1) is characteristic of T1-116C wild type antibody, T1-116C humanised and deimmunised variant 1 and T1-116C humanised and deimmunised variant 2, combination (2) is characteristic of T1-116C humanised and deimmunised variant 3, and combination (3) is characteristic of humanised and deimmunised variant 4.
[0091] In alternative embodiments, the antibody may comprise variants of any of the above CDR L1-L3 and CDR H1-H3 combinations with (in increasing preference) no more than 4, 3, 2, or 1 substitutions, deletions and/or insertions (the total number of substitutions, deletions and insertions not exceeding 4, 3, 2 or 1); more preferably no more than 4, 3, 2, or 1 substitutions as the only variation; as compared to SEQ ID NO: 2, 3, 4, 7, 8, 10 and 11 where appropriate.
[0092] Preferably: [0093] (i) the antibody of (1) comprises a light chain variable domain (V.sub.L) having the sequence of SEQ ID NO: 12 and a heavy chain variable domain (V.sub.H) having the sequence of SEQ ID NO: 17; or [0094] (ii) the antibody of (1) comprises a V.sub.L having the sequence of SEQ ID NO: 13 and a V.sub.H having the sequence of SEQ ID NO: 18; or [0095] (iii) the antibody of (1) comprises a V.sub.L having the sequence of SEQ ID NO: 13 and a V.sub.H having the sequence of SEQ ID NO: 19; or [0096] (iv) the antibody of (2) comprises a V.sub.L having the sequence of SEQ ID NO: 13 and a V.sub.H having the sequence of SEQ ID NO: 20; or [0097] (v) the antibody of (3) comprises a V.sub.L having the sequence of SEQ ID NO: 13 and a V.sub.H having the sequence of SEQ ID NO: 21.
[0098] Combination (i) is characteristic of T1-116C wild type antibody, combination (ii) is characteristic of T1-116C humanised and deimmunised variant 1, combination (iii) is characteristic of T1-116C humanised and deimmunised variant 2, combination (iv) is characteristic of T1-116C humanised and deimmunised variant 3 and combination (v) is characteristic of T1-116C humanised and deimmunised variant 4.
[0099] In alternative embodiments, the antibody may comprise variants of any of the above V.sub.L and V.sub.H combinations with (in increasing preference) at least 70%, at least 80%, at least 90%, or at least 95% sequence identity to SEQ ID NO: 12, 13, 17, 18, 19, 20 and 21 where appropriate. The percentage sequence identity may be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software are known in the art that may be used to obtain alignments of amino acid sequences. These include, but are not limited to, BLAST and ALIGN.
[0100] The present invention further provides pharmaceutical compositions comprising one or more of the antibodies described herein. In certain embodiments, the pharmaceutical compositions further comprise a pharmaceutically acceptable vehicle or diluent, examples of which are known in the art. These pharmaceutical compositions find use in inhibiting tumour growth and treating cancer in a subject (e.g., a human patient).
[0101] In certain embodiments, compositions are prepared for storage and use by combining a purified antibody described herein with a pharmaceutically acceptable vehicle (e.g., a carrier or excipient). Suitable pharmaceutically acceptable vehicles include, but are not limited to, nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives such as octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens, such as methyl or propylparaben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol; low molecular weight polypeptides (e.g., less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; carbohydrates such as monosaccharides, disaccharides, glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes such as Zn-protein complexes; and non-ionic surfactants such as TWEEN or polyethylene glycol (PEG).
[0102] The pharmaceutical compositions can be administered in any conventional way. Administration can be by parenteral administration, more particularly by intravenous administration. However, other routes of administration are also envisaged. In certain embodiments, in addition to comprising an antibody as described herein, the pharmaceutical compositions of the present invention further comprise at least one additional therapeutic agent. In certain embodiments, the at least one additional therapeutic agent comprises 1, 2, 3, or more additional therapeutic agents.
[0103] The present invention also provides an antibody as described herein, or the means for its expression, or a pharmaceutical composition according as defined herein, for use in therapy. Said therapy is most preferably of a human subject having the haplotype HLA-A*0201, as determined by standard methods of genetic testing, available to the skilled person. An antibody of the invention may also be administered to a subject via gene therapy techniques (as an example of means for its expression), whereby subject patient is administered a polynucleotide that encodes the antibody. For example, a gene therapy vector, comprising a polynucleotide that encodes the antibody, may be administered, such that the antibody is expressed in vivo. Gene therapy techniques may also be used to introduce the polynucleotide encoding the antibody into T cells, ex vivo, which are then administered to a patient as an adoptive cell therapy. The delivery of an antibody by such suitable techniques will be apparent to the skilled person [71], [72].
[0104] The therapy is preferably that of a subject having a tumour/cancer. More preferably, the tumour/cancer is selected from the group consisting of lung cancer, melanoma, osteosarcoma, colon cancer, breast cancer, chronic lymphocytic leukaemia, follicular lymphoma, mast cell leukaemia, diffuse large B-cell lymphoma, prostate cancer, pancreatic cancer, ovarian cancer and mantle cell lymphoma. The above tumour cell types are known in the art to exhibit p53 overexpression, increased p53 peptide presentation and/or altered activity through mutation or other p53 pathway alterations, as compared to non-malignant cells of same tissue type;
[0105] in addition, immunolabelling of cell lines from a number of the above tumour types has been confirmed experimentally with an antibody according to the invention (T1-116Csee Example; Table 3;
[0106] In some embodiments, 1, 2, 3, or more additional therapeutic agents may be administered. Combination therapy with at least two therapeutic agents often involves agents that work by different mechanisms of action, although this is not required. Combination therapy using agents with different mechanisms of action may result in additive or synergistic effects. Combination therapy may allow for a lower dose of each agent than is used in monotherapy, thereby reducing toxic side effects. Combination therapy may decrease the likelihood that resistant cancer cells will develop. Combination therapy may allow for one therapeutic agent to be targeted to tumourigenic cancer stem cells, while a second therapeutic agent may be targeted to non-tumourigenic cancer cells.
[0107] An additional therapeutic agent may be administered in any order or concurrently with the antibody as described herein. In some embodiments, the antibody will be administered to patients that have previously undergone treatment with a second therapeutic agent. In certain other embodiments, the antibody and a second therapeutic agent will be administered substantially simultaneously or concurrently. For example, a subject may be given the antibody while undergoing a course of treatment with a second therapeutic agent (e.g., chemotherapy). In certain embodiments, the antibody will be administered within 1 year of the treatment with a second therapeutic agent. In certain alternative embodiments, the antibody will be administered within 10, 8, 6, 4, or 2 months of any treatment with a second therapeutic agent. In certain other embodiments, the antibody will be administered within 4, 3, 2, or 1 weeks of any treatment with a second therapeutic agent. In some embodiments antibody will be administered within 5, 4, 3, 2, or 1 days of any treatment with a second therapeutic agent. It will further be appreciated that the two (or more) agents or treatments may be administered to the subject within a matter of hours or minutes (i.e., substantially simultaneously).
[0108] Useful classes of therapeutic agents include, for example, antitubulin agents, auristatins, DNA minor groove binders, DNA replication inhibitors, alkylating agents (e.g., platinum complexes such as cisplatin, mono(platinum), bis(platinum) and tri-nuclear platinum complexes and carboplatin), anthracyclines, antibiotics, antifolates, antimetabolites, chemotherapy sensitizers, duocarmycins, etoposides, fluorinated pyrimidines, ionophores, lexitropsins, nitrosoureas, platinols, purine antimetabolites, puromycins, radiation sensitizers, steroids, taxanes, topoisomerase inhibitors, vinca alkaloids, or the like. In certain embodiments, the second therapeutic agent is an antimetabolite, an antimitotic, a topoisomerase inhibitor, or an angiogenesis inhibitor.
[0109] Therapeutic agents that may be administered in combination with the antibody as described herein include chemotherapeutic agents. Thus, in some embodiments, the therapy involves the combined administration of the antibody and a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents. Treatment with the antibody can occur prior to, concurrently with, or subsequent to administration of chemotherapies. Combined administration can include co-administration, either in a single pharmaceutical formulation or using separate formulations, or consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously.
[0110] Chemotherapeutic agents useful in the instant invention include, but are not limited to, alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamime; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytosine arabinoside, dideoxyuridine, doxifluridine, enocitabine, floxuridine, 5-FU; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenishers such as folinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK; razoxane; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; urethane; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); taxoids, e.g. paclitaxel (TAXOL) and docetaxel (TAXOTERE); chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT11, topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Chemotherapeutic agents also include anti-hormonal agents that act to regulate or inhibit hormone action on tumours such as antiestrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY1170 18, onapristone, and toremifene (Fareston); and antiandrogens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[0111] The chemotherapeutic agent may be a topoisomerase inhibitor. Topoisomerase inhibitors are chemotherapy agents that interfere with the action of a topoisomerase enzyme (e.g., topoisomerase I or II). Topoisomerase inhibitors include, but are not limited to, doxorubicin HCl, daunorubicin citrate, mitoxantrone HCl, actinomycin D, etoposide, topotecan HCl, teniposide (VM-26), and irinotecan, as well as pharmaceutically acceptable salts, acids, or derivatives of any of these. In certain embodiments, the second therapeutic agent is irinotecan.
[0112] The chemotherapeutic agent may also be an anti-metabolite. An anti-metabolite is a chemical with a structure that is similar to a metabolite required for normal biochemical reactions, yet different enough to interfere with one or more normal functions of cells, such as cell division. Antimetabolites include, but are not limited to, gemcitabine, fluorouracil, capecitabine, methotrexate sodium, ralitrexed, pemetrexed, tegafur, cytosine arabinoside, thioguanine, 5-azacytidine, 6-mercaptopurine, azathioprine, 6-thioguanine, pentostatin, fludarabine phosphate, and cladribine, as well as pharmaceutically acceptable salts, acids, or derivatives of any of these. In certain embodiments, the second therapeutic agent is gemcitabine.
[0113] The chemotherapeutic agent may also be an antimitotic agent, including, but not limited to, agents that bind tubulin. In some embodiments, the agent is a taxane. In certain embodiments, the agent is paclitaxel or docetaxel, or a pharmaceutically acceptable salt, acid, or derivative of paclitaxel or docetaxel. In certain embodiments, the agent is paclitaxel (TAXOL), docetaxel (TAXOTERE), albumin-bound paclitaxel (ABRAXANE), DHA-paclitaxel, or PG-paclitaxel. In certain alternative embodiments, the antimitotic agent comprises a vinca alkaloid, such as vincristine, binblastine, vinorelbine, or vindesine, or pharmaceutically acceptable salts, acids, or derivatives thereof. In some embodiments, the antimitotic agent is an inhibitor of kinesin Eg5 or an inhibitor of a mitotic kinase such as Aurora A or PlkI. In certain embodiments, where the chemotherapeutic agent administered in combination with the antibody is an anti-mitotic agent, the cancer or tumour being treated is breast cancer or a breast tumour.
[0114] Combination therapy is also envisaged, and may involve the combined administration of the antibody as described herein and radiotherapy. Administration of the antibody as described herein can occur prior to, concurrently with, or subsequent to administration of radiotherapy by the skilled medical practitioner.
[0115] It is also envisaged that a second therapeutic agent may comprise a further antibody. Thus, treatment can involve the combined administration an antibody of the present invention with other antibodies against additional tumour-associated antigens including, but not limited to, antibodies that bind to EGFR, ErbB2, HER2, DLL4, Notch, PD-1, PD-1L, CTLA-4 and/or VEGF. In certain embodiments, a second therapeutic agent is an antibody that is an angiogenesis inhibitor (e.g., an anti-VEGF antibody). In certain embodiments, a second therapeutic agent is bevacizumab (AVASTIN), trastuzumab (HERCEPTIN), panitumumab (VECTIBIX), or cetuximab (ERBITUX). In certain embodiments a second therapeutic agent is an antibody that inhibits an immune checkpoint receptor ligand interaction (e.g. PD-1, PD-1L, CTLA-4 and others) ipilimumab (YERVOY), pembrolizumab (KEYTRUDA), nivolumab (OPDIVO). Combined administration can include co-administration, either in a single pharmaceutical formulation or using separate formulations, or consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously.
[0116] Combination therapy with the antibodies described herein can include treatment with one or more cytokines (e.g., lymphokines, interleukins, tumour necrosis factors, and/or growth factors)
[0117] Therapy with the antibodies described herein can be accompanied by surgical removal of tumours, cancer cells or any other therapy deemed necessary by a treating physician.
[0118] The antibody described herein may also be delivered in conjunction with an oncolytic virus in the therapy of a tumour/cancer. This may improve the bystander killing effect of such therapy.
[0119] The antibody described herein may be used as a delivery means for a drug (preferably, a cytotoxic drug), radioisotope, nanoparticle or further antibody to the cells of the tumour/cancer as described above; by way of standard conjugation and/or labelling methods available in the art to the skilled person. By delivery means, it is meant that the antibody (according to the invention) acts as a targeting moiety to localise the above agents to the cells of the tumour/cancer, through specific recognition of p53.sub.65-73 in the context of HLA-A*0201. Wherein the antibody according to the invention is conjugated to a further antibody (as a bispecific antibody construct), preferred further antibodies include, but are not limited to, anti-CD3 antibodies (for example as found in BITE bispecific T cell engagersavailable from Amgen Oncology); checkpoint inhibitors (including inter alia anti-PD-1, PD-1L and CTLA-4 antibodies, for example ipilimumab (YERVOY), pembrolizumab (KEYTRUDA), nivolumab (OPDIVO)); and angiogenesis inhibitors (for example, anti-VEGF antibodies). In such bi-specific antibody constructs, both antibodies are both typically, but not necessarily, in the form of single chain variable fragments. Wherein the antibody is conjugated to a radiolabel, positron emission tomography (PET) may be used to determine tumour or off-target binding. Furthermore, when the antibody is conjugated to a nanoparticle, preferably iron nanoparticle, magnetic resonance imaging (MRI) may be used to a similar effect. It is envisaged that an initial sub-therapeutic dose to the subject may be used to set dosing thresholds and indicate their response, prior to the administration of the therapeutically-effective dose.
[0120] The antibody described herein may also be used as a delivery means for an immune effector cell to the cells of the tumour/cancer, wherein the immune effector cell expresses a chimeric receptor comprising the antibody as a single chain variable fragment. The antibody will be found in the extracellular domain of the receptor, allowing specific recognition of p53.sub.65-73 in the context of HLA-A*0201. Preferably, the immune effector cell is a T cell. Preferably, the receptor comprises the antibody as described above, linked to one or more intracellular co-stimulatory signalling domains (typically either 1, 2 or 3 domains), such as the Fc receptor chain, to activate the immune effector, preferably T cell. Chimeric antigen receptor T cells (CAR T-cells) are known in the art [73-75], and may be produced by standard methods known to the skilled person. Such methods typically comprise the introduction to the cell of a chimeric gene incorporating the antibody as a single chain variable fragment, linked to the one or more signalling domains.
[0121] The present invention furthermore provides a method of treating or preventing a tumour/cancer in a subject in need of such treatment or prevention, by administering a therapeutically-effective amount of an antibody as defined herein to the subject. Said method has the same optional and preferred features as described above.
[0122] The present invention also provides a hybridoma comprising and/or secreting an antibody according as described herein. Said hybridoma may be obtained by standard fusion protocols [67] after murine immunisation according to the methods of the Example (Cell culture; Generation of HLA-A2/p53 tetramer and chimeric tetramer; Generation of anti-p53 TCR monoclonal antibodies).
[0123] The present invention also provides a cell or cell line expressing an antibody as described herein in recombinant form. Suitable host cells for expression of a recombinant antibody as described herein include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters. Prokaryotes include gram-negative or gram-positive organisms, for example, E. coli or Bacilli. Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems can also be employed. Various mammalian or insect cell culture systems are used to express the recombinant antibody. Expression of in mammalian cells may be preferred because such proteins are generally correctly folded, appropriately modified and completely functional. Examples of suitable mammalian host cell lines include COS-7 (monkey kidney-derived), L-929 (murine fibroblast-derived), C127 (murine mammary tumour-derived), 3T3 (murine fibroblast-derived), CHO (Chinese hamster ovary derived), HeLa (human cervical cancer-derived) and BHK (hamster kidney fibroblast-derived) cell lines.
[0124] The present invention also provides an expression vector, capable of expressing an antibody as described herein. Mammalian expression vectors can comprise non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5 or 3 flanking non-transcribed sequences, and 5 or 3 non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences. Baculovirus systems for production of heterologous proteins in insect cells are known to those of skill in the art.
[0125] The present invention also provides the use of an antibody as defined herein in an in vitro method for determining the level of cellular antigen presentation of human p53.sub.65-73 by HLA-A*0201. It has been realised by the present inventors that an antibody as defined herein may furthermore be useful as an analytical tool, for assessing in vitro the level of antigen presentation by a variety of cell types. The presence, absence or level of human p53.sub.65-73 presentation by HLA-A*0201 may be determined by contacting one or more cells with a purified antibody as defined herein, and determining cell surface binding using standard analytical means known to the skilled person. For example, binding may be assessed qualitatively, semi-quantitatively or quantitatively; preferred techniques include fluorescenceactivated cell sorting (FACS), immunohistochemistry, immunofluorescence and cell-based enzyme-linked immunosorbant assay (ELISA). Appropriate negative and positive controls will be apparent to the skilled person, depending on the technique used and cell type to be analysed. As an example only, to improve confidence an antibody specific for HLA-A2*0201 may be used (for example mAb BB7.2see Example;
[0126] The present invention also provides an in vitro method for determining the suitability of a subject (preferably having the haplotype HLA-A*0201) having a tumour/cancer to undergo immunotherapy; comprising contacting one or more cells obtained from the subject with an antibody as defined herein, and determining the presence, absence or level of binding of said antibody to the surface of said one or more cells; wherein
(1) said one or more cells comprise tumour cells of the tumour/cancer; and wherein cell surface binding is a positive indication of the suitability of the subject to undergo said immunotherapy; or
(2) said one or more cells comprise non-malignant cells, and wherein cell surface binding is a negative indication of the suitability of the subject to undergo said immunotherapy;
wherein said immunotherapy is to be specific for human p53.sub.65-73 presented by HLA-A*0201.
[0127] The presence, absence or level of binding of said antibody to the surface of said one or more cells may be determined using standard analytical means known to the skilled person. For example, binding may be assessed qualitatively, semi-quantitatively or quantitatively; preferred techniques include fluorescenceactivated cell sorting (FACS), immunohistochemistry, immunofluorescence, cell-based enzyme-linked immunosorbant assay (ELISA). Positive and negative controls for cell surface binding will be apparent to the skilled person; for example, strongly positive p53+/HLA-A2+ cell lines, and negative cell lines or tumour cells of a patient subgroup with low endogenous tumour cell p53.sub.65-73 presentation by HLA-A2*0201, respectively. A clinically relevant cut-off for therapy may be determined by the skilled person by a variety of means; following methods available in the art. Positive and negative controls may be used to set upper and lower thresholds respectively, and the distribution of patient data viewed relative to said thresholds. By way of example, clinical response may be correlated to mean fluorescence intensity when using FACS, number of bound antibodies per cell when using FACS in combination with PE-conjugated antibody and QuantiBRITE PE beads (see Example; Quantitation of antibody molecules bound per target cell), or staining signal or frequency of positivity when using immunohistochemistry.
[0128] According to this aspect of the invention, if (1) applies, the subject preferably has a tumour/cancer selected from the group consisting of lung cancer, melanoma, osteosarcoma, colon cancer, breast cancer, chronic lymphocytic leukaemia, follicular lymphoma, mast cell leukaemia, diffuse large B-cell lymphoma, prostate cancer, pancreatic cancer, ovarian cancer and mantle cell lymphoma; more preferably said group consists of lung cancer, melanoma, osteosarcoma, colon cancer, breast cancer, chronic lymphocytic leukaemia, follicular lymphoma, mast cell leukaemia, diffuse large B-cell lymphoma, pancreatic cancer, and mantle cell lymphoma. Binding of an antibody as defined herein to said tumour cell types is indicative of a positive clinical response to immunotherapy as defined above.
[0129] If (2) applies, said one or more cells preferably comprise peripheral blood mononuclear cells. Binding of an antibody as defined herein to such non-malignant cells is indicative of off-target reactivity during immunotherapy (specific to the subject). Therefore, immunotherapy as defined above would be disfavoured in the subject.
[0130] The immunotherapy is preferably selected from vaccination, administration of an antibody or pharmaceutical composition as defined herein, and TCR-based immunotherapy.
[0131] It is to be noted that the diagnostic test defined herein may be used by the skilled person in conjunction with the PET and MRI in vivo use embodiments (as defined above), to improve response and/or safety predictions concerning the subject intended to undergo said immunotherapy.
[0132] Cell line deposits prefixed by ATCC refer to deposits made at American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, Va. 20110-2209; cell line deposits prefixed by DSMZ refer to deposits made at Leibniz-lnstitut DSMZDeutsche Sammlung von Mikroorganismen and Zellkulturen GmbH, Inhoffenstr. 7B 38124 Braunschweig. The prefix PMID refers to a PubMed manuscript ID (http://www.ncbi.nlm.nih.gov/pubmed, as accessed 28 August 2015).
[0133] The invention is now illustrated by reference to the following non-limiting Example.
Example
[0134] The present inventors used human tetramers composed of the human MHC class I protein HLA-A*0201, 2-microglobulin (2m) and an immunogenic peptide derived from the human tumour suppressor protein p53 as an immunogen with which to generate monoclonal antibodies. As a large number of antibodies recognised human components of the tetramer that did not comprise the desired epitope (e.g. the undesirable human 3 domain and 2m) chimeric tetramers were also engineered to replace these domains with the murine BALB/c counterparts to reduce undesirable immunogenicity (
[0135] The human p53 peptides selected were those with proven endogenous presentation[54-56], that had been tested in clinical trials of p53 vaccines.[28] Wild type human p53 peptides, located N-terminal to the most common mutations leading to premature termination of translation (R196X and R213X), were chosen to advantageously enable therapeutic targeting of the widest range of HLA-A2.sup.+ patients with p53 epitope presentation on their tumours (Table 1).
TABLE-US-00001 TABLE 1 Wild type p53 peptides selected for TCRm antibody production Peptide Peptide1 Peptide 2 amino acid coordinates 65-73 187-197 human sequence RMPEAAPPV GLAPPQHLIRV mouse sequence RVSGAPAAQ GLAPPQHLIRV human/mouse homology 22% 100%
[0136] Monoclonal antibodies were generated against human or chimeric (human/murine) tetramers containing either the wild type p53.sub.65-73 or p53.sub.187-197 peptide by immunising MF1 or BALB/c mice (T1-116C was generated from MF1 mice). Splenic B cells taken from the immunised mice were then fused with a myeloma cell line (NS0) to create immortalised antibody secreting hybridomas. Hybridoma supernatants from individual hybridoma colonies were tested, by ELISA assay, for recognition of a human tetramer presenting the immunising peptide, irrespective of whether the immunogen was a human or chimeric tetramer (
[0137] The p53 TCRm antibodies were tested for their ability to recognise their target peptide presented on the cell surface of T2 cells in the context of HLA-A2. T2 is a hybrid cell line that is only able to naturally express low amounts of the HLA-A2 protein on the cell surface, because of its deficiency in the transporter associated with antigen processing (TAP).[57] This deficiency in peptide transport can be overcome by pulsing the T2 cells with MHC class I binding peptides that then stabilise the HLA-A2/peptide complex on the cell surface. T2 cells were pulsed with either the target p53 peptide or the control flu-derived peptide. By virtue of exhibiting positive binding for T2 cells pulsed with their p53 target peptide and not binding T2 cells pulsed with an irrelevant control flu peptide, five antibodies were considered to exhibit specificity for recognising T2 cells presenting p53 epitopes (
TABLE-US-00002 TABLE 2 TCRm antibodies preferentially recognising p53 peptide containing tetramers in a T2 assay. Hybridoma P53 peptide Tetramer Isotype T2 specificity T1-116C P53.sub.65-73 human IgG1 specific T1-84C P53.sub.65-73 chimeric IgG2b specific T1-29D P53.sub.65-73 chimeric IgG1 specific T2-2A P53.sub.187-197 chimeric IgG2a specific T2-116A P53.sub.187-197 chimeric IgG1 specific T2-108A P53.sub.187-197 human IgG1 NS NS indicates insufficient specificity.
[0138] T2 cells were pulsed with decreasing concentrations of peptide to compare the relative abilities of the four specific TCRm antibodies (for which we had purified antibody) to detect their target peptide. Staining with BB7.2 (anti-HLA-A2) was performed to determine the levels of MHC class I presentation. HLA-A2 levels at the cell surface decreased at lower peptide concentrations, which were thus insufficient to maximise MHC class I presentation. All four antibodies effectively labelled T2 cells pulsed with 50 M-200 M of their target peptide and started to exhibit reduced binding at 5 M peptide (
[0139] The ability of the p53 TCRm antibodies to detect the endogenously presented p53 peptide on cancer cell lines was investigated by flow cytometry. The HLA-A2 status of each cell line was determined by flow cytometry using antibody BB7.2 (data not shown) and their p53 status was determined by RT-qPCR to detect transcript expression and Western blotting using three commercial anti-p53 antibodies against the p53 N-terminus (
[0140] Only the antibody of the present invention, T1-116C, was able to widely label (n=15/38, 39.5%) the surface of a range of cancer cell lines derived from different tumour types (
[0141] A minority of cancer cell lines were also labelled by T2-108A or T2-116A. T2-108A exhibited weak labelling of NCI-H1395 and MO-1043, T2-116A weakly labelled NCI-H1395 and SW480 (
TABLE-US-00003 TABLE 3 T1-116C immunoreactivity with cancer cell lines, their HLA-A2 status, TP53 mutation status and p53 protein expression. HLA-A2 p53 Cell line Tumour status p53 MUT protein T1-116C NCI-H2087 Lung + V157F ++ + NCI-H1395 Lung + WT +/ +++ CALU6 Lung R196stop COR-L23 Lung WT NCI-H1299 Lung WT/NULL NCI-H1975 Lung R273H +++ NCI-H1930 Lung + G245R ++ A2058 Melanoma V274F +/ G361 Melanoma +/ HS-695T Melanoma + +/ ++ 143B Osteosarcoma + R156P +++ + SW480 Colon + P309S +++ ++ R273H Colo-205 Colon + G266E ++ + Y103_L111 > L Colo-678 Colon + WT ++ + AU565 Breast + R175H + + MDA-MB-231 Breast + R280K +++ ++ MDA-MB-453 Breast + WT/MUT +/ MDA-MB-468 Breast R273H +++ MCF-7 Breast + WT +/ T47D Breast L194F ++ PANC-1 Pancreas + V272A ++ + R273H MO-1043 CLL + +/ ++ FL-18 FL + +++ + Granta-519 MCL + WT +++ +++ OCI-Ly1 DLBCL + +++ ++ OCI-Ly8 DLBCL + +++ +++ SUDHL6 DLBCL + ++ OCI-Ly3 DLBCL WT +/ KMH2 cHL + WT +/ THIEL Myeloma + Daudi BL G266Q + R213stop CCRF-CEM T-ALL R175H +++ R248Q MOLT-4 T-ALL R248Q +/ R306stop Jurkat T-ALL R196stop T256A D259G S260A RPMI 8402 T-ALL R273C ++ HUT78 CTCL R196stop + KARPAS-299 ALCL R273C ++ SUDHL-1 ALCL + ++ HL60 APL NULL +
[0142] The intensity of immunolabelling is indicated as very weak (+/), weak (+), moderate (++) or strong (+++). Chronic lymphocytic leukaemia (CLL), follicular lymphoma (FL), mantle cell lymphoma (MCL), diffuse large B-cell lymphoma (DLBCL), classical Hodgkin lymphoma (cHL), Burkitt lymphoma (BL), T-cell acute lymphoblastic leukaemia (T-ALL), cutaneous T-cell lymphoma (CTCL), ALK.sup.+ anaplastic large cell lymphoma (ALCL), acute promyelocytic leukaemia (APL). NT are samples where p53 protein status has not yet been tested. Mutations in p53 (MUT) are indicated with the original amino acid, codon position, and alteration; data were retrieved from the IARC TP53 database (http://p53.iarc.fr/CellLines.aspx). WT refers to wild type TP53, WT/NULL and WT/MUT indicates either null or mutated TP53 reported as well as wild type in IARC TP53 database.
[0143] The expression of p53 in normal tissues has been linked to their radiation-sensitivity, with hematopoietic tissues being among the normal adult tissues exhibiting the highest levels of p53 protein expression.[58, 59] Normal circulating peripheral blood mononuclear cells (PBMCs) have been demonstrated to express the p53 protein, and levels can be increased even further by exposure to gamma irradiation.[60] Flow cytometry analysis was performed to investigate whether normal PMBCs presented sufficient copies of the wild type p53.sub.65-73 peptide to enable binding of the T1-116C antibody. 13/14 (92.9%) PBMC preparations from HLA-A2.sup.+ donors were negative for T1-116C staining when tested with the hybridoma supernatant (
[0144] The ability of the T1-116C to stain tumour cell lines by immunocytochemistry (ICC) was investigated, as this experimental technique is particularly amenable to routine clinical screening of antibody reactivity with normal and malignant solid human tissues. The T1-116C antibody was able to recognise its epitope on acetone-fixed T2 cells pulsed with the target p53.sub.65-73 peptide. T1-116C staining was not observed when T2 cells were pulsed with the irrelevant flu-derived peptide indicating that ICC specifically demonstrated recognition of the presented p53 peptide (
[0145] Future studies will address whether ICC replicates the pattern of T1-116C staining detected by flow cytometry and whether it is sufficiently sensitive to detect cell lines that only exhibit weak positivity by flow cytometry. Preliminary data from ICC on NCI-H2087 lung cancer cells (which are only weakly T1-116C labelled by flow cytometry) suggests it is possible to detect T1-116C binding, although only in a minority of cells (
[0146] An in silico approach to predicting potential TCR cross reactivity was developed following the death of the first two patients treated with affinity-enhanced MAGE-A3 TCR targeted T cells that recognised the EVDPIGHLY peptide in the context of HLA-A*01.[61, 62] Despite a lack of MAGE-A3 expression in the heart, autopsy findings reported severe myocardial damage in both patients. An amino acid scanning approach enabled identification of a TCR binding peptide from the striated muscle-specific protein Titin (ESDPIVAQY) as the cross-reactivity responsible for the previously unpredicted cardiovascular toxicity.[61, 62] Importantly the use of a murine model system would not have predicted this toxicity as the murine Titin peptide was not recognised by the MAGE-A3 TCR.[61] Thus highlighting the importance of additional strategies for predicting off-target toxicity.
[0147] The approach of alanine and glycine replacement of individual amino acids in the target peptide was adopted for identifying the residues in the p53.sub.65-73 peptide that were important for T1-116C antibody recognition. T2 cells pulsed with the wild type or mutated peptides were tested (n=3) for the ability of the peptides to bind HLA-A2 (BB7.2 staining) and for binding of T1-116C (
[0148] The ability of each human peptide to bind HLA-A*0201 was then predicted in silico using the BIMAS http://www-bimas.cit.nih.gov/molbio/hla_bind/) and SYFPETHI (http://www.syfpeithi.de) algorithms (Table 4). The three non-target (non-p53) peptides with high HLA-A*0201 binding score predictions from both algorithms, and p53, are SHANK1, LHX6 and UBR3.
[0149] All of the potentially cross-reactive peptides were synthesised and analysed (n=3) for HLA-A2 (BB7.2 antibody) and T1-116C binding in T2 assays (
TABLE-US-00004 TABLE4 Humanproteinscontainingpeptidesderivedfrom alanineandglycinereplacementofindividual aminoacidscontainingtheT1-116Cconsensusof RXPXXAPXV,theirinsilicopredictedHLA-A*0201 bindingscoresandexperimentallydetermined HLA-A2binding(BB7.2staining)andT1-116C binding. T1- Protein Peptide BIMAS SYFPETHI BB7.2 116C P53 RMPEAAPPV 205.951 21 +++ +++ ASPC1 RAPAAAPFV 5.313 15 +/ ODFP2 RAPCGAPSV 0.966 19 + +/ TSTD1 RAPSSAPTV 0.966 17 +/ 3BHS2 RDPKKAPSV 0.097 14 +/ OPA3 RDPPPAPPV 0.097 14 + ATG2A RDPSQAPPV 0.097 11 +/ NPA1P RDPVLAPAV 0.097 13 +/ RRBP1 REPVRAPAV 1.352 12 +/ MEPCE RGPIAAPQV 0.454 11 +/ SHANK1 RLPPTAPGV 69.552 24 +++ +++ LHX6 RLPYTAPPV 69.552 20 +++ + RGS11 RPPPGAPDV 0.454 15 +/ UBP49 RQPAMAPGV 7.052 12 + +/ PANX2 RSPPAAPAV 0.454 14 +++ + ASIP RTPLSAPCV 0.966 15 + UBR3 RVPETAPEV 24.952 19 +++ +++ AP3B1 RVPKIAPDV 6.086 15 ++ + BSN RVPMIAPRV 6.086 15 +++ +++ CSPG2 RYPIRAPRV 0.01 11 +
[0150] The intensity of antibody staining is indicated as negative () 0-10% observed with the p53 peptide, very weak (+1-) >10%-<25% observed with the p53 peptide, weak (+) >25-<50% observed with the p53 peptide, moderate (++) >50-<75% observed with the p53 peptide or strong (+++) >75% observed with the p53 peptide. The strongest staining observed in any one of the three replicate experiments is indicated. Bold font indicates those peptides with the most effective T1-116C binding (>50% binding of that to p53).
[0151] In silico sequence analysis to predict potential epitope cross reactivity has identified several proteins (most notably SHANK1, UBR3, and BSN) with the potential to generate HLA-A2-bound peptides that could effectively bind the T1-116C antibody and thus give rise to off-target reactivity, weak binding was also observed to LHX6, PANX2 and AP3B1. Four of these peptides, Shank1, Lhx6, Ap3b1 and Bsn, were identical in the mouse, while the PANX2 and UBR3 peptides were not conserved in the orthologous protein. Importantly none of the peptides identified only in murine proteins showed strong T1-116C binding. Thus studies in HLA-A2 transgenic mice could be used for safety testing the T1-116C mAb in a system containing several of the non-p53 potential targets without any murine specific off-target binding. However, these data do not address whether these epitopes are indeed naturally processed and presented or the expression pattern of the target antigen.
[0152] Searches for known T-cell epitopes (with antigens exhibiting >25% T1-116C binding) in the Immune Epitope Database and Analysis Resource (http://www.iedb.org) identified the known p53 epitope but found no experimentally determined epitopes for SHANK1, LHX6, PANX2, UBR3 or BSN. MHC class I epitopes for AP3B1 had been identified, but these were not the same peptide or HLA haplotype. Web searching with T cell epitope and the antigen name identified a murine MHC class I epitope from Ubr3 and an MHC class II presented murine peptide from Bsn that did not overlap with peptides identified in the current study. Web searching with the peptide sequence, among the top hits on Google, also failed to identify T-cell epitopes for any of the antigens but did identify the p53 epitopes. Thus to the best of the inventors knowledge there is no existing evidence that the T1-116C cross-reactive peptides are naturally processed and presented within the context of human HLA-A*0201. This can be further investigated by overexpressing potentially cross reactive antigens in HLA-A2.sup.+/p53-negative cell lines and studying correlation between antigen expression levels in cell lines and T1-116C binding.
[0153] Normal human tissue expression patterns of these antigens were investigated to assess the potential risks of toxicity if there was off-target T1-116C binding. Although it should be noted that transcript expression does not guarantee protein expression or peptide presentation. The expression of SHANK1 and BSN transcripts was restricted in normal tissues with the brain and testis exhibiting the highest levels of normal tissue expression (
[0154] In cancer cell lines UBR3 transcript expression was frequently higher than the levels observed in normal tissues. UBR3 was particularly highly transcribed (
[0155] A human IgG1 chimeric T1-116C antibody was transiently expressed in CHOK1SV GS-KO cells using the GS Xceed vector system by Lonza Biologics plc. The recombinant antibody exhibited a reasonable yield (9.3 mg from 400 ml culture) with only a small percentage (1.6%) of higher molecular weight impurities. The affinity of this human IgG1 chimeric T1-116C antibody for a human HLA-A2 tetramer containing the p53.sub.65-73 peptide was 0.977 M using a Quartz crystal Microbalance (QCM) assay performed by Lonza Biologics plc (
[0156] The number of available epitopes present on the cell surface for antibody binding is an important determinant of therapeutic antibody activity. A standard curve of PE-coupled calibration beads (QuantiBRITE PE beads) was used to estimate the number of PE-conjugated T1-116C antibodies bound to the surface of peptide pulsed T2 cells and cancer cell lines. T2 cells were pulsed with increasing concentrations of the p53.sub.65-73 peptide. Approximately 100 bound T1-116C molecules per cell were detectable above background levels in this assay. This is comparable to p53.sub.264-272/HLA-A2 TCR binding (200-300 binding sites per cell) detected using a soluble TCR with the same assay system.[50] Approximately 2000 T1-116C antibody molecules were bound per cell for MDA-MB-231, while approximately 5800 were bound per cell for OCI-Ly8.
TABLE-US-00005 TABLE 5 Quantitation of T1-116C binding sites per target cell. Cell line Peptide (T2 only) T1-116C-PE per cell T2 Flu-100 M 179 p53.sub.65-73-100 M 60955 p53.sub.65-73-50 M 21954 p53.sub.65-73-10 M 2190 p53.sub.65-73-2 M 440 p53.sub.65-73-0.5 M 119 FL-18 1329 Granta-519 7491 MO1043 4145 OCI-Ly1 4016 OCI-Ly8 5819 AU565 1617 Hs695T 1101 MDA-MB-231 1956 NCI-H1395 15291 NCI-H2087 3975 SW480 551 143B 1019
[0157] TCRm antibodies can be used to deliver drugs and toxins, reviewed by [6]. Some drugs require internalisation of the antibody to deliver the drug inside the cell, where it is then activated. Internalisation of a directly PE-conjugated T1-116C antibody by OCI-Ly8 human lymphoma cells was investigated. Target cells were incubated with T-116C, the OKT3 antibody (a negative control that lacks binding) and BB7.2 (positive control for HLA-A2, which is known to internalise) for 1-3 hours, after which externally bound antibody was stripped off and the cells were fixed and analysed by flow cytometry to detect the intracellular antibody (
[0158] Several TCRm antibodies against cancer targets have in vivo activity against tumours by mediating immune effector mechanisms such as complement-dependent cytotoxicity (CDC), antibody dependent phagocytosis (ADCP) and/or antibody-dependent cellular cytotoxicity (ADCC).[63-65]. The ability of a chimeric T1-116C antibody with a human IgG1 Fc domain to engage human immune effector cells was tested against B-cell lymphoma cell lines with high T1-116C binding, an isotype matched Rituximab antibody (anti-CD20) was used as a positive control (
[0159] The MDA-MB-231 cell line is derived from an aggressive triple receptor negative breast cancer, was labelled by T1-116C and had already been demonstrated to be targetable with a TCRm mAb against human chorionic gonadotropin beta (presented by HLA-A*0201) in vivo.[63] Recombinant T1-116C in either a human IgG1 (hlgG1) format or murine IgG2a (mlgG2a) format were tested for their ability to prevent the engraftment of MBA-MB-231 tumours in BALB/s nu/nu mice (10 mg/ml). The T1-116C IgG2a format antibody significantly inhibited tumour growth in vivo (P<0.0001) (
[0160] The T1-116C mlgG2a format antibody was further tested for its ability to prevent the growth of established MDA-MB-231 tumours in BALB/s nu/nu mice (10 mg/ml). Compared to an isotype matched control antibody (anti-fluorescein) or PBS carrier alone, the T1-116C antibody significantly reduced the growth rate of MDA-MB-231 tumours (P<0.0001).
[0161] Humanisation and de-immunisation of the T1-116C antibody was outsourced to Lonza Biologics plc. Screening did not identify any potentially high-risk post-translational modifications in the CDRs (complementarity determining regions) of antibody T1-116C. The optimal human germlines were identified, 3D computational models of the Fv domains were generated and Epibase profiling was used to design 16 humanised/deimmunised antibody variants (combinations of four light chain and four heavy chains, Table 6). A chimeric antibody containing the unaltered CDRs was also constructed.
TABLE-US-00006 TABLE6 CDRsequencesofhumanisedand deimmunisedT1-116Cantibodyvariants. CDR1 CDR2 CDR3 VL SASSSVSYIY STSNLAS QQRSNYPFT Wildtype (SEQIDNO:2) (SEQIDNO:3) (SEQIDNO:4) VL_1 SASSSVSYIY STSNLAS QQRSNYPFT VL_2 SASSSVSYIY STSNLAS QQRSNYPFT VL_3 SASSSVSYIY
[0162] The humanised and deimmunised T1-116C variants were transiently expressed and their yield, levels of soluble aggregates and their binding affinity for the immunising tetramer (p53.sub.65-73 peptide/HLA*0201 complex) are illustrated (Table 7). Only the four T1-116C variants containing the VL1 light chain were capable of binding their target antigen. Variants 1 and 2 showed comparable affinity to the parental and chimeric T1-116C antibody while variants 3 and 4 retained binding ability but at a lower affinity. These four variants demonstrated acceptable yields and low levels of aggregates.
TABLE-US-00007 TABLE 7 Summary of expression and binding data for transiently expressed T1-116C humanisation variants Conc. Yield % insoluble T1-116C Variant Heavy chain Light chain (mg/ml) (mg) aggregate K.sub.D(M) T1-116C chimeric T1-116C_VL T1-116C_VH 1.25-1.76 T1-116C variant 1 T1-116C_VL_1 T1-116C_VH_1 2.37 3.84 0.7 3.76 T1-116C variant 2 T1-116C_VL_1 T1-116C_VH_2 8.30 3.36 0.8 5.32 T1-116C variant 3 T1-116C_VL_1 T1-116C_VH_3 4.17 3.21 0.9 29.30 T1-116C variant 4 T1-116C_VL_1 T1-116C_VH_4 8.23 3.87 0.9 108.0 T1-116C variant 5 T1-116C_VL_2 T1-116C_VH_1 2.69 4.03 1.0 T1-116C variant 6 T1-116C_VL_2 T1-116C_VH_2 3.11 1.87 0.7 T1-116C variant 7 T1-116C_VL_2 T1-116C_VH_3 9.62 5.77 0.8 T1-116C variant 8 T1-116C_VL_2 T1-116C_VH_4 5.03 2.56 0.9 T1-116C variant 9 T1-116C_VL_3 T1-116C_VH_1 12.41 4.10 0.7 T1-116C variant 10 T1-116C_VL_3 T1-116C_VH_2 15.56 4.36 0.7 T1-116C variant 11 T1-116C_VL_3 T1-116C_VH_3 9.57 3.59 0.6 T1-116C variant 12 T1-116C_VL_3 T1-116C_VH_4 13.94 3.90 1.0 T1-116C variant 13 T1-116C_VL_4 T1-116C_VH_1 3.15 3.30 0.4 T1-116C variant 14 T1-116C_VL_4 T1-116C_VH_2 16.07 4.58 0.8 T1-116C variant 15 T1-116C_VL_4 T1-116C_VH_3 8.53 3.41 0.6 T1-116C variant 16 T1-116C_VL_4 T1-116C_VH_4 19.24 5.58 1.0 The heavy and light chain variable domains for the antibodies were synthesised and cloned into Lonza's GS XCeed vectors. Light chain variable domain encoding regions were transferred into pXC Kappa and heavy chain variable domain encoding regions into pXC IgG1f(K) vectors respectively. Single gene vectors were transiently co-transfected into Chinese Hamster Ovary cells GS Knockout (CHOKSV GS-KO) alongside the reference chimeric antibody at 200 ml scale. Six days post-transfection, the clarified supernatant was purified by Protein A chromatography. Product quality and purity was assessed by SDS-PAGE and SE-HPLC and antigen binding affinity was measured by QCM.
[0163] The ability of the four humanised T1-116C antibody variants to recognise the p53.sub.65-73 peptide/HLA*0201 complex on the surface of cells was tested by flow cytometry analysis in a T2 presentation assay and using a cancer cell line (
[0164] To further investigate the potential cross-activity of the T1-116C mAb, we expanded the replacement of individual amino acids to glycine or alanine, so that each position was individually changed to all possible 19 amino acids. The resulting 171 peptides were then compared to the original for their ability to be presented by HLA-A2 and to be bound by the T1-116C mAb in a T2 assay (
TABLE-US-00008 Single Amino Acid Substitution T1-116C Consensus Sequence Position 1 R Position 2 M, A, C, G, I, L, Q, S, T, V, W Position 3 P, A, C, D, H, L, M, Q, S, V, W, Y Position 4 E, A, C, D, G, K, M, N, P, Q, S, V Position 5 X Position 6 A, C, D, E, F, G, H, I, L, M, N, P, Q, S, T, V, W, Y Position 7 P, A, C, D, E, F, H, I, K, L, M, Q, S, T, V, W, Y Position 8 P, A, C, E, F, G, H, I, L, M, N, Q, R, S, V, W, Y Position 9 V, A, C, I, L
[0165] Peptides that retained T1-116C binding were used to interrogate the Immune Epitope Database (IEDB) that contains experimentally proven processed T-cell epitopes. We selected several peptides derived from known cancer antigens (including WT-1 and NY-ESO-1 peptides that displayed a single amino acid mismatch to the T1-116C consensus), and tested their binding to the original murine and humanised T1-116C mAbs variants 1 and 2 in a T2 assay. The following peptides were found to be recognised by T1-116C in an HLA-A2-dependent manner: MG501244-1252(RLGPTLMCL), Tyrosinase473-481 (RIWSWLLGA), gp100626-634 (RLMKQDFSV). Wilms Tumour protein 1 (WT1)126-134 (RMFPNAPYL), and NY-ESO-186-94(RLLEFYLAM) were also selected given their sequences were highly similar to the single amino acid substitution consensus sequence, and were additionally found to be recognised by T1-116C in an HLA-A2-dependent manner (
[0166] The T1-116C mAb was radiolabelled with 111In-chloride through p-SCN-Bn-DTPA) and purified by size exclusion chromatography (
[0167] To investigate the in vivo bio-distribution of the T1-116C antibody, SPECT imaging was conducted at 24, 48, and 72 hours following administration of 111In-labelled T1-116C antibody (or an isotype control) in mouse xenografts derived from breast cancer cell lines MDA-MB-231 (HLA-A2+) and MDA-MB-468 (HLA-A2-) (
[0168] These data illustrate that the T1-116C antibody can be used as an in vivo imaging agent. Imaging could be used to confirm the specificity of antibody binding in vivo and to stratify patients suitable for T1-116C therapy.
[0169] One of the major breakthroughs in cancer immunotherapy is the successful treatment of B-cell acute lymphoblastic leukaemia (B-ALL) using CD19 CAR T cells [76]. TCRm antibodies recognising cancer epitopes have potential as CAR T-cell targeting agents. To evaluate the suitability of the T1-116C antibody for this approach, two forms of CAR construct containing T1-116C variable regions in a second generation of CAR format, with alternative VH and VL orientations were generated (
Sequences
[0170]
TABLE-US-00009 Lightchainsequences T1-116C-VL (SEQIDNO:12) QIVLTQSPAIMSASPGEKVTVTCSASSSVSYIYWFQQKPGTSPKLWIYST SNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSNYPFTFGSG TKLEIKR T1-116C-VL_1 (SEQIDNO:13) QIVLTQSPATLSLSPGERATLSCSASSSVSYIYWFQQKPGQAPRLWIYST SNLASGVPARFSGSGSGTDYTLTISSLEPEDAAVYYCQQRSNYPFTFGSG TKLEIKR T1-116C-VL_2 (SEQIDNO:14) QIVLTQSPATLSLSPGERATLSCSASSSVSYIYWYQQKPGQAPRLLIYST SNLASGIPARFSGSGSGTDYTLTISSLEPEDFAVYYCQQRSNYPFTFGQG TKLEIKR T1-116C-VL_3 (SEQIDNO:15) QIVLTQSPATLSLSPGERATLSCSASSSVSYIYWYQQKPGQAPRLLIYST SNRATGIPARFSGSGSGTDYTLTISSLEPEDFAVYYCQQRSNYPFTFGQG TKLEIKR T1-116C-VL_4 (SEQIDNO:16) QIVLTQSPATLSLSPGERATLSCRASSSVSYIYWYQQKPGQAPRLLIYST SNRATGIPARFSGSGSGTDYTLTISSLEPEDFAVYYCQQRSNYPFTFGQG TKLERKR Heavychainsequences T1-116C-VH (SEQIDNO:17) EVQLQQSGAELVRPGASVKLSCKASGYTFTNYWIHWVKQRPGQGLEWIGN IYPSDSYSNYNQKFKDKATLTVDRSSSTAYMQLSSPTSEDSAVYYCARSE GYYDYEAFDYWGQGTTLTVSS T1-116C-VH_1 (SEQIDNO:18) EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWIHWVRQAPGQGLEWMGN IYPSDSYSNYNQKFKDRATLTVDRSTSTAYMELSSLRSEDTAVYYCARSE GYYDYEAFDYWGQGTLVTVSS T1-116C-VH_2 (SEQID:19) QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWIHWVRQAPGQGLEWMGN IYPSDSYSNYAQKFQGRVTLTVDTSTSTAYMELSSLRSEDTAVYYCARSE GYYDYEAFDYWGQGTLVTVSS T1-116C-VH_3 (SEQIDNO:20) QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWIHWVRQAPGQGLEWMGN IYPSDSYSNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCARSE GYYDYEAFDYWGQGTLVTVSS T1-116C-VH_4 (SEQIDNO:21) QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWMHWVRQAPGQGLEWMGN IYPSDSYTNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCARSE GYYDYEAFDYWGQGTLVTVSS
[0171] The following materials and methods are those used by the present inventors in the above Example.
Cell Culture
[0172] Cell lines were maintained in RPMI 1640 media supplemented with 10% fetal calf serum (FCS), 2 mM glutamine, and antibiotics (streptomycin [50 g/mL] and penicillin [50 U/mL]) at 37 C. and 5% CO.sub.2.
Generation of HLA-A2/p53 Tetramer and Chimeric Tetramer
[0173] A bacterial expression construct encoding the human HLA-A*0201 extracellular domain (amino acids 24-293) fused with a C-terminal BirA biotinylation sequence (LNDIFEAQKIEWH), and separate construct expressing mature human 2 microglobulin 2m, amino acids 21-119), were each generated and transformed into competent Escherichia coli strain BL21(DE3). Protein expression was induced by addition of 0.5 mM IPTG in low-salt LB medium (1% Tryptone, 0.5% Yeast extract and 0.5% NaCl W/V), and insoluble inclusion bodies containing the recombinant proteins were purified using BugBuster (Merck), according to the manufacturer's instructions. Peptides were synthesised by the peptide synthesis facility in the Weatherall Institute of Molecular Medicine (University of Oxford), these included p53 peptide1 (amino acids 65-73, RMPEAAPPV), peptide 2 (amino acids 187-197 GLAPPQHLIRV), and a control peptide derived from influenza A virus M1 protein (GILGFVFTL).
[0174] HLA-A2 tetramers were generated as previously described (Altman 1996 Science 273: 94-96). Briefly, HLA-A*0201 (15 mg), (32m (12.5 mg) and peptide (5 mg) were added into 500 ml of refolding buffer (100 mM Tris.Cl pH8.0, 400 mM L-Arginine, 2 mM EDTA, 5 mM reduced-glutathione, 0.5 mM oxidised-glutathione, and 0.1 mM PMSF) and refolded for 48 h. The refolding complex was concentrated and buffer exchanged to 10 mM Tris.Cl pH8.0, before being biotinylated with BirA protein biotin ligase (Avidity LLC) according to the manufacturer's instructions. Biotinylated protein was then separated using an Akta Purifier FPLC with a Sephadex 75 column and HLA-A2/2m/peptide monomers were isolated. Biotinylated monomers in FPLC buffer (20 mM Tris.Cl pH8.0, 150 mM NaCl) were aliquoted and stored at 80 C., and aliquots were thawed and tetramerised with Extravidin-PE or -APC (Sigma) on use. Tetramers are commonly described according to their HLA haplotype and peptide and the invariant (32m is not described but will be present in the complex.
[0175] To generate chimeric tetramers, a bacterial expression construct encoding a chimeric protein composed of human HLA-A2 12 domain (amino acids 24-208, from the wildtype HLA-A*201 expression construct) and murine H-2Dd 3 domain (amino acids 185-274, cloned from BALB/c mouse spleen cells) was generated by overlapping PCR. In addition, cDNA sequence encoding mature murine (32m (amino acids 21-119) was cloned from BALB/c mouse spleen cells, and PCR site-directed mutagenesis was performed on murine (32m to include the following changes to improve its refolding efficiency with HLA-A*0201: Pro53Ser, His54Asp, Met71 His, Met74Leu. Protein expression, refolding and tetramerisation were performed similarly to human tetramers.
Generation of Anti-p53 TCRm Monoclonal Antibodies
[0176] MF1 (used to generate T1-116C) and BALB/c mice (6-8 week old females) were immunised with the HLA-A*0201/p53 tetramers following a standard protocol, i.e., each mouse was given three immunisations, with 100 g tetramer per immunisation, at 10 day intervals. Forty days post the first immunisation, a boost immunisation, 100 g tetramer, was given and fusions were performed two days later. A standard fusion protocol was followed [67] with NS0 murine myeloma cells as the fusion partner and hybridomas were grown out under hypoxanthine, aminopterin and thymidine (HAT) selection.
[0177] Hybridoma supernatants were screened for the presence of secreted antibodies specifically, or preferentially, recognising the immunising tetramer containing a p53 peptide rather than a control tetramer containing a peptide from influenza virus, by ELISA. Wild type HLA-A*0201 tetramers with the immunising p53 peptide or influenza peptide were screened simultaneously and individual hybridoma colonies were picked from wells where the supernatant showed enhanced binding to a tetramer containing the immunising peptide rather than control peptide. Only individual colonies secreting antibodies that specifically recognised the tetramer containing the immunising peptide were studied further and were cloned by limiting dilution. All supernatants were screened for reactivity with a wild type human tetramer, even when the immunising tetramer was chimeric.
[0178] T1-116C antibody gene cloning and sequencing Total RNA was extracted from 510.sup.6 T1-116C hybridoma cells using an RNeasy kit (Qiagen), and first strand cDNA was synthesised using SuperScript III Reverse Transcriptase (Invitrogen) and Oligo(dT).sub.6 primer. The heavy chain variable region was amplified using the primers listed in Table 7, and light chain variable region was amplified using the primers listed in Table 8 (Brocks et al 2001 Molecular Medicine 7: 461-469). PCR products were purified with a Wizard SV Gel and PCR Clean-Up System (Promega) and cloned into a TOPO vector using a Zero Blunt TOPO PCR Cloning Kit (Invitrogen). The cloned T1-116C sequences were then sequenced.
TABLE-US-00010 TABLE7 MHV.B1 GATGTGAAGCTTCAGGAGTC MHV.B2 CAGGTGCAGCTGAAGGAGTC MHV.B3 CAGGTGCAGCTGAAGCAGTC MHV.B4 CAGGTTACTCTGAAAGAGTC MHV.B5 GAGGTCCAGCTGCAACAATCT MHV.B6 GAGGTCCAGCTGCAGCAGC MHV.B7 CAGGTCCAACTGCAGCAGCCT MHV.B8 GAGGTGAAGCTGGTGGAGTC MHV.B9 GAGGTGAAGCTGGTGGAATC MHV.B10 GATGTGAACTTGGAAGTGTC MHV.B11 GAGGTCCAGCTGCAACAGTC MHV.B12 GAGGTGCAGCTGGAGGAGTC MHC.F GCCAGTGGATAGTCAGATGGGGGTGTCGTTTTGGC
TABLE-US-00011 TABLE8 MKV.B1 GATGTTTTGATGACCCAAACT MKV.B2 GATATTGTGATGACGCAGGCT MKV.B3 GATATTGTGATAACCCAG MKV.B4 GACATTGTGCTGACCCAATCT MKV.B5 GACATTGTGATGACCCAGTCT MKV.B6 GATATTGTGCTAACTCAGTCT MKV.B7 GATATCCAGATGACACAGACT MKV.B8 GACATCCAGCTGACTCAGTCT MKV.B9 CAAATTGTTCTCACCCAGTCT MKV.B10 GACATTCTGATGACCCAGTCT MKC.F GGATACAGTTGGTGCAGCATC
Production of Purified Antibodies
[0179] Production of purified TCRm antibodies from hybridoma supernatant was achieved by culturing hybridoma cells in serum-free medium to extinction, or in CL350 bioreactors, followed by protein A or protein G purification of immunoglobulin.
[0180] Large-scale production of recombinant T1-116C antibody (mlgG1) and its isotype switching (mlgG2a or hlgG1) and endotoxin-free antibody production were outsourced to Absolute Antibody Ltd. Briefly, T1-116C heavy and light chains were cloned into pUV vectors, then transiently transfected into ABS293 cells. Culture supernatants were harvested and antibody purified through Protein A affinity chromatography. Purified antibody was analysed by SDS-PAGE and endotoxin level was determined by LAL chromogenic endotoxin assay.
[0181] For the QCM assay, a T1-116C human IgG1 chimeric antibody and sixteen humanised and deimmunised T1-116C variants were produced by Lonza Biologics PLC. Briefly, T1-116C heavy and light chains were cloned into Lonza's GS Xceed vectors, which were subsequently transiently transfected into CHOKISV GS-KO cells. Cell culture supernatant was harvested 6 days post transfection, filtered and antibody purified by Protein A chromatography. Purified material was analysed by SDS-PAGE and SE-HPLC.
ELISA Assay
[0182] Ninety-six well MaxiSorp plates were coated with 100 l of streptavidin at 10 g/ml in PBS at 4 C. overnight. The plates were then washed with PBS/0.1% Tween-20 and blocked with 1% BSA in PBS for 2 h at room temperature. Plates were used fresh or kept at 20 C. after washing for future use.
[0183] To test hybridoma binding to HLA-A2/peptide complexes, plates were used fresh or recovered from the 20 C. freezer and thawed at room temperature. HLA-A2/peptide monomers were added to the wells at 1 g/ml (100 l) and incubated for 1 h at room temperature. After washing, 100 l of mAb at 10 g/ml or neat hybridoma supernatants were added to the wells and incubated for 1 h before washed. HRP conjugated anti-mouse secondary antibody was added at 1:1000 dilution to each well and incubated for 1 h. Substrate ABTS Solution (Roche) was added to each well (100 l) after washing and OD405 nm was measured with a plate reader within 5-30 min.
T2 Cell Binding Assay
[0184] Hybridoma supernatants and/or purified antibodies were further screened for their ability to recognise their target peptide (or potentially cross reactive peptides identified by peptide scanning) presented on the cell surface of peptide-pulsed T2 cells by HLA-A2.
[0185] Peptides were synthesised by the peptide synthesis facility in the Weatherall Institute of Molecular Medicine, University of Oxford (20 mg scale), or by Sigma-Aldrich (1 mg scale). TAP-deficient T2 cells cultured at logarithmic phase were pulsed with peptides at 100 mM (or a range of lower concentrations for peptide titration experiments) for 12 h in a U-shaped bottom 96 well tissue culture plate. Cell were then harvested and stained with TCRm antibodies and/or HLA-A2-specific mAb BB7.2 (Abcam), followed by APC conjugated goat anti-mouse secondary antibody (eBioscience). Samples were washed with FACS wash buffer (2% FBS in PBS+0.1% sodium azide) then fixed with 1% paraformaldehyde (in PBS) and acquired with a FACSCalibur (BD Bioscience).
FACS Analysis
[0186] Cells were stained with either purified TCRm antibodies, generally at 10 g/ml diluted in FACS wash buffer (2% FBS in PBS+0.1% sodium azide), or neat hybridoma supernatants, followed by the indicated allophycocyanin (APC)-conjugated secondary antibody at 1:200 dilution: for murine primary antibodies the secondary antibody was goat anti-mouse-APC (eBioscience); for humanised and chimeric antibodies the secondary antibody was goat anti-human IgG (H+L) secondary antibody (Jackson ImmunoResearch Laboratories). After washing, samples were fixed with 1% paraformaldehyde (in PBS) and acquired with a FACSCalibur (BD Bioscience). FACS data were analysed with FlowJo software (TreeStar Inc.). On some occasions a directly PE-conjugated T1-116C mAb (conjugation of the T1-116C was outsourced to BioLegend) was used.
Immunocytochemistry
[0187] Acetone-fixed cytocentrifuge cell preparations of either peptide pulsed T2 cells (p53.sub.65-73, no peptide or Flu peptide), or cancer cell lines, were incubated in a solution of hydrogen peroxide (0.3% H.sub.2O.sub.2, 0.1% NaN.sub.3 in PBS) for 10 minutes to block any endogenous peroxidase activity. Slides were washed once in PBS then once in PBS-Tween (0.05% v/v, 3 minutes each wash). Slides were then incubated with primary antibody (T1-116C purified antibody, anti-HLA-A2 antibody clone BB7.2, mouse anti-p53 clone D01, Santa Cruz Biotechnology, sc-126 or isotype-matched control antibody (all at 10 g/ml)) for 30 minutes. After washing as above, the slides were incubated in secondary antibody reagent (Dako REAL EnVision Detection System, K5007) for 30 minutes. Labelling was visualized using the Liquid DAB+ Substrate Chromogen System (Dako, K3468), allowing colour to develop for 10 minutes. After washing as above, cells were counter-stained with Gill 3 Hematoxylin (Thermo Scientific, 6765009) and coverslips were mounted using Aquatex (VWR 1.08562.0050). All steps were performed at room temperature.
Western Blotting
[0188] Whole cell lysates were prepared using Mammalian Protein Extraction Reagent Thermo Scientific, 78503) containing a nuclease to degrade any nucleic acids and additional protease and phosphatase inhibitors. Protein concentrations were quantified using BCA assay (Thermo Scientific 23227). 30 g whole cell lysates were resolved on 10% polyacrylamide gels and transferred to Protran nitrocellulose membranes (GE Healthcare, 15269794). Membranes were blocked in 5% (w/v) low fat milk in PBS for 1 hour at RT, and were then incubated with primary antibodies overnight at 4 C. diluted in 5% (w/v) low fat milk in PBS (mouse anti-p53 (D01, Santa Cruz Biotechnology, sc-126, 1 g/ml), mouse anti-p53 (D07, Santa Cruz Biotechnology, sc-47698, 1 g/ml), mouse anti-p53 (Pab1801, Santa Cruz Biotechnology, sc-98, 1 g/ml), mouse anti--Actin (Sigma, clone AC-15) 1:20,000). This was followed by washing of the membranes in PBS (three washes) and PBS-Tween (0.1% v/v, one wash) at RT (5 minutes each wash) then incubation in secondary antibody solution (goat anti-mouse IgG-HRP, Dako, P0447, diluted in 5% w/v low fat milk in PBS) for 1 hour at RT. After washing as above, antibody binding was visualized with ECL reagent (GE Healthcare, RPN2106) and visualised with a G:BOX ChemiXRQ imaging system (Syngene).
Real Time-Quantitative PCR (RT-qPCR)
[0189] Expression of transcripts was assessed using cDNAs from normal human tissue (Clontech Human MTC Panels I and II, Takara Bio Europe, 636742 and 636743), and a panel of malignant cell lines. MTC Panel cDNAs were prepared from pools of individual donors. Cell line total RNA was isolated using QIAgen's RNeasy Mini kit (QIAgen, 74106) according to the manufacturer's instructions (incorporating the DNase I treatment). 1 g total RNA was then reverse transcribed using Superscript l (Life Technologies, 18080044). Cell line cDNAs were diluted 1/5 and 4 l of diluted cDNA was used for qPCR (20 l reaction volume). qPCR was performed using EXPRESS qPCR Supermix, Universal (Life Technologies, 11785-200) in a 96-well plate format on an MJ Research Chromo4 thermal cycler. Exon-spanning TaqMan assays (Life Technologies) for target genes were selected to ensure widest transcript coverage and/or detection of transcripts containing (or adjacent to) the exon encoding a potentially T1-116C cross reactive peptide. Assay details are listed in Table 9. Normal tissue expression was normalized to 2M (Beta-2-microglobulin) and GAPDH (glyceraldehyde-3-phophate dehydrogenase), whilst cell line expression was normalised to TBP (TATA Box Binding Protein), 18S RNA and HPRT1 (Hypoxanthine phosphoribosyltransferase 1). Expression is presented relative to positive control samples.
TABLE-US-00012 TABLE 9 Target Gene TaqMan Assay p53 Hs01034249_m1 (Ex 10-11) Hs01034253_m1 (Ex 4-5) UBR3 Hs00419575_m1 (Ex 23-24) Hs01118905_m1 (Ex 36-37) SHANK1 Hs01061105_m1 (Ex 21-22) Hs01061106_m1 (Ex 22-23) BSN Hs01109152_m1 (Ex 3-4) Hs00185720_m1 (Ex 5-6) AP3B1 Hs00186383_m1 (Ex 2-3) Hs01564196_m1 (Ex 16-17) LHX6 Hs01030943_m1 (Ex 5-6) Hs01030946_m1 (Ex 8-9) PANX2 Hs00364525_m1 (Ex 1-2) 2M 4326319E GAPDH 4310884E TBP 4326322E 18S RNA 4319413E HPRT1 Hs99999909_m1
Quartz Crystal Microbalance (QCM) Analysis
[0190] To determine the binding affinity of T1-116C mAb and its chimeric and humanised variants to HLA-A2/p53 peptide 1 monomers, a QCM assay was performed by Lonza Biologics plc. Briefly, a polyclonal rabbit anti-human IgG antibody (Attana) was immobilised onto an LNB Carboxyl Sensor Chip (Attana) via amine coupling, and T1-116C chimeric antibody or a negative control hlgG1 mAb was captured onto the chip at a concentration of 5.0 g/ml (150 s contact time and 60 s association time at 10 l/min). HLA-A2/p53 monomer titrations were performed in an 8 point 2-fold serial dilution (from 50 g/ml, 1.08 M) and injected over the surface for a contact time of 60 s in duplicates, and association was monitored for 300 s. Between each antibody injection, the surface was regenerated by one injection of 100 mM HCl (60 s contact time) followed by a subsequent injection of 20 mM NaOH (60 s contact time).
[0191] All measurements were performed at 25 C. in 1HBS-T running buffer. Data was collected by Attester software v3.0 and subsequently processed in Attester Evaluation v3.0 and Clamp XP software to achieve kinetic data where data were fitted to a Simple 1:1 Binding Model.
Quantitation of Antibody Molecules Bound Per Target Cell
[0192] Cell lines or T2 cells pulsed with the p53.sub.65-73 peptide at 0.5-100 M concentrations or the Flu peptide at 100 M were stained with PE-conjugated T1-116C mAb (mAb:PE=1:1) or an isotype matched control antibody at 10 g/ml for 30 min on ice. Cells were washed with FACS Wash buffer then fixed with 1% paraformaldehyde before being analysed with a FACSCalibur (BD Biosciences). QuantiBRITE-PE beads (BD Biosciences) were acquired in parallel and correlation between geometric means (corrected to remove background binding to isotype control antibody) and PE molecules/beads of the four QuantiBRITE bead populations was established according to the manufacturer's instructions. Numbers of T1-116C-PE antibody molecules bound per cell was calculated based on the correlation formula and subtraction of background from negative cells (unpulsed T2 cells [531 antibody molecules bound] or 293T cells [437 antibody molecules bound]).
Antibody Internalisation Assay
[0193] Human B cell lymphoma OCI-Ly8 cells were stained with PE-conjugated T1-116C mAb (10 g/ml) at 4 C. for 20 min and washed with FACS wash buffer. Aliquots of the cells were fixed with 1% paraformaldehyde (to demonstrate cell surface labelling) and the rest were incubated at 37 C. for various time points to allow the labelled T1-116C antibody to internalise before the cells were harvested and stripped of externally bound antibody with a stripping buffer (150 mM NaCl, pH2.5) before being fixed with 1% paraformaldehyde. Samples were analysed by FACS. Antibodies OKT3-PE and BB7.2-PE served as negative (no binding to target cells) and positive (known to internalise) controls for internalisation.
Complement Dependent Cytotoxicity (CDC) Assay
[0194] 110.sup.5 cells were opsonised with antibody for 15 min at room temperature (RT) in a flat-bottomed 96-well plate. Human serum was added to a final volume of 10% and incubated for 30 min at 37 C. Cells were transferred to a FACS tube where 10 L propidium iodide (P1) solution (10 g/mL in PBS) was added prior to data acquisition. Percentage cell death was defined as the percentage PI+ cells of the total cell population.
Antibody Dependent Cellular Phagocytosis (ADCP) Assay:
[0195] Mouse bone marrow derived macrophages (BMDM) were differentiated from the bone marrow of WT BALB/c female mice and cultured for 7-10 days in the presence of 20% L929 conditioned media (containing M-CSF). 510.sup.4 BMDM per well were plated in a flat-bottomed 96-well plate the day before the assay was performed as previously described.[68]
[0196] In brief, target cells were labelled with Carboxyfluorescein succinimidyl ester (CFSE) at RT before being washed once in RPMI media. The CFSE labelled cells were opsonised with antibody for 30 min at 4 C., washed once and then 2.510.sup.5 opsonised target cells added to the BMDM and left to co-culture at 37 C. for 1 hr. The BMDM were labelled with anti-F4/80-APC (Serotec) and the wells washed with PBS, before removal and analysis of the cells on FACS Calibur (BD Biosciences). Percentage phagocytosis was defined as the percentage of CFSE.sup.+ F4/80.sup.+ cells of the total F4/80.sup.+ population.
Antibody Dependent Cellular Cytotoxicity (ADCC) Assay:
[0197] Human peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation. Target cells were labelled with calcein AM (Life Technologies) and suspended in RPMI. The labelled cells were opsonised with antibody for 30 min at 4 C. before washing once in RPMI media. The target cells and PBMC effector cells were co-cultured at a 50:1 (Effector:Target) ratio for 4 hr at 37 C. The cells were pelleted by centrifugation (1500 rpm for 5 min), the supernatant transferred to a white 96-well plate, and read using a Varioskan Flash (Thermo Scientific) to record calcein release (excitation wavelength 485 nm; emission wavelength 530 nm). Percent of maximum lysis was defined as the calcein release compared to the response recorded when cells were treated with 4% Triton-X100 solution.
Xenograft Experiments
[0198] MDA-MB-231 cells (110.sup.7) in 100 l Matrigel were injected subcutaneously into the flank of BALB/c nu/nu mice (n=10 per group). T1-116C in two formats, a murine IgG2a isotype (mlgG2a) versus a human IgG1 isotype (hlgG1), or PBS carrier alone, was administered twice a week (10 mg/kg for Ab and 200 l for PBS) starting from the time of tumour inoculation. Tumour sizes were calculated as lengthwidthheight/6. Geometric Mean Diameter (GMD) was calculated as (LWH).sup.1/3.
T1-116C mAb Humanisation and Deimmunisation
[0199] T1-116C mAb was humanised and deimmunised by Lonza Biologics. Briefly, in silico humanisation and deimmunisation were performed on heavy and light chain sequences using CDR grafting technology and T-cell epitope reduction. Heavy chain and light chain variable region cDNAs were synthesised and cloned into expression vectors encoding human IgG1 framework. In total 16 variants were generated in addition to a chimeric format in which the murine VH-C1 fused with human IgG1-C2-C3 was paired with murine VL-CL. Transient transfection was performed in CHOK1SV GS-KO cells and humanised antibodies were purified from 200 ml culture supernatants via Protein A chromatography.
Antibody Radiolabelling
[0200] T1-1160-mlgG2a and an isotype control antibody (Absolute Antibody Ltd, UK) were radiolabeled with 111In as previously described [77]. Briefly, 500 g of T1-1160 or isotype control antibody was dissolved in 0.1 M sodium bicarbonate aqueous buffer (pH 8.2) before adding a 20-fold molar excess of 2-(4-isothiocyanatobenzyl)-diethylenetriaminepentaacetic acid (p-SCN-Bn-DTPA; Macrocyclics) and incubating for 1 h at 37 C. The DTPA-conjugated antibody was subsequently purified using a Sephadex G50 gel filtration column and radiolabeled using 111In-chloride (1 MBq per 1 g of IgG). The protein was further purified by Sephadex G50 size exclusion chromatography. Radiochemical purity was determined by instant thin layer chromatography (iTLC) as >95%.
Saturation Binding Assay
[0201] MDA-MB-231 breast cancer cells growing in 12-well plates were incubated with 111In-T1-116C antibody (1 MBq/g) at various concentrations (2-400 nM) at 4 C. for 2 h. Cells were washed, lysed and the amount of cell-associated radioactivity was measured using an automated gammacounter. A saturation binding curve was fitted to the data using the GraphPad Prism software package to estimate the affinity (KD) and number of binding sites per cell (Bmax).
In Vivo Imaging and Biodistribution
[0202] Female BALB/c nu/nu mice (Charles Rivers) were injected subcutaneously on their flanks with 1106 MDA-MB-231 or MDA-MB-468 breast cancer cells. 111In-labelled T1-116C or mlgG2a isotype control antibody (5 MBq, 5 g) was administered i.v. when tumour sizes reach 120 mm3 at day 20, and SPECT/CT imaging was performed at 24, 48, 72 h after injection, using a Bioscan NanoSPECT/CT. Volume-of-interest analysis was performed on SPECT images using the Inveon Research Workplace software package (Siemens). After imaging at 72 h post injection, animals were sacrificed and selected organs were removed, rinsed, blot dried, weighed, and the amount of 111In in each tissue was measured using an automated gammacounter. Uptake of 111In was expressed as the percentage of the injected dose per gram of tissue (% ID/g).
Generation of Cell Lines Expressing T1-116C CARs
[0203] CAR constructs containing the T1-116C scFv in two different variable fragment orientations were generated according to the design in
REFERENCES
[0204] 1. Bronte, G., et al., Monoclonal antibodies for the treatment of non-haematological tumours: update of an expanding scenario. Expert Opin Biol Ther, 2015. 15(1): p. 45-59. [0205] 2. Maloney, D. G., et al., IDEC-C2B8 (Rituximab) anti-CD20 monoclonal antibody therapy in patients with relapsed low-grade non-Hodgkin's lymphoma. Blood, 1997. 90(6): p. 2188-95. [0206] 3. Baselga, J., et al., Recombinant humanized anti-HER2 antibody (Herceptin) enhances the antitumor activity of paclitaxel and doxorubicin against HER2/neu overexpressing human breast cancer xenografts. Cancer Res, 1998. 58(13): p. 2825-31. [0207] 4. Rock, K. L., I. A. York, and A. L. Goldberg, Post-proteasomal antigen processing for major histocompatibility complex class I presentation. Nat Immunol, 2004. 5(7): p. 670-7. [0208] 5. Weidanz, J. A., et al., TCR-like biomolecules target peptide/MHC Class I complexes on the surface of infected and cancerous cells. Int Rev Immunol, 2011. 30(5-6): p. 328-40. [0209] 6. Dahan, R. and Y. Reiter, T-cell-receptor-like antibodies-generation, function and applications. Expert Rev Mol Med, 2012. 14: p. e6. [0210] Cohen, M. and Y. Reiter, T-cell receptor-like antibodies: targeting the intracellular proteom therapeutic potential and clinical applications. Antibodies, 2013. 2: p. 517-534. [0211] 8. Cohen, C. J., et al., Recombinant antibodies with MHC-restricted, peptide-specific, T-cell receptor-like specificity: new tools to study antigen presentation and TCR-peptide-MHC interactions. J Mol Recognit, 2003. 16(5): p. 324-32. [0212] 9. Verma, B., et al., TCR mimic monoclonal antibodies induce apoptosis of tumor cells via immune effector-independent mechanisms. J Immunol, 2011. 186(5): p. 3265-76. [0213] 10. Brown, C. J., et al., Awakening guardian angels: drugging the p53 pathway. Nat Rev Cancer, 2009. 9(12): p. 862-73. [0214] 11. Malkin, D., Li-fraumeni syndrome. Genes Cancer, 2011. 2(4): p. 475-84. [0215] 12. Barnes, D. M., et al., Abnormal expression of wild type p53 protein in normal cells of a cancer family patient. Lancet, 1992. 340(8814): p. 259-63. [0216] 13. Vogelstein, B., D. Lane, and A. J. Levine, Surfing the p53 network. Nature, 2000. 408(6810): p. 307-10. [0217] 14. Khoo, K. H., C. S. Verma, and D. P. Lane, Drugging the p53 pathway: understanding the route to clinical efficacy. Nat Rev Drug Discov, 2014. 13(3): p. 217-36. [0218] 15. Freed-Pastor, W. A. and C. Prives, Mutant p53: one name, many proteins. Genes Dev, 2012. 26(12): p. 1268-86. [0219] 16. Garcia, P. B. and L. D. Attardi, Illuminating p53 function in cancer with genetically engineered mouse models. Semin Cell Dev Biol, 2014. 27: p. 74-85. [0220] 17. Hong, B., et al., Targeting tumor suppressor p53 for cancer therapy: strategies, challenges and opportunities. Curr Drug Targets, 2014. 15(1): p. 80-9. [0221] 18. Muller, P. A. and K. H. Vousden, Mutant p53 in cancer: new functions and therapeutic opportunities. Cancer Cell, 2014. 25(3): p. 304-17. [0222] 19. Theobald, M., et al., The sequence alteration associated with a mutational hotspot in p53 protects cells from lysis by cytotoxic T lymphocytes specific fora flanking peptide epitope. J Exp Med, 1998. 188(6): p. 1017-28. [0223] 20. Vierboom, M. P., et al., High steady-state levels of p53 are not a prerequisite for tumor eradication by wild-type p53-specific cytotoxic T lymphocytes. Cancer Res, 2000. 60(19): p. 5508-13. [0224] 21. Kuckelkorn, U., et al., The effect of the interferon-gamma-inducible processing machinery on the generation of a naturally tumor-associated human cytotoxic T lymphocyte epitope within a wild-type and mutant p53 sequence context. Eur J Immunol, 2002. 32(5): p. 1368-75. [0225] 22. De Leo, A. B., p53-based immunotherapy of cancer. Approaches ro reversing unresponsiveness to T lymphocytes and preventing tumor escape. Adv Otorhinolaryngol, 2005. 62: p. 134-50. [0226] 23. Labrecque, S., et al., Analysis of the anti-p53 antibody response in cancer patients. Cancer Res, 1993. 53(15): p. 3468-71. [0227] 24. Yanuck, M., et al., A mutant p53 tumor suppressor protein is a target for peptide-induced CD8+ cytotoxic T-cells. Cancer Res, 1993. 53(14): p. 3257-61. [0228] 25. Humar, M., et al., DNA vaccination with a mutated p53 allele induces specific cytolytic T cells and protects against tumor cell growth and the formation of metastasis. J Cancer Res Clin Oncol, 2009. 135(4): p. 567-80. [0229] 26. Noguchi, Y., Y. T. Chen, and L. J. Old, A mouse mutant p53 product recognized by CD4+ and CD8+ T cells. Proc Natl Acad Sci USA, 1994. 91(8): p. 3171-5. [0230] 27. Theobald, M. and R. Offringa, Anti-p53-directed immunotherapy of malignant disease. Expert Rev Mol Med, 2003. 5(11): p. 1-13. [0231] 28. DeLeo, A. B. and T. L. Whiteside, Development of multi-epitope vaccines targeting wild-type sequence p53 peptides. Expert Rev Vaccines, 2008. 7(7): p. 1031-40. [0232] 29. Vermeij, R., et al., Immunological and clinical effects of vaccines targeting p53-overexpressing malignancies. J Biomed Biotechnol, 2011. 2011: p. 702146. [0233] 30. Choi, J. and L. A. Donehower, p53 in embryonic development: maintaining a fine balance. Cell Mol Life Sci, 1999. 55(1): p. 38-47. [0234] 31. Rogel, A., et al., p53 cellular tumor antigen: analysis of mRNA levels in normal adult tissues, embryos, and tumors. Mol Cell Biol, 1985. 5(10): p. 2851-5. [0235] 32. Kubbutat, M. H. and K. H. Vousden, Keeping an old friend under control: regulation of p53 stability. Mol Med Today, 1998. 4(6): p. 250-6. [0236] 33. Milner, J., Different forms of p53 detected by monoclonal antibodies in non-dividing and dividing lymphocytes. Nature, 1984. 310(5973): p. 143-5. [0237] 34. Pezzella, F., et al., Antibody for detecting p53 protein by immunohistochemistry in normal-tissues. Journal Of Clinical Pathology, 1994. 47: p. 592-596. [0238] 35. Pillai, G., et al., p53 expression in normal paraffin-embedded tissue using different antibodies and antigen retrieval buffer systems. Histopathology, 2003. 42(1): p. 83-7. [0239] 36. Nijman, H. W., et al., Immunologic aspect of ovarian cancer and p53 as tumor antigen. J Transl Med, 2005. 3: p. 34. [0240] 37. Vierboom, M. P., et al., Tumor eradication by wild-type p53-specific cytotoxic T lymphocytes. J Exp Med, 1997. 186(5): p. 695-704. [0241] 38. Zwaveling, S., et al., Antitumor efficacy of wild-type p53-specific CD4(+) T-helper cells. Cancer Res, 2002. 62(21): p. 6187-93. [0242] 39. Theoret, M. R., et al., Relationship of p53 overexpression on cancers and recognition by anti-p53 T cell receptor-transduced T cells. Hum Gene Ther, 2008. 19(11): p. 1219-32. [0243] 40. Cheever, M. A., et al., The prioritization of cancer antigens: a national cancer institute pilot project for the acceleration of translational research. Clin Cancer Res, 2009. 15(17): p. 5323-37. [0244] 41. Molloy, P. E., A. K. Sewell, and B. K. Jakobsen, Soluble T cell receptors: novel immunotherapies. Curr Opin Pharmacol, 2005. 5(4): p. 438-43. [0245] 42. Stone, J. D., et al., T cell receptor engineering. Methods Enzymol, 2012. 503: p. 189-222. [0246] 43. Laugel, B., D. A. Price, and A. K. Sewell, On the path to TCR-directed therapeutics. Nat Biotechnol, 2006. 24(6): p. 615-6. [0247] 44. Foote, J. and H. N. Eisen, Breaking the affinity ceiling for antibodies and T cell receptors. Proc Natl Acad Sci USA, 2000. 97(20): p. 10679-81. [0248] 45. Holler, P. D., et al., In vitro evolution of a T cell receptor with high affinity for peptide/MHC. Proc Natl Acad Sci USA, 2000. 97(10): p. 5387-92. [0249] 46. Liddy, N., et al., Monoclonal TCR-redirected tumor cell killing. Nat Med, 2012. 18(6): p. 980-7. [0250] 47. Oren, R., et al., Functional comparison of engineered T cells carrying a native TCR versus TCR-like antibody-based chimeric antigen receptors indicates affinity/avidity thresholds. J Immunol, 2014. 193(11): p. 5733-43. [0251] 48. Epel, M., et al., A functional recombinant single-chain T cell receptor fragment capable of selectively targeting antigen-presenting cells. Cancer Immunol Immunother, 2002. 51(10): p. 565-73. [0252] 49. Card, K. F., et al., A soluble single-chain T-cell receptor IL-2 fusion protein retains MHC-restricted peptide specificity and IL-2 bioactivity. Cancer Immunol Immunother, 2004. 53(4): p. 345-57. [0253] 50. Zhu, X., et al., Visualization of p53(264-272)/HLA-A*0201 complexes naturally presented on tumor cell surface by a multimeric soluble single-chain T cell receptor. J Immunol, 2006. 176(5): p. 3223-32. [0254] 51. Fishman, M. N., et al., Phase I trial of ALT-801, an interleukin-2/T-cell receptor fusion protein targeting p53 (aa264-272)/HLA-A*0201 complex, in patients with advanced malignancies. Clin Cancer Res, 2011. 17(24): p. 7765-75. [0255] 52. Mosquera, L. A., et al., In vitro and in vivo characterization of a novel antibody-like single-chain TCR human IgG1 fusion protein. J Immunol, 2005. 174(7): p. 4381-8. [0256] 53. Hoffmann, T. K., et al., Frequencies of tetramer+ T cells specific for the wild-type sequence p53(264-272) peptide in the circulation of patients with head and neck cancer. Cancer Res, 2002. 62(12): p. 3521-9. [0257] 54. Theobald, M., et al., Tolerance to p53 by A2.1-restricted cytotoxic T lymphocytes. J Exp Med, 1997. 185(5): p. 833-41. [0258] 55. Barfoed, A. M., et al., Cytotoxic T-lymphocyte clones, established by stimulation with the HLA-A2 binding p5365-73 wild type peptide loaded on dendritic cells In vitro, specifically recognize and lyse HLA-A2 tumour cells overexpressing the p53 protein. Scand J Immunol, 2000. 51(2): p. 128-33. [0259] 56. Wurtzen, P. A., et al., Specific killing of P53 mutated tumor cell lines by a cross-reactive human HLA-A2-restricted P53-specific CTL line. Int J Cancer, 2001. 93(6): p. 855-61. [0260] 57. Salter, R. D. and P. Cresswell, Impaired assembly and transport of HLA-A and-B antigens in a mutant TxB cell hybrid. EMBO J, 1986. 5(5): p. 943-9. [0261] 58. MacCallum, D. E., et al., The p53 response to ionising radiation in adult and developing murine tissues. Oncogene, 1996. 13(12): p. 2575-87. [0262] 59. Dainiak, N., Hematologic consequences of exposure to ionizing radiation. Exp Hematol, 2002. 30(6): p. 513-28. [0263] 60. Maas, K., et al., Reduced p53 in peripheral blood mononuclear cells from patients with rheumatoid arthritis is associated with loss of radiation-induced apoptosis. Arthritis Rheum, 2005. 52(4): p. 1047-57. [0264] 61. Cameron, B. J., et al., Identification of a Titin-derived HLA-A1-presented peptide as a cross-reactive target for engineered MAGE A3-directed T cells. Sci Transl Med, 2013. 5(197): p. 197ra103. [0265] 62. Linette, G. P., et al., Cardiovascular toxicity and titin cross-reactivity of affinity-enhanced T cells in myeloma and melanoma. Blood, 2013. 122(6): p. 863-71. [0266] 63. Wittman, V. P., et al., Antibody targeting to a class I MHC-peptide epitope promotes tumor cell death. J Immunol, 2006. 177(6): p. 4187-95. [0267] 64. Sergeeva, A., et al., An anti-PR1/HLA-A2 T-cell receptor-like antibody mediates complement-dependent cytotoxicity against acute myeloid leukemia progenitor cells. Blood, 2011. 117(16): p. 4262-72. [0268] 65. Dao, T., et al., Targeting the intracellular WT1 oncogene product with a therapeutic human antibody. Sci Transl Med, 2013. 5(176): p. 176ra33. [0269] 66. Overdijk, M. B., et al., Crosstalk between human IgG isotypes and murine effector cells. J Immunol, 2012. 189(7): p. 3430-8. [0270] 67. Mason, D. Y., J. L. Cordell, and K. A. F. Pulford, Production of monoclonal antibodies for immunocytochemical use., in Techniques in Immunocytochemistry, G. R. Bullock and P. Petrusz, Editors. 1983, Academic Press: London. p. 175-216. [0271] 68. Tipton, T. R., et al., Antigenic modulation limits the effector cell mechanisms employed by type I anti-CD20 monoclonal antibodies. Blood, 2015. [0272] 69. Kabat et al., J. Immunol., 1991; 147(5): 1709-1719. [0273] 70. Al-Lazikani B., Lesk A. M., Chothia C. (1997). Standard conformations for the canonical structures of immunoglobulins. J Mol Biol. 273. 927-948. [0274] 71. Samaranayake et al., Ann. Med., 2009; 41(5): 322-31. [0275] 72. Fang et al., Mol. Ther., 2007; 15(6):1153-9. [0276] 73. Kershaw et al., Nat Rev Cancer., 2013; 13; 525-541 [0277] 74. Kershaw et al., Clin Cancer Res., 2006; 15; 12: 6106-15. [0278] 75. Brentjens et al., Nat Med., 2003; 9; 3; 279-86. [0279] 76. Maude, S. L., et al., CD19-targeted chimeric antigen receptor T-cell therapy for acute lymphoblastic leukemia. Blood. 2015 125(26): p. 4017-23. [0280] 77. Cornelissen, B., et al., Imaging DNA damage in vivo using gammaH2AX-targeted immunoconjugates. Cancer Res. 2011 71(13): p. 4539-49. [0281] 78. Kawata et al. Establishment and characterization of the tumors of chronic lymphocytic leukemia cell line in nude and SCID mice. Leuk Res. 1993 October; 17(10):883-94. [0282] 79. Ohno et al., A newly established human lymphoma cell line, FL-18, carrying a 14;18 translocation. Jpn J Cancer Res. 1985 July; 76(7):563-6. [0283] 80. Mehra et al. Molecular cytogenetic characterization of non-Hodgkin lymphoma cell lines. Genes Chromosomes Cancer. 2002 March; 33(3):225-34.