Device for Detection of Vitamin D Metabolites
20190086430 ยท 2019-03-21
Inventors
Cpc classification
C07K2317/32
CHEMISTRY; METALLURGY
G01N33/543
PHYSICS
G01N2470/06
PHYSICS
C07K16/44
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides methods, devices, and compositions to rapidly detect analytes, including small analytes, using a lateral flow device. Described herein is such a lateral flow device that can detect and quantify vitamin D in a whole blood, serum, or plasma sample by employing a sandwich-based immunoassay.
Claims
1. A test device for detecting one or more vitamin D molecules comprising: (a) a housing, containing therein; (i) a sample application pad configured to absorb a biological sample and transport said biological sample to a conjugate pad; (ii) said conjugate pad comprising a vitamin D binding agent that specifically binds to one or more vitamin D molecules; and (iii) a detection zone comprising a first region having immobilized thereon a detection agent that specifically binds an epitope that is generated by complexing said vitamin D binding agent with said one or more vitamin D molecules.
2. The test device of claim 1, wherein said one or more vitamin D molecules are selected from the group consisting of 25-hydroxyvitamin D.sub.2, 25-hydroxyvitamin D.sub.3, 25-hydroxyvitamin D.sub.4, 25-hydroxyvitamin D.sub.5, and 1,25-hydroxyvitamin D.sub.3.
3. The test device of claim 1, wherein said one or more vitamin D molecules are selected from the group consisting of 25-hydroxyvitamin D.sub.2 and 25-hydroxyvitamin D.sub.3.
4. The test device of claim 1, wherein said one or more vitamin D molecules are 25-hydroxyvitamin D.sub.2 and 25-hydroxyvitamin D.sub.3.
5. The test device of claim 1, wherein said one or more vitamin D molecules consist of 25-hydroxyvitamin D.sub.2.
6. The test device of claim 1, wherein said one or more vitamin D molecules consist of 25-hydroxyvitamin D.sub.3.
7. The test device of claim 1, wherein said detection zone further comprises a second region having immobilized thereon an antibody that is capable of binding to said vitamin D binding agent whether or not said vitamin D binding agent is bound to said one or more vitamin D molecules.
8. The test device of claim 1, wherein said vitamin D binding agent is conjugated to a detection reagent.
9.-11. (canceled)
12. The test device of claim 1, wherein said sample application pad, said conjugate pad, and said detection zone are aligned from upstream to downstream along a fluid path through which said biological sample travels.
13. The test device of claim 1, further comprising a filtering component between said sample application pad and said conjugate pad configured to separate a particulate portion of said biological sample from an aqueous portion of said biological sample.
14. The test device of claim 1, wherein said detection agent is an antibody comprising a light chain and a heavy chain, wherein said light chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs 1-5 and 16-20, or an amino acid sequence sharing at least 80% sequence homology to a sequence selected from the group consisting of SEQ ID NOs 1-5, and 16-20; and wherein said heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs 6-15, or an amino acid sequence sharing at least 80% sequence homology to a sequence selected from the group consisting of SEQ ID NOs 6-15.
15.-17. (canceled)
18. A method, comprising: (a) applying a biological sample to said sample application pad of said test device of claim 1; (b) applying a chase buffer to said sample application pad; and (c) detecting said one or more vitamin D molecules.
19. The method of claim 18, further comprising quantifying said one or more vitamin D molecules in said biological sample.
20. The method of claim 19, wherein said quantifying classifies said biological sample as having a sufficient level, an insufficient level, or a deficient level of said one or more vitamin D molecules.
21. The method of claim 20, wherein said sufficient level is at least 30 ng/mL.
22. The method of claim 20, wherein said insufficient level is at least 10 ng/mL and less than 30 ng/mL.
23. The method of claim 20, wherein said deficient level is less than 10 ng/mL.
24. The method of claim 19, wherein said quantifying further comprises using: (i) an imaging device to provide an image of said detection zone; and (ii) software on a programmed computer configured to quantify said one or more vitamin D molecules in said biological sample based on said image of said detection zone.
25. (canceled)
26. The method of claim 18, wherein said chase buffer comprises reagents to dissociate said one or more vitamin D molecules from said vitamin D binding agent.
27. The method of claim 18, wherein said biological sample is selected from the group consisting of whole blood, serum, plasma, urine, saliva, ocular fluid, spinal fluid, and perspiration.
28. A method for detecting one or more vitamin D levels in a biological sample with a test device configured to perform a binding assay, comprising: (a) contacting said biological sample to said test device; (b) subjecting said biological sample to said binding assay that utilizes a reaction mixture comprising a complex formed by (i) a vitamin D binding agent and (ii) one or more vitamin D molecules; (c) further exposing said complex to a detection agent that binds to an epitope that is formed by complexing said vitamin D binding agent with said one or more vitamin D binding molecules, wherein said binding assay has a sensitivity of detection in said biological sample that is comparable to that of liquid chromatography-tandem mass spectrometry.
29.-33. (canceled)
34. A kit, comprising: (a) said test device of claim 1; and (b) written instructions for use of said kit.
35.-39. (canceled)
40. The method of claim 19, wherein said quantifying comprises quantifying a concentration of about 3 ng/ml to about 105 ng/ml of said one or more vitamin D molecules in said biological sample.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
DETAILED DESCRIPTION OF THE INVENTION
[0033] The systems and methods of this disclosure as described herein may employ, unless otherwise indicated, conventional techniques and descriptions of molecular biology (including recombinant techniques), cell biology, biochemistry, microarray and sequencing technology, which are within the skill of those who practice in the art. Such conventional techniques include polymer array synthesis, hybridization and ligation of oligonucleotides, sequencing of oligonucleotides, and detection of hybridization using a label. Specific illustrations of suitable techniques can be had by reference to the examples herein. However, equivalent conventional procedures can, of course, also be used. Such conventional techniques and descriptions can be found in standard laboratory manuals such as Green, et al., Eds., Genome Analysis: A Laboratory Manual Series (Vols. I-IV) (1999); Weiner, et al., Eds., Genetic Variation: A Laboratory Manual (2007); Dieffenbach, Dveksler, Eds., PCR Primer: A Laboratory Manual (2003); Bowtell and Sambrook, DNA Microarrays: A Molecular Cloning Manual (2003); Mount, Bioinformatics: Sequence and Genome Analysis (2004); Sambrook and Russell, Condensed Protocols from Molecular Cloning: A Laboratory Manual (2006); and Sambrook and Russell, Molecular Cloning: A Laboratory Manual (2002) (all from Cold Spring Harbor Laboratory Press); Stryer, L., Biochemistry (4th Ed.) W.H. Freeman, N.Y. (1995); Gait, Oligonucleotide Synthesis: A Practical Approach IRL Press, London (1984); Nelson and Cox, Lehninger, Principles of Biochemistry, 3rd Ed., W.H. Freeman Pub., New York (2000); and Berg et al., Biochemistry, 5th Ed., W.H. Freeman Pub., New York (2002), all of which are herein incorporated by reference in their entirety for all purposes.
[0034] It is to be understood that this disclosure is not limited to the specific systems and methods, compositions, targets and uses described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only and is not intended to limit the scope of the present disclosure, which will be limited only by appended claims.
[0035] The term about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, about can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term about meaning within an acceptable error range for the particular value should be assumed.
[0036] The terms polynucleotide, nucleic acid, and oligonucleotide are used interchangeably. As used herein, they generally refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown. Non-limiting examples of polynucleotides are coding or non-coding regions of a gene or gene fragment, intergenic DNA, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), small nucleolar RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, adapters, and primers. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
[0037] The terms polypeptide, peptide and protein are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. As used herein the term amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
[0038] A control is an alternative subject or sample used in an experiment for comparison purpose.
[0039] The terms subject, individual, and patient are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.
[0040] The terms determining, measuring, evaluating, assessing, assaying, detecting, and analyzing can be used interchangeably herein to refer to any form of measurement, and include determining if an element is present or not (for example, detection). These terms can include both quantitative and/or qualitative determinations. Assessing may be relative or absolute. Detecting the presence of can include determining the amount of something present, as well as determining whether it is present or absent.
[0041] Antibody is an immunoglobulin, or derivative or fragment or active fragment thereof, having an area on the surface or in a cavity which specifically binds to and is thereby defined as complementary with a particular spatial and polar organization of another molecule. The antibody can be monoclonal or polyclonal and can be prepared by techniques that are well known in the art such as, for example, immunization of a host and collection of sera or hybrid cell line technology.
Test Devices
[0042] In one aspect, the present disclosure provides for a test device for detecting one or more vitamin D molecules, comprising (a) a housing, contained therein: (i) a sample application unit configured to absorb a biological sample and transport said biological sample to a conjugate pad; (ii) said conjugate pad comprising a first antibody that specifically binds to one or more vitamin D molecules; (iii) a detection zone comprising a first region immobilized therein a second antibody that specifically binds to an immunocomplex, said immunocomplex comprising (a) said first antibody and (b) said one or more vitamin D molecules, or an epitope that is generated by complexing said first antibody and said one or more vitamin D molecules.
[0043] One or more vitamin D molecules refers to members of the group of fat-soluble secosteriods responsible for enhancing intestinal absorption of calcium, iron, magnesium, phosphate, and zinc. Exemplary members of this group are vitamin D.sub.1, vitamin D.sub.2, vitamin D.sub.3, vitamin D.sub.4, and hydroxylated versions thereof. Exemplary hydroxylated vitamin D molecules are 25-hydroxyvitamin D.sub.2 (25-OHD.sub.2 or 25-(OH)D.sub.2) and 25-hydroxyvitamin D.sub.3 (25-OHD.sub.3 or 25-(OH)D.sub.3). One or more vitamin D molecules can include vitamin D compounds with an additional hydroxy group attached at the 1- position, such as 1,25-hydroxyvitamin D.sub.3 (1,25-OHD.sub.3, or 1,25-(OH)D.sub.3).
[0044] The test device can be a lateral flow test device. A lateral flow device can comprise a housing, enclosed therein a test strip. A test strip can comprise a sample application unit, a conjugate pad, and/or a detection unit. A test strip can include one or more materials. If a test strip comprises more than one material, the one or more materials are preferably in fluid communication. One material of a test strip may be overlaid on another material of the test strip, such as for example, filter paper overlaid on nitrocellulose. Alternatively or in addition, a test strip may include a region comprising one or more materials followed by a region comprising one or more different materials. In this case, the regions are in fluid communication and may or may not partially overlap one another. Suitable materials for test strips include, but are not limited to, materials derived from cellulose, such as filter paper, chromatographic paper, nitrocellulose, and cellulose acetate, as well as materials made of glass fibers, nylon, polyethylene terephthalate, polyvinyl chloride, polyacrylamide, cross-linked dextran, agarose, polyacrylate, ceramic materials, and the like. The material or materials of the test strip may optionally be treated to modify their capillary flow characteristics or the characteristics of the applied sample. For example, the sample application region of the test strip may be treated with buffers to correct the pH or specific gravity of an applied urine sample, to ensure optimal test conditions.
[0045] The test strip material or materials can be a single structure such as a sheet cut into strips or it can be several strips or particulate material bound to a support or solid surface such as found, for example, in thin-layer chromatography and may have an absorbent pad either as an integral part or in liquid contact. The material can also be a sheet having lanes thereon, capable of spotting to induce lane formation, wherein a separate assay can be conducted in each lane. The material can have a rectangular, circular, oval, triagonal or other shape provided that there is at least one direction of traversal of a test solution by capillary migration. Other directions of traversal may occur such as in an oval or circular piece contacted in the center with the test solution. However, the main consideration is that there be at least one direction of flow to a predetermined site. In the following discussion strips will be described by way of illustration and not limitation.
[0046] The support for the test strip, where a support is desired or necessary, will generally be water insoluble, frequently non-porous and rigid but may be elastic, usually hydrophobic, and porous and usually will be of the same length and width as the strip but may be larger or smaller. The support material can be transparent, and, when a test device of the present invention is assembled, a transparent support material can be on the side of the test strip that can be viewed by the user, such that the transparent support material forms a protective layer over the test strip where it may be exposed to the external environment, such as by an aperture in the front of a test device. A wide variety of non-mobilizable and non-mobilizable materials, both natural and synthetic, and combinations thereof, may be employed provided only that the support does not interfere with the capillary action of the material or materials, or non-specifically bind assay components, or interfere with the signal producing system. Illustrative polymers include polyethylene, polypropylene, poly(4-methylbutene), polystyrene, polymethacrylate, poly(ethylene terephthalate), nylon, poly(vinyl butyrate), glass, ceramics, metals, and the like. Elastic supports may be made of polyurethane, neoprene, latex, silicone rubber and the like.
[0047] The test device can comprise a sample application aperture leading to the sample application unit. In some cases, sample application aperture can refer to the portion of a test device or test strip where where an opening in the test device provides access to the sample application unit of the test strip. In one embodiment of the present invention, a sample application aperture is created by an open-ended channel at the proximal end of the test device. Preferably, a test strip is engaged in the open-ended channel such that sample contacted with the sample application aperture is thereby applied to the test strip. In an alternate embodiment, a sample application aperture is formed by an opening in the front of a test device, such that the sample application unit of the test strip is in fluid communication with the exterior of the test device.
[0048] Sample application unit can be the portion of a test strip where sample can be applied. The sample application zone of a test strip of the present invention preferably occurs at the sample application aperture of a test device of the present invention, and is in fluid communication with the sample application aperture. In some cases, the sample application unit comprises a filtering component configured to remove particulate portions of a biological fluid, leaving only the aqueous component. Components for filtering out blood cells, for example, are described in WO2003014726 and WO2009069017, which are hereby incorporated by reference in their entirety.
[0049] Conjugate pad refers to a region of a test strip where reagent is provided, which can be referred to as a reagent zone. The conjugate pad can be a separate segment of bibulous or non-bibulous material included on the test strip, or it can be a region of a bibulous or non-bibulous material of a test strip that also includes other zones, such as an analyte detection zone. The reagent zone can carry a detection reagent, which may be a direct or indirect label. Preferably the detection reagent is provided in a form that is immobile in the dry state and mobile in the moist state. A reagent can be a specific binding member (e.g., an antibody), an analyte or analyte analog, an enzyme, a substrate, indicators, components of a signal producing system, chemicals or compounds such as buffering agents, reducing agents, chelators, surfactants, etc., that contribute to the function of the test strip assay.
[0050] In some cases, a label may be any molecule attached to a specific binding member that can produce a detectable signal. In the present invention, the label may be inert and provide a signal by concentrating in the detection zone, or it may serve solely as a binding site for a member of the signal producing system, or it may spontaneously produce a detectable signal or may produce a detectable signal in conjunction with a signal producing system. A label can be selected from the group consisting of gold particle, latex particle, carbon nanoparticles, selenium nanoparticles, silver nanoparticles, quantum dots, fluorescent compound, textile dyes, enzymes, and liposomes. The label can be gold particle. The label can be latex particle.
[0051] Specific binding member is one of two different molecules having an area on the surface or in a cavity which specifically binds to and is thereby defined as complementary with a particular spatial and polar organization of the other molecule. Specific binding members can be members of an immunological pair such as antigen-antibody, although other specific binding pairs such as ligand-carrier protein, biotin-avidin, hormone-hormone receptor, nucleic acid duplexes, IgG-protein A, DNA-DNA, DNA-RNA, and the like are not immunological pairs but are included in the definition. A specific binding member can be a binding agent.
[0052] A binding agent can be a molecule that complementarily binds one or more molecules. A binding agent can be a protein, a nucleic acid, a ligand, a receptor, or the like.
[0053] Exemplary proteins that are binding agents can include hemagglutinins, small molecule binding proteins, active or inactive enzymes or fragmented antibodies. Hemagglutinins can comprise antibodies or lectins. Antibodies can be of one or more classes of immunoglobulins (Ig). For instance, an antibody can be an IgA, IgD, IgE, IgG1, IgG2, IgG3, IgG4, IgM, IgW, or a modified variation thereof. Antibodies can be monoclonal or polyclonal. An antibody can be a humanized antibody, a chimeric antibody, or a bispecific antibody. Antibodies can comprise various types of binding regions. For instance, an antibody can have scFv, VH, Fab, or (Fab)2 binding regions. An antibody can comprise various modifications. For example, an antibody can be modified with one or more detection reagents. An antibody may be conjugated to another binding agent, oligonucleotide or protein.
[0054] A binding agent can be a fusion protein that incorporates various combinations of protein subunits. The combinations of protein subunits can be non-naturally occurring or naturally occurring. As a non-limiting example, a fusion protein can incorporate aspects of an antibody (e.g., an Fc region) and one or more receptor domains. A fusion protein can comprise two or more subunits. For example, a fusion protein can be a dimer, trimer, tetramer, or pentamer.
[0055] In one aspect of the present invention, one or more binding agents can be used to detect one or more vitamin D molecules. In an embodiment, a vitamin D binding agent specifically binds to one or more vitamin D molecules. A vitamin D binding agent can be a specific binding member. A vitamin D binding agent can be a specific binding member that is capable of binding to one or more vitamin D molecules. A vitamin D binding agent can be a first antibody, as referred to herein.
[0056] A detection agent can be used and may bind to a complex of the vitamin D binding agent and one or more vitamin D molecules. A detection agent can be used to detect one or more vitamin D molecules complexed with a vitamin D binding agent or a first antibody. The detection agent can be a detection antibody that specifically binds to a first complex of vitamin D binding agent and a vitamin D molecule. A detection agent can be a second antibody or a detection antibody, as referred to herein.
[0057] A third binding agent can be used that is capable of binding to a vitamin D binding agent whether or not the vitamin D binding agent is bound to the one or more vitamin D molecules.
[0058] A binding agent may comprise any of the amino acid sequences listed in Table 1 (SEQ ID Nos 1-20), or a combination thereof.
[0059] In some embodiments, a conjugate pad comprises a detection reagent, wherein the detection reagent is a first antibody that specifically binds to one or more vitamin D molecules. Vitamin D antibodies are known in the art. An exemplary vitamin D antibody, AF10, was produced as described in Example 1. Other antibodies capable of binding one or more vitamin D molecules are known in the art, such as those described in US20130059825, which is hereby incorporated by reference in its entirety.
[0060] A detection zone is a region of the test strip in which a dye as described above can be observed to shift location, appear, change color, or optionally to disappear. Detection or observation of the detection zone can be performed by any convenient means, depending upon the choice of detectable label. For example, detection or observation can be performed visually, fluorescently, by reflectance, radiographically, or any other means known the one of ordinary skill in the art.
[0061] A detection zone can comprise a first region, immobilized therein a detection agent or second antibody that specifically binds to an immunocomplex comprising (a) the first antibody (e.g., AF10) that specifically binds one or more vitamin D molecules and (b) one or more vitamin D molecules. In some cases, the detection agent or second antibody binds an epitope created when the complex of the vitamin D binding agent or first antibody and one or more vitamin D molecules is formed. For example, a second antibody can bind the junction between the one or more vitamin D molecules and the first antibody. In some cases, the binding of a vitamin D binding agent or first antibody to the one or more vitamin D molecules can cause the formation of an epitope on the vitamin D binding agent or the first antibody that is recognized by the detection agent or second antibody. In some cases the epitope formed upon the binding of one or more vitamin D molecules is not the binding site of the one or more vitamin D molecules, but an epitope at another site of the first antibody. In some cases, the second antibody can recognize the one or more vitamin D molecules when bound to the first antibody. The first region of the detection zone can provide a detectable signal indicating the presence of the analyte. The first region of the detection zone can include an immobilized binding reagent specific for an analyte (specific binding member), and/or an enzyme that reacts with the analyte. Other substances that may allow or enhance detection of the analyte, such as substrates, buffers, salts, may also be provided in the detection zone. One or more members of a signal producing system may be bound directly or indirectly to the detection zone. A detection zone can optionally include a second region comprising one or more control zones that provide indication that the test has been performed properly.
[0062] In some instances, the detection zone can further comprise a second region. This region can be a control region, immobilized therein a specific binding member that binds the first antibody whether or not it is bound to one or more vitamin D molecules. For example, the specific binding member can be a third antibody can bind the constant region of the first antibody. The third antibody can bind an epitope on the first antibody that is unchanged whether the one or more vitamin D molecules are bound or not. In some cases, the second region can be a control region, and the specific binding member immobilized therein can be protein A. In some cases, the conjugate pad comprises an additional antibody derived from a different species than the first antibody, wherein the additional antibody does not bind the first antibody, vitamin D, or vitamin D binding protein. In some cases, the second region is a control region, and the third antibody recognizes the additional antibody, but does not recognize the first antibody or second antibody. For example, if the first and second antibody are derived from mouse and rat, respectively, the additional antibody can be derived from chicken, and the third antibody can be goat anti-chicken, rat anti-chicken, etc.
[0063] Signal appearing in the second region can be used to indicate that the first antibody can be detected and that the test strip is functioning properly. The second region can be a region of a test strip in which a detectable label can be observed to shift location, appear, change color, or optionally to disappear. Detection or observation of the second region may be done by any convenient means, depending upon the particular choice of dye, especially, for example but not limited to, visually, fluorescently, by reflectance, radiographically, by a lateral flow reader and the like.
[0064] A biological sample is any material to be tested for the presence or amount of an analyte. Preferably, a biological sample is a fluid sample, preferably a liquid sample. Examples of liquid samples that may be tested using a test device of the present invention include bodily fluids including blood, serum, plasma, saliva, urine, ocular fluid, semen, perspiration, and spinal fluid. The biological sample can be blood or plasma. Viscous liquid, semi-solid, or solid specimens may be used to create liquid solutions, eluates, suspensions, or extracts that can be samples. For example, throat or genital swabs may be suspended in a liquid solution to make a sample.
[0065] An exemplary lateral flow assay is provided in
Methods
[0066] In one aspect, the present disclosure provides methods capable of detecting levels of one or more vitamin D molecules using test devices disclosed herein. The methods can comprise applying a biological sample to the sample application unit of a test device disclosed herein; applying a chase buffer to the sample application unit, and detecting levels of the one or more vitamin D molecules. Such detection can occur by visualizing signal appearing in the second region of the test device, such as by concentration of a labeled first antibody in a detection zone by a specific binding agent.
[0067] In some cases, methods further comprise quantifying the one or more vitamin D molecules in the sample. Quantification can be performed by determining a relationship between signal strength in the first region of the detection zone and the amount of analyte present in biological sample. It will be appreciated that the relationship between signal strength and the amount of analyte present in the biological sample may be determined for each batch or each test strip by the application of standards containing known amounts of one or more vitamin D molecules.
[0068] In some instances, the quantification will be semi-quantitative, such as by classifying a subject as having sufficient levels, insufficient levels, or deficient levels of one or more vitamin D molecules in the biological sample. Sufficient levels of vitamin D can be at least 10 ng/mL, at least 15 ng/mL, at least 20 ng/mL, at leat 25 ng/mL, at least 30 ng/mL, at least 35 ng/mL, at least 40 ng/mL, or at least 50 ng/mL. Insufficient levels of vitamin D can be at least 5 ng/mL and at most 45 ng/mL, at least 5 ng/mL and at most 40 ng/mL, at least 5 ng/mL and at most 35 ng/mL, at least 5 ng/mL and at most 30 ng/mL, at least 5 ng/mL and at most 25 ng/mL, at least 5 ng/mL and at most 20 ng/mL, at least 5 ng/mL and at most 15 ng/mL, at least 5 ng/mL and at most 10 ng/mL, at least 10 ng/mL and at most 45 ng/mL, at least 10 ng/mL and at most 40 ng/mL, at least 10 ng/mL and at most 35 ng/mL, at least 10 ng/mL and at most 30 ng/mL, at least 10 ng/mL and at most 25 ng/mL, at least 10 ng/mL and at most 20 ng/mL, at least 10 ng/mL and at most 15 ng/mL, at least 15 ng/mL and at most 45 ng/mL, at least 15 ng/mL and at most 40 ng/mL, at least 15 ng/mL and at most 35 ng/mL, at least 15 ng/mL and at most 30 ng/mL, at least 15 ng/mL and at most 25 ng/mL, at least 15 ng/mL and at most 20 ng/mL, at least 20 ng/mL and at most 45 ng/mL, at least 20 ng/mL and at most 40 ng/mL, at least 20 ng/mL and at most 35 ng/mL, at least 20 ng/mL and at most 30 ng/mL, at least 20 ng/mL and at most 25 ng/mL, at least 25 ng/mL and at most 45 ng/mL, at least 25 ng/mL and at most 40 ng/mL, at least 25 ng/mL and at most 35 ng/mL, at least 25 ng/mL and at most 30 ng/mL, at least 30 ng/mL and at most 45 ng/mL, at least 30 ng/mL and at most 40 ng/mL, at least 30 ng/mL and at most 35 ng/mL, at least 35 ng/mL and at most 45 ng/mL, at least 35 ng/mL and at most 40 ng/mL, at least 40 ng/mL and at most 45 ng/mL. Deficient levels of vitamin D can be at most 10 ng/mL, at most 15 ng/mL, at most 20 ng/mL, at leat 25 ng/mL, at most 30 ng/mL, at most 35 ng/mL, at most 40 ng/mL, or at most 50 ng/mL. For example, the subject may have greater than 30 ng/mL of one or more vitamin D molecules and be classified as having sufficient levels of one or more vitamin D molecules. For example, the subject may have between 10-30 ng/mL of one or more vitamin D molecules and be classified as having insufficient levels of one or more vitamin D molecules. For example, the subject may have less than 10 ng/mL of one or more vitamin D molecules and be classified as having deficient levels of one or more vitamin D molecules.
[0069] In some instances, quantifying further comprised using an imaging device to produce an image of the detection zone and software on a programmed computer configured to quantify the one or more vitamin D molecules in the biological sample based on the image of the detection zone. The image can be analyzed for signal strength. In some cases, signal strength is compared against the signal strength of the control region to normalize the image for variables such as light intensity, light quality, and variation between imaging devices.
[0070]
[0071] The computer system 701 includes a central processing unit (CPU, also processor and computer processor herein) 705, which can be a single core or multi core processor, or a plurality of processors for parallel processing. The computer system 701 also includes memory or memory location 710 (e.g., random-access memory, read-only memory, flash memory), electronic storage unit 715 (e.g., hard disk), communication interface 720 (e.g., network adapter) for communicating with one or more other systems, and peripheral devices 725, such as cache, other memory, data storage and/or electronic display adapters. The memory 710, storage unit 715, interface 720 and peripheral devices 725 are in communication with the CPU 705 through a communication bus (solid lines), such as a motherboard. The storage unit 715 can be a data storage unit (or data repository) for storing data. The computer system 701 can be operatively coupled to a computer network (network) 730 with the aid of the communication interface 720. The network 730 can be the Internet, an internet and/or extranet, or an intranet and/or extranet that is in communication with the Internet. The network 730 in some cases is a telecommunication and/or data network. The network 730 can include one or more computer servers, which can enable distributed computing, such as cloud computing. The network 730, in some cases with the aid of the computer system 701, can implement a peer-to-peer network, which may enable devices coupled to the computer system 701 to behave as a client or a server.
[0072] The CPU 705 can execute a sequence of machine-readable instructions, which can be embodied in a program or software. The instructions may be stored in a memory location, such as the memory 710. The instructions can be directed to the CPU 705, which can subsequently program or otherwise configure the CPU 705 to implement methods of the present disclosure. Examples of operations performed by the CPU 705 can include fetch, decode, execute, and writeback.
[0073] The CPU 705 can be part of a circuit, such as an integrated circuit. One or more other components of the system 701 can be included in the circuit. In some cases, the circuit is an application specific integrated circuit (ASIC).
[0074] The storage unit 715 can store files, such as drivers, libraries and saved programs. The storage unit 715 can store user data, e.g., user preferences and user programs. The computer system 701 in some cases can include one or more additional data storage units that are external to the computer system 701, such as located on a remote server that is in communication with the computer system 701 through an intranet or the Internet.
[0075] The computer system 701 can communicate with one or more remote computer systems through the network 730. For instance, the computer system 701 can communicate with a remote computer system of a user (e.g., patient, healthcare provider, or service provider). Examples of remote computer systems include personal computers (e.g., portable PC), slate or tablet PC's (e.g., Apple iPad, Samsung Galaxy Tab), telephones, Smart phones (e.g., Apple iPhone, Android-enabled device, Blackberry), or personal digital assistants. The user can access the computer system 701 via the network 730.
[0076] Methods as described herein can be implemented by way of machine (e.g., computer processor) executable code stored on an electronic storage location of the computer system 701, such as, for example, on the memory 710 or electronic storage unit 715. The memory 710 can be part of a database. The machine executable or machine readable code can be provided in the form of software. During use, the code can be executed by the processor 705. In some cases, the code can be retrieved from the storage unit 715 and stored on the memory 710 for ready access by the processor 705. In some situations, the electronic storage unit 715 can be precluded, and machine-executable instructions are stored on memory 710.
[0077] The code can be pre-compiled and configured for use with a machine having a processer adapted to execute the code, or can be compiled during runtime. The code can be supplied in a programming language that can be selected to enable the code to execute in a pre-compiled or as-compiled fashion.
[0078] Aspects of the systems and methods provided herein, such as the computer system 701, can be embodied in programming. Various aspects of the technology may be thought of as products or articles of manufacture typically in the form of machine (or processor) executable code and/or associated data that is carried on or embodied in a type of machine readable medium. Machine-executable code can be stored on an electronic storage unit, such as memory (e.g., read-only memory, random-access memory, flash memory) or a hard disk. Storage type media can include any or all of the tangible memory of the computers, processors or the like, or associated modules thereof, such as various semiconductor memories, tape drives, disk drives and the like, which may provide non-transitory storage at any time for the software programming. All or portions of the software may at times be communicated through the Internet or various other telecommunication networks. Such communications, for example, may enable loading of the software from one computer or processor into another, for example, from a management server or host computer into the computer platform of an application server. Thus, another type of media that may bear the software elements includes optical, electrical and electromagnetic waves, such as used across physical interfaces between local devices, through wired and optical landline networks and over various air-links. The physical elements that carry such waves, such as wired or wireless links, optical links or the like, also may be considered as media bearing the software. As used herein, unless restricted to non-transitory, tangible storage media, terms such as computer or machine readable medium refer to any medium that participates in providing instructions to a processor for execution.
[0079] Hence, a machine readable medium, such as computer-executable code, may take many forms, including but not limited to, a tangible storage medium, a carrier wave medium or physical transmission medium. Non-volatile storage media include, for example, optical or magnetic disks, such as any of the storage devices in any computer(s) or the like, such as may be used to implement the databases, etc. shown in the drawings. Volatile storage media include dynamic memory, such as main memory of such a computer platform. Tangible transmission media include coaxial cables; copper wire and fiber optics, including the wires that comprise a bus within a computer system. Carrier-wave transmission media may take the form of electric or electromagnetic signals, or acoustic or light waves such as those generated during radio frequency (RF) and infrared (IR) data communications. Common forms of computer-readable media therefore include for example: a floppy disk, a flexible disk, hard disk, magnetic tape, any other magnetic medium, a CD-ROM, DVD or DVD-ROM, any other optical medium, punch cards paper tape, any other physical storage medium with patterns of holes, a RAM, a ROM, a PROM and EPROM, a FLASH-EPROM, any other memory chip or cartridge, a carrier wave transporting data or instructions, cables or links transporting such a carrier wave, or any other medium from which a computer may read programming code and/or data. Many of these forms of computer readable media may be involved in carrying one or more sequences of one or more instructions to a processor for execution.
[0080] The computer system 701 can include or be in communication with an electronic display 735 that comprises a user interface (UI) 740 for providing, for example, genetic information, such as an identification of disease-causing alleles in single individuals or groups of individuals. Examples of UI's include, without limitation, a graphical user interface (GUI) and web-based user interface (or web interface).
[0081] A chase buffer may be used to detect one or more vitamin D molecules. The chase buffer can be configured comprise reagents to dissociate the one or more vitamin D molecules from vitamin D binding protein and/or albumin. Non-limiting examples of reagents to dissociate the one or more vitamin D molecules are acidic solution, alkaline solution, 8-anilino-1-napthalenesulfonic acid, 3-(acetonylbenzyl)-4-hydroxycoumarin, alkyl amino fluoro surfactants, perfluorhexanoic acid, perfluoroctanoic acid, proteinase K, urea, and guanidine hydrochloride. For example, the chase buffer can be an acidic solution or an alkaline solution, as described in WO2004063704, which is hereby incorporated by reference in its entirety. In another, the chase buffer can rely on the competitive displacement of Vitamin D from endogenous binding proteins using 8-anilino-1-napthalenesulfonic acid and/or 3-(acetonylbenzyl)-4-hydroxycoumarin, as described in U.S. Pat. No. 7,482,162, which is hereby incorporated by reference in its entirety.
[0082] Chase buffer can, for example, be a reagent with a pH from 3.8 to 4.8 and 5-30% DMSO, a liquid organic amide and optionally 0.5-5% of a short chain alcohol, such as described in WO2007039194, which is hereby incorporated by reference in its entirety. Chase buffer can comprise stabilizing agents and capture ligands, including alkyl amino fluoro surfactants as described in WO2008039266, which is hereby incorporated by reference in its entirety.
Kits
[0083] In one aspect, the present disclosure provides kits capable of detecting levels of one or more vitamin D molecules comprising test devices disclosed herein and written instructions for the use of the kit. In some instances, kits can further comprise one or more components selected from the group consisting of a sterilization agent, a device to puncture skin, gauze, chase buffer, and a micropipette.
[0084] A sterilization agent can be, for example, an alcohol wipe capable of disinfecting human skin.
[0085] A device to puncture the skin can be a small, sharp object capable of penetrating the skin of the subject to produce a small volume of blood. The device to puncture the skin can be selected from the group consisting of a lancet, a needle, and a syringe. The lancet can, for example, be spring-powered.
[0086] Chase buffer can comprise reagents for dissociating one or more vitamin D molecules from vitamin D binding protein, as described previously.
[0087] A micropipette can provide a known volume of biological sample to the device.
[0088] The kit can further comprise a color chart relating signal strength to a quantity of said one or more vitamin D molecules in a sample. Due to potential batch-to-batch variability, the color chart can be generated empirically for each batch of test devices by running standards containing known amounts of one or more vitamin D molecules and determining the colors corresponding to different ranges of amounts of one or more vitamin D molecules in the biological sample.
EXAMPLES
Example 1
Generation of Monoclonal Antibody to 25-(OH)D
[0089] Monoclonal antibodies against 25-(OH)D were prepared by a modified method of Kohler and Milstein (G. Kohler and C. Milstein Nature, 1975, 256, 495). Mice were immunized by subcutaneous injection of 25-(OH)D conjugated at its 3-position to carrier protein KHL. The complete Freund's adjuvant was injected with the antigen. The incomplete Freund's adjuvant was used for antigen boosts. The immune response was monitored by ELISA against 25-(OH)D.sub.3. After four to five antigen boosts, the spleen cells were harvested and fused with myeloma cells in the presence of polyethylene glycol (PEG). The fused cells were seeded in 96-well plates and grown in the presence of selective hypoxanthine, aminopterin and thymidine (HAT) medium. The supernatants from the fused cells were tested by ELISA for binding activity to 25-(OH)D.sub.3 and 25-(OH)D.sub.2. The clone AF10, which has a high affinity for binding both 25-(OH)D.sub.3 and 25-(OH)D.sub.2, was selected for large scale of antibody production and purification.
Example 2
Generation of a Monoclonal Antibody Against an Immunocomplex of 25-(OH)D and mAb From Immunized Mice
[0090] Mice were immunized by subcutaneous injection of 25-(OH)D conjugated at its 26-position to carrier protein keyhole limpet hemocyanin (KLH). The complete Freund's adjuvant was injected with antigen. KLH conjugate and the incomplete Freund's adjuvant was used for the first and third boosts, and the immunocomplex of 25-(OH)D:antibody AF10 was used for the second and fourth boosts. The immune response was monitored by ELISA assay to the immunocomplex of 25-(OH)D:antibody AF10. After 4 boosts, the spleen cells were harvested. The RNA from the spleen cells was then isolated and variable gene amplification was performed.
[0091] The mRNA was isolated by using Dynabeads mRNA Purification Kit (ThermoFisher) according to the manufacturer's protocol. Subsequently, first strand cDNA was generated using Superscript II reverse transcriptase (Invitrogen, Carlsbad, Calif.). From the cDNA, heavy and light chain variable genes were amplified separately by PCR using primer sets for mouse VH, VK and VX, as described according to Phage Display: A Laboratory Manual (Cold Spring Harbor Laboratory Press). Heavy and light chain variable region genes were further amplified by PCR to add partial sequence of (G53).sub.4 linker to the 3 VH and 5 VL. In the third PCR reaction, an equal amount of second round amplified VH and VL DNA was mixed for single-chain variable fragment (scFv) assembly. The final scFv DNA was purified with Qiagen PCR purification column (QIAGEN Inc., Germany). The purified scFv DNA and PCANTAB5 vector DNA were digested with restriction enzymes Ncol and Notl (New England Lab) and then size-selected by 1% agarose gel. Excised bands were purified with the QlAquick Gel Extraction Kit. Digested scFv, vector DNA and T4 ligase (New England Lab) were mixed for overnight ligation at 16 C. 20 g of ligated DNA was purified and transformed into E coli TG1 competent cells by electroporation. After transformation, TG1 cells were suspended into SOC medium and incubated for 1 h at 37 C. and 250 rpm shaking. The TG1 cells were plated on 2YT-agar plates containing 100 g/ml of carbenicillin and 2% glucose. Following overnight 30 C. incubation, the TG1 transformants were harvested into 2YT containing 15% glycerol, 100 g/ml of carbenicillin and 2% glucose, and the library aliquots were kept at 80 C. for storage. This procedure resulted in a library size of 1.210.sup.9 colonies.
[0092] Phage displayed library was prepared as follows. 200 mL 2YT medium (with 100 g/ml of carbenicillin and 2% glucose) was inoculated with library TG1 cells at starting OD 0.1. After 3-4 hours of incubation at 37 C. with 250 rpm shaking, KO7 helper phage was added at a 1:10 ratio of cells to phage, and the culture was incubated at 37 C. for 1 hour without sharking. The TG1 cells were centrifuged and the cell pellet was re-suspended into 2 L of 2YT with 100 g/ml carbenicillin and 35 g/ml Kanamycin, followed by overnight incubation at 30 C. with 250 rpm sharking. TGlcells were then centrifuged for 30 minutes at 6000g at 4 C. The library phage particles were purified by PEG-precipitation from culture supernatant, resuspended into phosphate-buffered saline (PBS) and titered by OD268 measurement. The phage display antibody library was stored at -80 C. in PBS with 20% glycerol.
[0093] Immunocomplex-specific antibodies were selected from the above mouse scFv phage display library by the following selection procedure. The microtiter well was coated with 1 g of mAb AF10 overnight at 4 C. After 2 hour blocking with lx chemiblocker (EMD Millipore), 1 g of 25-(OH)D.sub.3 was added to each well for overnight incubation at 4 C. The well was washed 3 times with PBS and blocked with 1 chemiblocker for 1 hour at room temperature. Prior to performing affinity selection against the immunocomplex of 25-(OH)D:antibody AF10, 400 l of the phage library solution (a total of 1,012 phage particles) was pre-incubated in a well containing antibody AF10 without vitamin D for 2 hours at room temperature, after which the unbound phages were transferred into 4 wells with the immunocomplex of 25-(OH)D:antibody AF10 for 2 hour incubation at room temperature. The unbound phages were removed and the well was washed 10 times with PBS-Tween. Bound phages were eluted with 100 l of 100 mM HCl for 10 minutes, and eluted phages were harvested and neutralized with 10% 1 M Tris-HCl. The eluted phages were then added to 10 mL of fresh TG1 cells (0D6000.8) for 1 hour incubation at 37 C. Infected TG1 cells were plated on two 2YT plates with carbenicillin and glucose for overnight growth, and overnight cells were harvested for first round phage preparation as described above. The affinity selection procedure was performed on these second round phages as just described. A total of three rounds of affinity selection were performed.
[0094] The infected TG1 colonies from the third round of affinity selection were picked for expression of scFv-p3 fusion and confirmation of binding activity. Briefly, isolated TG colonies were picked into 96 well plates (5 plates and a total of 480 colonies) with 100 l of 2YT/carbenicillin and glucose, and incubated overnight at 30 C. The second day, 10 l of culture per well was transferred into a corresponding well in a 96-well deep plate containing 500 l per well 2YT medium containing carbenicillin and 0.1% Glucose. The deep-well plates were incubated in a 37 C. shaker incubator shaking at 250 rpm until the cultures reach OD600 of 0.8-1. 100 l of 2YT containing 6 mM IPTG was then added to each well and the expression plate was incubated overnight at 30 C. shaking at 250 rpm. 160 L of lysis buffer containing 2.5 mg/mL lysozyme and 5 mM EDTA were then added to each well of the expression plate, and the cultures were shaken for 1 h at room temperature. The culture supernatant was mixed with 140 l 2 ChemiBlocker per well and incubated for an additional 30 min while shaking at 250 rpm. The culture supernatants were centrifuged and prepared for binding assay as below.
[0095] To screen for the clones capable of binding the immunocomplex of 25-(OH)D:antibody AF10, two 96-well assay plates were prepared for each expression plate, one plate coated with AF10 antibody only, the other coated with the immunocomplex of 25-(OH)D:antibody AF10. The assay plates were blocked with lx ChemiBlocker for 2 hours at room temperature. The culture supernatants from the expression plate were transferred to the corresponding well of the assay plate. After 1 hour incubation at room temperature and three PBS-Tween washes, 100 L of mouse anti-M13 p3 antibody (New England Lab) was added to each well for 1 hour incubation at room temperature. The samples were washed three times with PBS-Tween, and 100 L of horse radish peroxidase (HRP)-conjugated goat anti-mouse IgG was added to each well for 1 hour incubation. The samples were washed three times with PBS-Tween, and 100 L of substrate 3,3,5,5-Tetramethylbenzidine (TMB) was added to each well. The OD630 was measured after 10-30 minutes development. The clones that bound to the immunocomplex of 25-(OH)D:antibody AF10, but not AF10 antibody alone, were selected for confirmation. The positive culture supernatants were serially diluted in a 1:3 ratio and were assayed again following the above procedure.
[0096] A light chain can comprise a sequence selected from the group consisting of SEQ ID NOs 1-5, and 16-20. A heavy chain can comprise a sequence selected from the group consisting of SEQ ID NOs 6-15. In some instances, the light chain can comprise a sequence sharing at least 80% sequence homology to a sequence selected from the group consisting of SEQ ID NOs 1-5, and 16-20. In some instances, the heavy chain can comprise a sequence having least 80% sequence homology to a sequence selected from the group consisting of SEQ ID NOs 6-15.
[0097] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 6 and a light chain of SEQ ID NO 20.
[0098] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 7 and a light chain of SEQ ID NO 20.
[0099] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 8 and a light chain of SEQ ID NO 20.
[0100] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 9 and a light chain of SEQ ID NO 20.
[0101] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID
[0102] NO 1, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 10 and a light chain of SEQ ID NO 20.
[0103] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 11 and a light chain of SEQ ID NO 20.
[0104] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 12 and a light chain of SEQ ID NO 20.
[0105] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 13 and a light chain of SEQ ID NO 20.
[0106] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 14 and a light chain of SEQ ID NO 20.
[0107] An antibody may comprise light chain CDR and said heavy chain CDR with any of the following amino acid sequences: a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 1, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 2, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 3, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 4, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 5, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 16, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 17, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 18, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 19, a heavy chain of SEQ ID NO 15 and a light chain of SEQ ID NO 20.
TABLE-US-00001 TABLE1 Exemplaryheavyandlightchainvariableregions SequenceNo. Aminoacidsequences 1 DIQMTQSPAIMSASPGEKVTITCSASSSVSYMHWYQQKSGTSPK LWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQ RSSYPYTFGGGTKLEIK 2 DIVLTQSQKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQS PKALIYSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFC QQHYSTPYTFGGGTKLEIK 3 DIVLTQSPASLAVSLGQRATISCRASKSVSTSGYSYMHWYQQKP GQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAAT YYCQQSNEDPFTFGSGTKLELK 4 DIVLTQSPSSLSASLGERVSLTCRASQDIGSSLNWLQQEPDGTIKR LIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCQQHG ESPLTFGAGTKLEIK 5 DIVMTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQS PKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFC QQYASSPYTFGGGTKLEIK 6 EVQLQQSGAELAKPGASVKMSCKASGYTFTSYWMHWVKQRPG QGLEWIGYINPSTGYTEYNQKFKDKATLTADKSSSTAYMQLSSL TSEDSVVYYCARQDGYYVGYFDYWGQGTTLTVSS 7 EVELQESGAELVRPGASVKLSCKASGYSFTNYWMNWVRQRPG QGFEWIGEINPSNGDTFYNQKFKGKATLIVDKSSSTAYMELLSLT SEDSAVYYCARIGGYYFDYWGQGTTLTVSS 8 EVNVVESGAELVKPGASVRLSCTTSGFNIEDSYIHWVKQRPEQG LEWIGRIDPANGNIKSDPKFQGKATISADTSSNTAYLQLSSLTSED TAVYYCLYYYDSSDYWGQGTTLTVSS 9 EVKLVESGPELEKPGASVKISCKASGYSFTGYNMNWVKQSNGK SLEWIGNIDPYYGGTSYNQKFKGKATLTVDKSSSTAYMQLKSLT SEDSAVYYCARWSYYGNYVYWYFDVWGAGTTLTVSS 10 EVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQ GLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTS EDTAVYYCARSYYFDYWGQGTTLTVSS 11 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYTVNWVRQAPGK GLEWLSVISGDGSNTYYADSVKGRFTISRDNSKNTLYLQMNSLR AEDTAVYYCAKALNAGWGFDYWGQGTLVTVSS 12 QVQLLESGGGLVKPGGSLRLSCAASGFTFSGSAMHWVRQAPGK GMEWVSAISGSGGSTYYADSMKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYCARNGYTDGYGMDYWGQGTLVTVSS 13 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDSSVNWVRQAPGK GLEWLAVISGDGGSTYYADSVKGRVTISRDNSKNTLYLQMNSL RAEDTAVYYCARAIFPSYMDVWGQGTLVTVSS 14 EVQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVDWVRQARGQ RLEWIGWIVVGSGNTSYAQKFQERVTITRDMSTSTAYMELSSLR SEDTAVYYCAKSVTYYYMDHWGQGTLVTVSS 15 QVQLVQSGAEVKKPGSSVKVSCKASGGTFNSYAISWVRQAPGQ GLEWMGVIIGIFGTATYAQSVQGRVTITADESTSTAYMELSSLRS EDTAVYYCARSGRYSRSFDVWGQGTLVTVSS 16 EIVLTQSPGTLSLSPGERATLSCRANRLVSSSMLAWYQQKPGQA PRLLIGASKRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCAQ YDGSSYTFGQGTKLEIKR 17 QSVLTQPPSVSGSPGQRVTISCTGNNLSGYYVSWYQQLPGTAPK LLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAMDEADYYCA AYYSGTYVFGQGTKLTVLGQ 18 SYELTQPLSVSVSLGQTARITCWDNVGGYNVHWYQQKPGQSPV LVIYRDSERPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCSSY YQSTVLFGGGTKLTVLGQ 19 DIQMTQSPSSLSASVGDRVTITCQASNVGGNYLNWYQQKPGKA PKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCS AYHQSTYTFGQGTKVEIKR 20 DIQMTQSPSSLSASVGDRVTITCRASKVGSSYVNWYQQKPGKAP KLLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCAS YYSTSTFGGGTKVEIKR
Example 3
Generation of a Monoclonal Antibody to the Immunocomplex of 25-(OH)D:mAB From a Synthetic Library
[0108] The synthetic antibody library was designed based on the natural VH/VL pairing frequency (described in Protein Engineering, Design & Selection pp. 1-7, 2012 doi:10.1093/protein/gzs043), the frameworks of frequently paired human VH1, VH3, VK1, VK3, V1, VX2 and V3 were selected as master genes for gene synthesis. The selected master genes were synthesized by PCR assembly of overlapping oligos. The length of oligos was between 60 and 80 bases, and the oligos for all CDRs were degenerate oligos using the nucleotides NNS and/or MVS to randomize amino acid residues. After the first round of PCR assembly, 5 light chain master genes were assembled with a light chain constant region by PCR. The resulting full-length light chain genes were digested with restriction enzymes HindIIII and Ncol (New England Lab) and size-selected on a 1% agarose gel. The size-selected fragments were purified and extracted with the QlAquick Gel Extraction Kit. Digested light chain genes, pAXD20 vector DNA, and T4 ligase (New England Lab) were mixed and ligation was allowed to proceed overnight at 16 C. For each light chain gene construct, 20 g of ligated DNA was purified and transformed into E coli TOP10 competent cells by electroporation. Transformants were then grown on 100 2YT-agar plates containing 100m/m1 of carbenicillin and 2% glucose. After overnight 30 C. incubation, library transformants were harvested and suspended in 2YT with 15% glycerol. Half of the stock was stored as library aliquots at 80 C., and the rest was processed by Qiagen Maxiprep kit. The resulted library size is listed in Table 2. The DNA of AFK1 and AFk3 were combined, and AFL1, AFL2 and AFL3were also combined for the next step of heavy chain cloning.
TABLE-US-00002 TABLE 2 Characteristics of light chain libraries Library Library size AFK1 1.1 10.sup.9 AFK3 1.2 10.sup.9 AFL1 8.5 10.sup.8 AFL2 7.6 10.sup.8 AFL3 8 10.sup.8
[0109] PCR assembled VH1 and VH3 master genes were further assembled with CH1 constant region by PCR, the resulting Fd genes were digested with restriction enzymes NcoI and SalI (New England BioLab) and size-selected by 1% agarose gel. The size-selected fragment was purified and extracted with the QIAquick Gel Extraction Kit. Digested Fd genes, light chain library DNA and T4 ligase (New England Lab) were mixed and ligation was allowed to proceed overnight at 16 C. For each Fd chain gene library, 40 g of ligated DNA was purified and transformed into E. coli TG1 competent cells by electroporation. Transformants were then grown on 400 2YT-agar plates containing 100 g/ml of carbenicillin and 2% glucose. After overnight 30 C. incubation, library transformants were harvested and suspended in 2YT with 15% glycerol. Library aliquots were prepared and stored at -80 C. The resulting library sizes are listed in Table 3.
TABLE-US-00003 TABLE 3 Characteristics of phage display libraries Library Library size AFH1K 3.6 10.sup.9 AFH3K 3.3 10.sup.9 AFH1L 3.5 10.sup.9 AFH3L 3.2 10.sup.9 Total 1.4 10.sup.10
[0110] Phage display libraries were prepared in the following manner. A 500 2YT (with 100 g/ml of carbenicillin and 2% glucose) culture was inoculated with library TG1 cells at a starting OD of 0.1. After 3-4 hours incubation at 37 C. with 250 rpm shaking, KO7 helper phage was added in a 1:10 ratio. The culture was then incubated at 37 C. for 1 hour without shaking. The TG1 cells were centrifuged and the cell pellet was re-suspended into 2 L of 2YT containing 100 g/ml carbenicillin and 35 g/ml Kanamycin for overnight incubation at 30 C. with 250 rpm shaking. TGlcells were then centrifuged for 30 min at 6000 g at 4 C. The library phage particles were purified by PEG-precipitation from culture supernatants, resuspended into PBS and titered by OD268 measurement. The phage display antibody library was stored at -80 C. in PBS with 20% glycerol. Each library was prepared separately and kept separately.
[0111] The procedure to select immunocomplex-specific antibodies is similar to the description in the Example 2. Briefly, two kinds of microtiter wells were prepared, one coated with AF10 antibody only, and the second with the immunocomplex of 25-(OH)D.sub.3:AF10. Before affinity selection, the individual library was pre-incubated in AF10-only wells for to deplete for phages that bind AF10 alone. The supernatant is then transferred to the microtiter wells coated with the immunocomplex of 25-(OH)D.sub.3:AF10. In the first round affinity selection, a total of eight wells were used, and each library phage was added to two wells. In the second round of affinity selection, the phages from first round were mixed and 4 wells were used for incubation. A total of three rounds of affinity selection were performed.
[0112] The colonies from the third round of affinity selection were picked for expression of p3 fusion and confirmation of binding activity. The procedure is similar to that described in Example 2. Briefly, five 96-well plates and a total of 480 colonies were picked to make master plates. During the second day, 10 l of culture per well was transferred into a corresponding well in a 96-well deep-well expression plate. The deep-well plates were incubated in a 37 C. shaker incubator with shaking at 250 rpm until the cultures reach OD600nm of 0.8-1. 100 l of 2YT containing 6 mM IPTG was added to each well, and the expression plate was incubated overnight at 30 C. while shaking at 250 rpm. 160 l of lysis buffer containing 2.5 mg/ml lysozyme and 5 mM EDTA was added to each well of the expression plate, and the plate was incubated with shaking for 1 hour at room temperature. The culture supernatant was mixed with 140 l 2 ChemiBlocker per well and incubated for an additional 30 min at 250 rpm. The culture supernatants were centrifuged and prepared for binding assay as below.
[0113] The ELISA screening procedure was similar to that described in Example 2. Briefly, for each expression plate, two 96-well assay plates were prepared, one plate coated with AF10 antibody only, and the second with the immunocomplex of 25-(OH)D.sub.3:AF10. The culture supernatants from the expression plate were transferred to the corresponding well of the assay plate. After 1 hour incubation at room temperature, the samples were washed three times with PBS-Tween. 100 l of HRP-conjugated anti-Fab antibody (Jackson ImmunoReaearch Lab, USA) were added to each well for 1 hour incubation at room temperature. After 3 times wash with PBS-Tween, 100 l of substrate TMB was added to each well for 10-30 min development, and 50 l of stop solution was added. OD450 was then measured. The clones that bound to the immunocomplex of 25-(OH)D.sub.3:AF10 but not AF10 antibody alone were selected for confirmation. 1:3 serial dilutions of the positive culture supernatants were assayed following above procedure.
Example 4
Recombinant Antibody Expression and Purification
[0114] For recombinant Fab expression, VH and VL gens were cloned into E. coli expression vector pEx. For each individual clone, 20 ml overnight cultures were prepared in 2YT with 2% glucose and 100 g/ml Carbenicillin and incubated in a 37 C. shaker incubator. The next day, 700 mL of 2YT containing 0.1% glucose and 100m/mL Carbenicillin was inoculated in a 2L Ultra yield flask (Thomson Instrument Company) by transferring 7 ml of the overnight culture. The cultures were grown at 35 C. with 280 rpm shaking for approximately 2-3 hours until OD600 was 0.8. Then 350 l of 1M IPTG was added to the culture for overnight induction at 22 C. with 280 rpm shaking. The cells pellets were collected by centrifugation at 7500g for 20 minutes, and resuspended into lysis buffer containing 1 mg/ml lysozyme and 5 mM EDTA for 1 hour incubation at room temperature. The supernatant with soluble Fab was collected by centrifuging twice at 15,000 rpm 25000g at 4 C. . The supernatant was then loaded onto a 5 ml protein-G column (GE healthcare) for Fab binding and washed wash with 50 ml PBS. Fab protein was then eluted with 0.3M acetic acid, pH3 buffer. The eluted fractions were collected, and neutralized with 0.5 volumes of 1M Tris-HCl, pH8.5 buffer. The Fab samples were buffer-exchanged to PBS, and concentrated to a concentration of 3-5 mg/ml. The Fab samples were stored at 80 C.
[0115] For IgG expression, the heavy chain variable domains and light chain variable domains were cloned into a cytomegalovirus promoter-based mammalian expression vectors PMX30 and pMX31, respectively. The heavy chain and light chain vector DNA was mixed in a ratio of 1:3 and transiently transfected into a 30 ml suspension HEK293 cells in serum-free medium. After 20 hours, cells were sampled to determine viability and viable cell count, and titer was measured (Octet QKe, ForteBio). The cultures were harvested at day 5, and an additional sample for each was measured to determine cell density, viability, and titer. The conditioned media containing IgG was harvested and clarified from the transient transfection production by centrifugation and filtration. The supernatant was run over a Protein A column and eluted with a low pH buffer (pH=3). Filtration using a 0.2 m membrane filter was performed before aliquoting. After purification and filtration, the protein concentration was calculated based on the OD280 and the extinction coefficient. Generally, 1-5 mg of IgG was generated from this procedure.
Example 5
Sandwich ELISA Assay for Serum 25-(OH)D Measurement
[0116] A monoclonal antibody to the immunocomplex of 25-(OH)D:AF10 were used to prepare a sandwich based ELISA assay. Free 25-(OH)D.sub.3 was used for the assay. Briefly, 100 L/well of AF10 antibody (3 g/ml in PBS) was used to coat the microtiter plate overnight at 4 C.
[0117] The assay plates were washed with PBS and blocked with lx ChemiBlocker for 2 hours at room temperature. 5 L/well of 25-(OH)D.sub.3 at concentration of 0.5-50 ng/ml was added to the plate, and 200 L of anti-imunocomplex antibody at 3 g/ml was added thereafter. After 1 hour incubation at room temperature, the plate was washed 3 times with PBS-Tween, and 100 l of HRP-conjugated goat anti-mouse antibody (Jackson ImmunoReaearch Lab, USA) was added to each well for a 30-minutes incubation at room temperature. After washing three times with PBS-Tween, 100 l of substrate TMB was added to each well for a 30-minute development. 50 L of stop solution was added, and OD450 was measured. This data showed a dose-dependent response and served as proof -of-concept for a sandwich ELISA for 25-(OH)D detection. To further confirm the utility of the assay for clinical sample detection, patient serum samples with 25-(OH)D values (as determined by ADVIA Centaur VitaminD Total assay, Siemens) were measured using the sandwich ELISA assay. The assay was performed as for the free 25-(OH)D.sub.3, except that to each well 200 L of CalBiotech release buffer (Calbiotech, California, USA) containing 3 g/ml of the monoclonal antibody to the immunocomplex of 25-(OH)D:AF 10 was added, followed by 5 l of the serum sample. After mixing, the plate was incubated at room temperature for 1.5 hours.
Example 6
Lateral Flow Assay for 25-(OH)D Measurement
[0118] An exemplary lateral flow device comprises a sample application unit (e.g., from Ahlstrom or Millipore) for sample transportation, a conjugate pad comprising labeled antibody and a detection zone comprising immobilized capture reagents and an absorbent pad (e.g., from Ahlstrom or Millipore).
[0119] Dry conjugate pad was prepared as follows. A 0.04% colloidal solution was prepared by reducing gold chloride with sodium citrate at boiling temperature. 25 g of anti-25-(OH)D antibody was added to 1 ml of 0.04% colloidal solution and incubated at room temperature for 30 minutes. The conjugate was then centrifuged for 20 min at 10000 rpm. The supernatant was then decanted, and the pellet suspended in 1 mL of 15 mM phosphate buffer, pH 7.4. A similar procedure was performed to prepare the conjugate of colloidal gold-anti-chicken IgG antibody used for the positive control. The anti-25-(OH)D conjugate and the anti-chicken IgG conjugate were mixed with conjugate pad base in a 1:10 ratio. 10 ml of the conjugate pad base mixture was applied to a piece of 8 cm8 cm fiberglass sheet, and vacuum dried at room temperature for 4 hours. The pad was stored with desiccant in a dry room.
[0120] To prepare the detection membrane, the monoclonal antibody to the immunocomplex of 25-(OH)D:AF10 was prepared in 15 mM phosphate buffer at pH 7.4 at the range of concentration of 0.2-1.5 mg/ml as the test line solution. The test line solution was dispensed on to nitrocellulose membrane (Millipore 125 or GE AE99) at an amount between 0.6-1.0 L/cm. Similarly, the control line solution with anti-chicken IgG was dispensed onto the nitrocellulose membrane at the control line position. The membrane was then allowed to air-dry in an environment with less than 30% humidity for one hour, and then stored with desiccant in a dry room.
[0121] In order to construct the test device, the detection membrane, conjugate pad, and sample wicking materials were aligned and the assembled strip was placed into plastic housing.
[0122] The device was evaluated by using serum or blood samples with known 25-(OH)D concentrations. 5 L of serum or 10 L of capillary blood was applied to the sample pad, followed by 3 drops (100 L) of sample chase buffer. The test line and control line were read after 15 min. The results, shown in
TABLE-US-00004 TABLE 4 Comparison of measurements using lateral flow test device and ADVIA Centaur VitD Assay ADVIA Centaur VitD Lateral flow test results (Semi- Assay Quantitative) 25-(OH)D VitD Patient # Patient ID ng/mL 25-(OH)D ng/mL Sufficiency 1 03928913 4.2 <10 Deficient 2 03928920 4.2 <10 Deficient 3 1023110935 9 10 Deficient 4 1023110936 10 10 Deficient 5 1023110968 10 10 Deficient 6 1023110755 10 10 Deficient 7 1023110768 10 10 Deficient 8 1022110849 11 10 Deficient 9 1023110943 11 10 Deficient 10 1023110949 11 10 Deficient 11 1023110957 19.4 20 Insufficient 12 1023110763 20 20 Insufficient 13 1023110788 20 20 Insufficient 14 1023110831 20 20 Insufficient 15 1023110866 20 20 Insufficient 16 1023110876 20 20 Insufficient 17 1023110958 20 20 Insufficient 18 1023110743 21 20 Insufficient 19 1022110782 29 30 Sufficient 20 1022110783 29 30 Sufficient 21 1022110784 30 30 Sufficient 22 1022110863 30 30 Sufficient 23 1023110910 30 30 Sufficient 24 1023110813 29.1 30 Sufficient 25 10411110254 32.7 30 Sufficient 26 10411110267 33.5 30 Sufficient 27 10052015WK 42 >30 Sufficient 28 10052015JA 41 >30 Sufficient 29 1120834 67 >>30 Sufficient 30 1124761 80 >>30 Sufficient 31 1123647 97 >>30 Sufficient
[0123] Furthermore, a smartphone-based reader was used for quantitative detection of vitamin D levels in capillary blood samples. 10 l of capillary blood was applied to the sample pad, followed by 3 drops (100 l) of sample chase buffer. The test lines were read after 15 minutes. The serum samples of corresponding individuals were collected and subjected to an ELISA test.
Example 7
Lateral Flow Assay for 25-(OH)D Measurement Using Cube-Reader
[0124] The Cube-Reader (from opTricon GmbH, Germany) was used for fully quantitative measurement of 25-OH vitamin D. Cube-Reader is a portable lateral flow assay reader, with a cube-shape at an edge length of approximate 41 mm and weigh of 40 g. The measurement procedure is shown in
[0125] Total 20 human serum samples with 25-OH Vitamin D values determined by Liquid Chromatography Mass Spectrometry (LC-MS/MS) assay were applied to lateral flow test. The measurement procedure is described in the Example 6. The results listed in Table 5 show that the 25-OH vitamin D values from lateral flow test are very close to the true values generated from LC-MS/MS assay (a gold standard method for 25-OH vitamin D measurement).
TABLE-US-00005 TABLE 5 Test Results from Lateral Flow Test and Liquid Chromatography Mass Spectrometry Test 25-OH Vitamin D Sample (ng/ml) 25-OH Vitamin D (ng/ml) ID LC-MS/MS test Lateral flow test S-1 14.3 14.4 S-2 14.0 16.0 S-3 18.9 19.9 S-4 19.8 19.1 S-5 20.0 22.4 S-6 26.4 22.1 S-7 29.3 31.0 S-8 40.1 37.2 S-9 40.3 47.4 S-10 45.9 51.8 S-11 46.4 39.2 S-12 49.0 42.6 S-13 56.3 57.4 S-14 60.3 72.7 S-15 63.1 67.8 S-16 75.5 71.2 S-17 87.4 85.9 S-18 92.3 97.9 S-19 92.4 94.4 S-20 103.9 93.1 Average 49.8 50.2
The comparison of 25-OH vitamin D values between lateral flow test and LC-MS/MS assay yield a linear regression Y=0.98+1.49, with correlation coefficient of 0.98. The comparison result is illustrated in the
[0126] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.