METHODS OF IDENTIFYING AND TREATING IMMUNE CHECKPOINT INHIBITOR-RESPONSIVE NEOPLASMS AND CELLS, TRANSGENIC ANIMALS AND KITS FOR USE THEREIN
20190085404 ยท 2019-03-21
Inventors
Cpc classification
A01K67/0275
HUMAN NECESSITIES
C12N15/1138
CHEMISTRY; METALLURGY
G01N2800/52
PHYSICS
C12Q2600/106
CHEMISTRY; METALLURGY
International classification
Abstract
Provided are methods of identifying whether a subject having cancer will be responsive to agents that combat immune evasion, such as immune checkpoint inhibitors. Methods of treating a subject having cancer are also provided. Such methods may include those that involve identifying whether the cancer will be responsive to an immune checkpoint inhibitor and/or is an immune-evasive cancer and administering an agent, e.g., an immune checkpoint inhibitor and/or a MYC inhibitor, to the subject to treat the cancer. Also provided are methods of identifying cancer therapeutics that are effective during MYC-regulated immune evasion as well as cancer cell lines and transgenic animals useful in such methods. Kits for use in the described methods are also provided.
Claims
1. A method of identifying whether a subject having a cancer will be responsive to an immune checkpoint inhibitor, the method comprising: (a) determining whether a cellular sample from the cancer overexpresses a MYC oncogene; and (b) identifying the subject as (i) responsive to the immune checkpoint inhibitor when the determining indicates that the cancer overexpresses the MYC oncogene or (ii) as nonresponsive to the immune checkpoint inhibitor when the determining indicates that the cancer does not overexpress the MYC oncogene.
2. The method according to claim 1, wherein the immune checkpoint inhibitor is selected from the group consisting of: a CD47 inhibitor, a SIRP inhibitor, a PD-L1 inhibitor and a PD1 inhibitor.
3. The method according to claim 1, wherein the method further comprises measuring the level of expression of the MYC oncogene in the cellular sample.
4. The method according to claim 3, wherein the level of expression comprises an mRNA expression level or a protein expression level.
5. The method according to claim 1, wherein the cancer is selected from the group consisting of: a lymphoma/leukemia, a carcinoma and a melanoma.
6. A method of treating a subject for a cancer, the method comprising: (a) identifying whether the cancer will be responsive to an immune checkpoint inhibitor according to claim 1; and (b) administering an effective amount of an agent to the subject to treat the cancer, wherein when the cancer is identified as responsive the agent is the immune checkpoint inhibitor.
7. A method of treating a subject for an immune-evasive cancer, the method comprising: (a) determining whether a cellular sample of the immune-evasive cancer obtained from the subject overexpresses CD47, PD-L1 or both; and (b) administering an effective amount of an agent to the subject to treat the immune-evasive cancer, wherein when the cellular sample is determined to overexpress CD47, PD-L1 or both the agent is a MYC inhibitor.
8. The method according to claim 7, wherein the MYC inhibitor is a bromodomain and extra-terminal (BET) inhibitor.
9. The method according to claim 8, wherein the BET inhibitor is JQ1 or an analog thereof.
10-12. (canceled)
13. A cancer cell comprising: (a) an inducible MYC locus comprising a MYC encoding nucleic acid sequence operably linked to a transcriptional response element; and (b) a MYC-independent constitutively active locus comprising an immune checkpoint protein encoding nucleic acid sequence operably linked to a constitutively active promoter.
14. A transgenic non-human mammal comprising the cancer cell according to claim 13.
15. A kit for performing the method according to claim 6, the kit comprising: a reagent for measuring the expression of MYC in the cellular sample from the subject; and the immune checkpoint inhibitor.
16. The cancer cell according to claim 13, wherein the immune checkpoint protein is CD47 or PD-L1.
17. A method of identifying a therapeutic agent that is effective during MYC-regulated immune evasion of a cancer cell, the method comprising: (a) contacting (i) a first tumor cell line conditionally expressing a MYC oncogene and (ii) a second tumor cell line comprising the cancer cell according to claim 13 with a candidate therapeutic agent; (b) determining the effect of the contacting on a behavior of the contacted conditional tumor cell lines; (c) identifying the candidate agent as a therapeutic agent that is effective during MYC-regulated immune evasion of a cancer cell if the determined behavior of the first conditional tumor cell line (i) is reduced as compared to a non-contacted control and the determined behavior of the second conditional tumor cell line (ii) is not reduced as compared to a non-contacted control.
18. The method according to claim 17, wherein the behavior comprises cell line expansion or cell line survival.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0007] The invention is best understood from the following detailed description when read in conjunction with the accompanying drawings. It is emphasized that, according to common practice, the various features of the drawings are not to-scale. On the contrary, the dimensions of the various features are arbitrarily expanded or reduced for clarity. Included in the drawings are the following figures.
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
DEFINITIONS
[0035] The terms specific binding, specifically binds, and the like, refer to non-covalent or covalent preferential binding to a molecule relative to other molecules or moieties in a solution or reaction mixture (e.g., an antibody specifically binds to a particular polypeptide or epitope relative to other available polypeptides). In some embodiments, the affinity of one molecule for another molecule to which it specifically binds is characterized by a K.sub.D (dissociation constant) of 10.sup.5 M or less (e.g., 10.sup.6 M or less, 10.sup.7 M or less, 10.sup.8 M or less, 10.sup.3 M or less, 10.sup.10 M or less, 10.sup.11 M or less, 10.sup.12 M or less, 10.sup.13 M or less, 10.sup.14 M or less, 10.sup.15 M or less, or 10.sup.16 M or less). Affinity refers to the strength of binding, increased binding affinity being correlated with a lower K.sub.D.
[0036] The terms antibody and immunoglobulin, as used herein, are used interchangeably may generally refer to whole or intact molecules or fragments thereof and modified and/or conjugated antibodies or fragments thereof that have been modified and/or conjugated. The immunoglobulins can be divided into five different classes, based on differences in the amino acid sequences in the constant region of the heavy chains. All immunoglobulins within a given class will have very similar heavy chain constant regions. These differences can be detected by sequence studies or more commonly by serological means (i.e. by the use of antibodies directed to these differences). Immunoglobulin classes include IgG (Gamma heavy chains), IgM (Mu heavy chains), IgA (Alpha heavy chains), IgD (Delta heavy chains), and IgE (Epsilon heavy chains).
[0037] Antibody or immunoglobulin may refer to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four inter-connected by disulfide bonds. The structure of immunoglobulins has been well characterized, see for instance Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)). Briefly, each heavy chain typically is comprised of a heavy chain variable region (abbreviated as V.sub.H) and a heavy chain constant region (abbreviated as C.sub.H). The heavy chain constant region typically is comprised of three domains, C.sub.H1, C.sub.H2, and C.sub.H3. Each light chain typically is comprised of a light chain variable region (abbreviated as V.sub.L) and a light chain constant region (abbreviated herein as C.sub.L). The light chain constant region typically is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
[0038] Whole or largely intact antibodies are generally multivalent, meaning they may simultaneously bind more than one molecule of antigen whereas antibody fragments may be monovalent. Antibodies produced by an organism as part of an immune response are generally monospecific, meaning they generally bind a single species of antigen. Multivalent monospecific antibodies, i.e. antibodies that bind more than one molecule of a single species of antigen, may bind a single antigen epitope (e.g., a monoclonal antibody) or multiple different antigen epitopes (e.g., a polyclonal antibody).
[0039] Multispecific (e.g., bispecific) antibodies, which bind multiple species of antigen, may be readily engineered by those of ordinary skill in the art and, thus, may be encompassed within the use of the term antibody used herein where appropriate. Also, multivalent antibody fragments may be engineered, e.g., by the linking of two monovalent antibody fragments. As such, bivalent and/or multivalent antibody fragments may be encompassed within the use of the term antibody, where appropriate, as the ordinary skilled artisan will be readily aware of antibody fragments, e.g., those described below, which may be linked in any convenient and appropriate combination to generate multivalent monospecific or polyspecific (e.g., bispecific) antibody fragments.
[0040] Antibody fragments include but are not limited to antigen-binding fragments (Fab or F(ab), including Fab or F(ab), (Fab).sub.2, F(ab).sub.2, etc.), single chain variable fragments (scFv or Fv), third generation (3G) molecules, etc. which are capable of binding the epitopic determinant. These antibody fragments retain some ability to selectively bind to the subject antigen, examples of which include, but are not limited to:
[0041] (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain;
[0042] (2) Fab, the fragment of an antibody molecule can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab fragments are obtained per antibody molecule;
[0043] (3) (Fab).sub.2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction;
[0044] (4) F(ab).sub.2 is a dimer of two Fab fragments held together by two disulfide bonds;
[0045] (5) Fv, defined as a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains;
[0046] (6) Single chain antibody (SCA), defined as a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule; such single chain antibodies may be in the form of multimers such as diabodies, triabodies, tetrabodies, etc. which may or may not be polyspecific (see, for example, WO 94/07921 and WO 98/44001) and
[0047] (7) 3G, including single domain (typically a variable heavy domain devoid of a light chain) and miniaturized antibody molecules (typically a full-sized Ab or mAb in which non-essential domains have been removed).
[0048] The term small molecule is used to refer to molecules, whether naturally-occurring or artificially created (e.g., via chemical synthesis) that have a relatively low molecular weight. Typically, a small molecule is an organic compound (i.e., it contains carbon). The small molecule may contain multiple carbon-carbon bonds, stereocenters, and other functional groups (e.g., amines, hydroxyl, carbonyls, heterocyclic rings, etc.). In some embodiments, small molecules are monomeric and have a molecular weight of less than about 1500 g/mol. In certain embodiments, the molecular weight of the small molecule is less than about 1000 g/mol or less than about 500 g/mol. In certain embodiments, small molecules are biologically active in that they produce a biological effect in animals, e.g., mammals, e.g., humans.
[0049] The terms treatment, treating, treat and the like are used herein to generally refer to obtaining a desired pharmacologic and/or physiologic effect. The effect can be prophylactic in terms of completely or partially preventing a disease or symptom(s) thereof and/or may be therapeutic in terms of a partial or complete stabilization or cure for a disease and/or adverse effect attributable to the disease. The term treatment encompasses any treatment of a disease in a mammal, particularly a human, and includes: (a) preventing the disease and/or symptom(s) from occurring in a subject who may be predisposed to the disease or symptom(s) but has not yet been diagnosed as having it; (b) inhibiting the disease and/or symptom(s), i.e., arresting development of a disease and/or the associated symptoms; or (c) relieving the disease and the associated symptom(s), i.e., causing regression of the disease and/or symptom(s). Those in need of treatment can include those already inflicted (e.g., those with cancer, e.g. those having tumors) as well as those in which prevention is desired (e.g., those with increased susceptibility to cancer; those with cancer; those suspected of having cancer; etc.).
[0050] The terms recipient, individual, subject, host, and patient, are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired, particularly humans. Mammal for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, sheep, goats, pigs, camels, etc. In some embodiments, the mammal is human.
[0051] The terms co-administration and in combination with include the administration of two or more therapeutic agents either simultaneously, concurrently or sequentially within no specific time limits. In one embodiment, the agents are present in the cell or in the subjects body at the same time or exert their biological or therapeutic effect at the same time. In one embodiment, the therapeutic agents are in the same composition or unit dosage form. In other embodiments, the therapeutic agents are in separate compositions or unit dosage forms. In certain embodiments, a first agent can be administered prior to (e.g., minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapeutic agent.
[0052] A therapeutically effective amount, a therapeutically effective dose or therapeutic dose is an amount sufficient to effect desired clinical results (i.e., achieve therapeutic efficacy, achieve a desired therapeutic response, etc.). A therapeutically effective dose can be administered in one or more administrations. For purposes of this disclosure, a therapeutically effective dose of an agent that inhibits a target gene (e.g., a MYC-dependent target gene, and the like) and/or compositions is an amount that is sufficient, when administered to the individual, to palliate, ameliorate, stabilize, reverse, prevent, slow or delay the progression of the disease state (e.g., cancer, etc.) by, for example, inhibiting the growth of, inducing death of or otherwise preventing the clinical progressing of a MYC-dependent cancer present in the subject.
DETAILED DESCRIPTION
[0053] Provided are methods of identifying whether a subject having cancer will be responsive to agents that combat immune evasion, such as immune checkpoint inhibitors. Methods of treating a subject having cancer are also provided. Such methods may include those that involve identifying whether the cancer will be responsive to an immune checkpoint inhibitor and/or is an immune-evasive cancer and administering an agent, e.g., an immune checkpoint inhibitor and/or a MYC inhibitor, to the subject to treat the cancer. Also provided are methods of identifying cancer therapeutics that are effective during MYC-regulated immune evasion as well as cancer cell lines and transgenic animals useful in such methods. Kits for use in the described methods are also provided.
[0054] Before the present methods and compositions are described, it is to be understood that this invention is not limited to particular method or composition described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0055] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0056] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.
[0057] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
[0058] It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a cell includes a plurality of such cells and reference to the peptide includes reference to one or more peptides and equivalents thereof, e.g. polypeptides, known to those skilled in the art, and so forth.
[0059] The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed
Methods
[0060] As summarized above, methods are provided for identifying whether a subject having a neoplasm will be responsive to agents that combat immune evasion, such as immune checkpoint inhibitors. Such methods may include determining whether a cellular sample from the neoplasm overexpresses a MYC oncogene, where the overexpression of the MYC oncogene in the sample is indicative that the neoplasm is an immune checkpoint inhibitor responsive neoplasm. Such methods may include identifying a subject as responsive (or likely to be responsive) to treatment with an immune checkpoint inhibitor based on detected over expression of MYC within a cellular sample of a neoplasm from the subject. Similarly, the methods may include identifying a subject as non-responsive (or unlikely to be responsive) to treatment with an immune checkpoint inhibitor based on a detected level of MYC expression within a cellular sample of a neoplasm from the subject that does not amount to over expression.
[0061] By overexpresses a MYC oncogene is generally meant that a cell or a population of cells expresses MYC above a known (i.e., predetermined) level, e.g., threshold level or a normal level. MYC overexpression may include expression of a MYC encoding mRNA above a predetermined level, expression of a MYC protein above a predetermined level or a combination thereof. A predetermined level of MYC, above which a cell or a population of cells may be identified as overexpressing MYC, includes e.g., a normal level of MYC expression.
[0062] Predetermined and/or normal levels of MYC expression may be obtained through a variety of means. For example, in some instances, a predetermined level of MYC expression may be obtained from a cell known not to overexpress MYC, whether or not the cell is neoplastic, or from a population of cells known not to overexpress MYC, whether or not the population is neoplastic. In some instances, a predetermined level of MYC expression may be obtained from a cell known to overexpress MYC, whether or not the cell is neoplastic, or from a population of cells known to overexpress MYC, whether or not the population is neoplastic. Cells known to overexpress MYC or known not to overexpress MYC may include, e.g., those cells where MYC expression is controlled by an inducible and/or conditional expression system and the system is in an ON or OFF state, respectively. For example, a level of MYC expression measured from a cell know not to overexpress MYC, such as e.g., a cell with inducible/conditional MYC expression where MYC is off, may be used to establish a threshold above which a cell is considered to overexpress MYC. In some instances, a level of MYC expression measured from a cell know to overexpress MYC, such as e.g., a cell with inducible/conditional MYC expression where MYC is on, may be used to establish a threshold below which a cell is considered not to overexpress MYC.
[0063] In some instances, a predetermined or a normal level of MYC expression may be obtained from a cell known not to be a neoplastic cell or from a population of cells known not to be a neoplastic population of cells. For example, in some instances, a cell expressing a normal level of MYC or a population of cells expressing a normal level of MYC may include a non-neoplastic cell that does not overexpress MYC or a population of non-neoplastic cells that does not overexpress MYC. In some instances, a cell expressing a normal level of MYC or a population of cells expressing a normal level of MYC may include a neoplastic cell that does not overexpress MYC or a population of neoplastic cells that does not overexpress MYC. Normal levels of MYC expression, whether in neoplastic or non-neoplastic cells, may also be referred to as baseline expression levels. Neoplastic cells, and populations thereof, that do not overexpress MYC include but are not limited to e.g., neoplastic cells obtained from cancers not driven by MYC (i.e., non-MYC driven cancers); neoplastic cells where MYC, MYC activity and/or MYC signaling has or has not been disrupted; and the like. Cells with known and/or predetermined levels of MYC expression, including normal levels and overexpression levels, may be referred to as a control or control cells (e.g., including positive and negative controls), where control cells may, but need not necessarily, be the same or an equivalent cell type to cells under examination to which they are compared.
[0064] Levels of MYC expression in cells that do not overexpress MYC may be employed to establish a threshold for MYC expression above which a cell or a population of cells may be identified as MYC overexpressing. Such thresholds may be absolute or relative. Non-limiting examples of relative MYC expression thresholds above which a cell or a population of cells may be identified as overexpressing MYC include 1.1 times normal or control MYC expression or greater, including e.g., 1.2 times or greater, 1.3 times or greater, 1.4 times or greater, 1.5 times or greater, 1.6 times or greater, 1.7 times or greater, 1.8 times or greater, 1.9 times or greater, 2.0 times or greater, 2.1 times or greater, 2.2 times or greater, 2.3 times or greater, 2.4 times or greater, 2.5 times or greater, 2.6 times or greater, 2.7 times or greater, 2.8 times or greater, 2.9 times or greater, 3.0 times or greater, 3.5 times or greater, 4 times or greater, 4.5 times or greater, 5 times or greater, 6 times or greater, 7 times or greater, 8 times or greater, 9 times or greater, 10 times or greater, etc.
[0065] Levels of MYC expression in cells that overexpress MYC may be employed to establish a threshold for MYC expression below which a cell or a population of cells may be identified as not MYC overexpressing. Such thresholds may be absolute or relative. Non-limiting examples of relative MYC expression thresholds below which a cell or a population of cells may be identified as not overexpressing MYC include 0.9 times the level of MYC overexpression or less, including e.g., 0.8 times or less, 0.7 times or less, 0.6 times or less, 0.5 times or less, 0.4 times or less, 0.3 times or less, 0.2 times or less, 0.1 times or less, etc.
[0066] Relative levels of MYC expression, including protein levels and/or mRNA levels, may be determined through the use of various qualitative or quantitative methods including but not limited to e.g., differential expression microarray analysis, semi-quantitative PCR, quantitative PCR (qPCR), next generation sequencing (NGS), immuno-assays, fluorescence activated cell sorting (FACS), mass spectrometry, and the like. Absolute levels of MYC expression, including protein and/or mRNA, may be determined through the use of various quantitative methods including but not limited to e.g., qPCR, quantitative NGS, quantitative mass spectrometry, and the like.
[0067] Accordingly, the provided methods may include measuring the level of expression of a MYC oncogene in a cellular sample obtained from a subject and/or measuring the level of expression of a MYC oncogene in a cell of the cellular sample, wherein the measuring may be performed by any convenient method of measuring expression. Useful methods of measuring MYC oncogene expression include methods of measuring MYC encoding mRNA and/or MYC protein levels including but not limited to e.g., those methods of measuring mRNA and/or protein levels described above.
[0068] Determining the level of expression of MYC may also, in some instance, include measuring the level of expression of one or more MYC target genes. For example, in some instances, MYC overexpression may be inferred from the level of expression, overexpression or elevated expression of a MYC target gene. By MYC target gene is meant a gene, the expression of which is regulated (induced or inhibited) by the MYC transcription factor. Non-limiting examples of MYC target genes include PDK1, CHEK1, CDK2, LDHA, and ODC1.
[0069] MYC (also referred to as Myc oncogene protein or Myc proto-oncogene protein) is a transcription factor encoded by the c-Myc gene that regulates the expression of a multitude of gene products involved in cell proliferation, growth, differentiation, and apoptosis. The c-Myc gene is genetically activated and overexpressed in many cancers and this overexpression has been causally linked to tumorigenesis.
[0070] In humans, c-Myc (NCBI Gene ID: 4609) is present on chromosome 8 at 8q24.21. Human MYC protein (GenBank Accession No. NP_002458.2; UniProt P01106) has the following amino acid sequence:
TABLE-US-00001 (SEQ ID NO: 1) MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGD NDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAA SECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSP EPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCA.
[0071] In mice, c-Myc (NCBI Gene ID: 17869) is present on chromosome 15 at 15 D1 (15 26.19 cM). Mouse MYC protein (GenBank Accession Nos. NP_001170823.1, NP_001170824.1, NP_001170825.1, NP_034979.3; UniProt P01108) has the following amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 2) MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIW KKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQL EMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKL ASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPL NDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSS DSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDT EENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKAT AYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA.
[0072] In rats (Rattus norvegicus), c-Myc (NCBI Gene ID: 24577) is present on chromosome 7 at 7q33. Rat MYC protein (GenBank Accession No. NP_036735.2; UniProt P09416) has the following amino acid sequence:
TABLE-US-00003 (SEQ ID NO: 3) MNFLWEVENPTVTTMPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQ QSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPRED DDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAA SECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSSSSDSLLSSESSPRATPE PLVLHEETPPTTSSDSEEEQDDEEEIDVVSVEKRQPPAKRSESGSSPSRG HSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQI SNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELEN NEKAPKVVILKKATAYILSVQADEHKLISEKDLLRKRREQLKHKLEQLRN SGA.
[0073] As summarized above, the provided methods may identify whether a subject having a neoplasia will be responsive to an immune checkpoint inhibitor based on whether a sample of the neoplasia overexpresses MYC. Without being bound by theory, the subject method takes advantage of the discovery that MYC regulates the expression of immune checkpoint proteins in cancer cells. MYC expression was found to be directly correlated with the expression of immune checkpoint genes such that MYC overexpression resulted in high levels of expression of immune checkpoint proteins.
[0074] By immune checkpoint protein is generally meant a protein that regulates one or more immune cell stimulatory or inhibitory pathways. Inhibitory immune checkpoint proteins prevent activation of the immune cell in response to, e.g., an antigen expressed on the target cell. Immune checkpoints are crucial for maintaining self-tolerance and modulating the duration and amplitude of physiological immune responses in order to minimize collateral tissue damage. Inhibitory immune checkpoint proteins may be expressed by cancer cells to evade recognition and/or destruction by the host immune system. Accordingly, inhibitory immune checkpoint proteins may be expressed on the surface of a cell to render the cell capable of evading the host immune system, termed immune evasion. For example, a cancer cell may express an inhibitory immune checkpoint protein, thus signaling to a host immune cell through the immune checkpoint protein thereby repressing immune recognition, activation of the immune cell and/or phagocytosis.
[0075] Examples of inhibitory immune checkpoint protein ligands (and their relevant immune cell receptor) include but are not limited to e.g., PD-L1 (PD1); PD-L2 (PD1); CD80 (CLTA4, also known as CD152); CD86 (CLTA4); GAL9 (TIM3); HVEM (BTLA, also known as CD272); B7-H3, also known as CD276; B7-H4, also known as VTCN1; CD47, also known as IAP (SIRP); CD200, also known as OX-2 (CD200R); and the like. Such inhibitory immune checkpoint proteins are described in e.g., Pardoll. Nat Rev Cancer. 2012; 12(4):252-64; Liu et al. Nat Med. 2015; 21(10):1209-15; Liu et al. J Hematol Oncol. 2017; 10(1):12; ledziska et al. Mol Oncol. 2015; 9(10):1936-65; the disclosures of which are incorporated by reference herein in their entirety.
[0076] In the provided methods a determination that a cellular sample, or a cell therefrom, overexpresses a MYC oncogene indicates that the subject is likely to respond to treatment with an inhibitor of an immune checkpoint protein. For example, in some instances, a determination that a cellular sample, or a cell therefrom, overexpresses a MYC oncogene indicates that the subject is likely to respond to an inhibitor of the immune checkpoint protein CD47 or an agent that inhibits the expression of CD47. In some instances, a determination that a cellular sample, or a cell therefrom, overexpresses a MYC oncogene indicates that the subject is likely to respond to an inhibitor of the immune checkpoint protein PD-L1 or an agent that inhibits the expression of PD-L1.
[0077] Accordingly, in some embodiments, the provided methods may include administering to a subject an effective amount of one or more immune checkpoint inhibitors when the subject is identified as having a neoplasm that overexpresses MYC. In some embodiments, following a determination that the subject harbors a neoplasm that overexpresses MYC, the subject may be administered an effective amount of a CD47 inhibitor. In some embodiments, following a determination that the subject harbors a neoplasm that overexpresses MYC, the subject may be administered an effective amount of a PD-L1 inhibitor. In some embodiments, following a determination that the subject harbors a neoplasm that overexpresses MYC, the subject may be administered effective amounts of two or more immune checkpoint inhibitors. In some embodiments, following a determination that the subject harbors a neoplasm that overexpresses MYC, the subject may be administered effective amounts of both a CD47 inhibitor and a PD-L1 inhibitor. Useful immune checkpoint inhibitors are described greater detail below.
[0078] In some instances, where a cellular sample, or a cell therefrom, from a subject's neoplasm is determined not to overexpress MYC the subject may not be administered an immune checkpoint inhibitor or further evaluation may be indicated before the subject is administered an immune checkpoint inhibitor. For example, where a cellular sample of a neoplasm from a subject is determined to not overexpress MYC the sample and/or the neoplasm may be subjected to further testing to determine if the subject is likely or unlikely to be responsive to the immune checkpoint inhibitor. In some instances, a cellular sample found to not overexpress MYC may be further tested for expression of one or more immune checkpoint proteins (e.g., PD-L1, CD47, etc.) prior to administering an immune checkpoint inhibitor (e.g., a PD-L1 inhibitor, a CD47 inhibitor, etc.) to the subject. In some embodiments, if the non-MYC-overexpressing neoplasm from the subject is determined to express an inhibitory immune checkpoint protein, only then will the subject be administered an immune checkpoint inhibitor directed at the expressed inhibitory immune checkpoint protein. In instances, where a non-MYC-overexpressing neoplasm from the subject is determined to not express an inhibitory immune checkpoint protein, then other treatment options may be explored, e.g., conventional cancer therapy (e.g., surgery, radiation therapy, chemotherapy, etc.) or immunotherapy directed to targets other than inhibitory immune checkpoint proteins (e.g., adoptive T cell immunotherapy, etc.).
[0079] The provided methods may find use with subjects having a variety of different neoplasms, including but not limited to cancers. Relevant cancers include tumors (e.g., solid tumors (e.g., sarcomas and carcinomas) and blood cancers. Non-limited examples of various cancers to which the subject methods may be applied include: Acute Lymphoblastic Leukemia (ALL), Acute Myeloid Leukemia (AML), Adrenocortical Carcinoma, AIDS-Related Cancers (e.g., Kaposi Sarcoma, Lymphoma, etc.), Anal Cancer, Appendix Cancer, Astrocytomas, Atypical Teratoid/Rhabdoid Tumor, Basal Cell Carcinoma, Bile Duct Cancer (Extrahepatic), Bladder Cancer, Bone Cancer (e.g., Ewing Sarcoma, Osteosarcoma and Malignant Fibrous Histiocytoma, etc.), Brain Stem Glioma, Brain Tumors (e.g., Astrocytomas, Central Nervous System Embryonal Tumors, Central Nervous System Germ Cell Tumors, Craniopharyngioma, Ependymoma, etc.), Breast Cancer (e.g., female breast cancer, male breast cancer, childhood breast cancer, etc.), Bronchial Tumors, Burkitt Lymphoma, Carcinoid Tumor (e.g., Childhood, Gastrointestinal, etc.), Carcinoma of Unknown Primary, Cardiac (Heart) Tumors, Central Nervous System (e.g., Atypical Teratoid/Rhabdoid Tumor, Embryonal Tumors, Germ Cell Tumor, Lymphoma, etc.), Cervical Cancer, Childhood Cancers, Chordoma, Chronic Lymphocytic Leukemia (CLL), Chronic Myelogenous Leukemia (CML), Chronic Myeloproliferative Neoplasms, Colon Cancer, Colorectal Cancer, Craniopharyngioma, Cutaneous T-Cell Lymphoma, Duct (e.g., Bile Duct, Extrahepatic, etc.), Ductal Carcinoma In Situ (DCIS), Embryonal Tumors, Endometrial Cancer, Ependymoma, Esophageal Cancer, Esthesioneuroblastoma, Ewing Sarcoma, Extracranial Germ Cell Tumor, Extragonadal Germ Cell Tumor, Extrahepatic Bile Duct Cancer, Eye Cancer (e.g., Intraocular Melanoma, Retinoblastoma, etc.), Fibrous Histiocytoma of Bone (e.g., Malignant, Osteosarcoma, etc.), Gallbladder Cancer, Gastric (Stomach) Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Stromal Tumors (GIST), Germ Cell Tumor (e.g., Extracranial, Extragonadal, Ovarian, Testicular, etc.), Gestational Trophoblastic Disease, Glioma, Hairy Cell Leukemia, Head and Neck Cancer, Heart Cancer, Hepatocellular (Liver) Cancer, Histiocytosis (e.g., Langerhans Cell, etc.), Hodgkin Lymphoma, Hypopharyngeal Cancer, Intraocular Melanoma, Islet Cell Tumors (e.g., Pancreatic Neuroendocrine Tumors, etc.), Kaposi Sarcoma, Kidney Cancer (e.g., Renal Cell, Wilms Tumor, Childhood Kidney Tumors, etc.), Langerhans Cell Histiocytosis, Laryngeal Cancer, Leukemia (e.g., Acute Lymphoblastic (ALL), Acute Myeloid (AML), Chronic Lymphocytic (CLL), Chronic Myelogenous (CML), Hairy Cell, etc.), Lip and Oral Cavity Cancer, Liver Cancer (Primary), Lobular Carcinoma In Situ (LCIS), Lung Cancer (e.g., Non-Small Cell, Small Cell, etc.), Lymphoma (e.g., AIDS-Related, Burkitt, Cutaneous T-Cell, Hodgkin, Non-Hodgkin, Primary Central Nervous System (CNS), etc.), Macroglobulinemia (e.g., Waldenstrm, etc.), Male Breast Cancer, Malignant Fibrous Histiocytoma of Bone and Osteosarcoma, Melanoma, Merkel Cell Carcinoma, Mesothelioma, Metastatic Squamous Neck Cancer with Occult Primary, Midline Tract Carcinoma Involving NUT Gene, Mouth Cancer, Multiple Endocrine Neoplasia Syndromes, Multiple Myeloma/Plasma Cell Neoplasm, Mycosis Fungoides, Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Neoplasms, Myelogenous Leukemia (e.g., Chronic (CML), etc.), Myeloid Leukemia (e.g., Acute (AML), etc.), Myeloproliferative Neoplasms (e.g., Chronic, etc.), Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin Lymphoma, Non-Small Cell Lung Cancer, Oral Cancer, Oral Cavity Cancer (e.g., Lip, etc.), Oropharyngeal Cancer, Osteosarcoma and Malignant Fibrous Histiocytoma of Bone, Ovarian Cancer (e.g., Epithelial, Germ Cell Tumor, Low Malignant Potential Tumor, etc.), Pancreatic Cancer, Pancreatic Neuroendocrine Tumors (Islet Cell Tumors), Papillomatosis, Paraganglioma, Paranasal Sinus and Nasal Cavity Cancer, Parathyroid Cancer, Penile Cancer, Pharyngeal Cancer, Pheochromocytoma, Pituitary Tumor, Pleuropulmonary Blastoma, Primary Central Nervous System (CNS) Lymphoma, Prostate Cancer, Rectal Cancer, Renal Cell (Kidney) Cancer, Renal Pelvis and Ureter, Transitional Cell Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoma (e.g., Ewing, Kaposi, Osteosarcoma, Rhabdomyosarcoma, Soft Tissue, Uterine, etc.), Szary Syndrome, Skin Cancer (e.g., Childhood, Melanoma, Merkel Cell Carcinoma, Nonmelanoma, etc.), Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Squamous Cell Carcinoma, Squamous Neck Cancer (e.g., with Occult Primary, Metastatic, etc.), Stomach (Gastric) Cancer, T-Cell Lymphoma, Testicular Cancer, Throat Cancer, Thymoma and Thymic Carcinoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Ureter and Renal Pelvis Cancer, Urethral Cancer, Uterine Cancer (e.g., Endometrial, etc.), Uterine Sarcoma, Vaginal Cancer, Vulvar Cancer, Waldenstrm Macroglobulinemia, Wilms Tumor, and the like.
[0080] In some instances, a subject to which the provided methods may be applied may be a subject having a hematological (i.e., blood) cancer, e.g., a leukemia or a lymphoma. Non-limiting examples of hematological cancers include: Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Acute Myeloid Leukemia, Childhood; Chronic Lymphocytic Leukemia; Chronic Myelogenous Leukemia; Hairy Cell Leukemia; AIDS-Related Lymphoma; Cutaneous T-Cell Lymphoma (see Mycosis Fungoides and the Szary Syndrome); Hodgkin Lymphoma, Adult; Hodgkin Lymphoma, Childhood; Hodgkin Lymphoma During Pregnancy; Mycosis Fungoides; Non-Hodgkin Lymphoma, Adult; Non-Hodgkin Lymphoma, Childhood; Non-Hodgkin Lymphoma During Pregnancy; Primary Central Nervous System Lymphoma; Szary Syndrome; T-Cell Lymphoma, Cutaneous (see Mycosis Fungoides and the Szary Syndrome); Waldenstrm Macroglobulinemia (see Non-Hodgkin Lymphoma) Chronic Myeloproliferative Neoplasms; Langerhans Cell Histiocytosis; Multiple Myeloma/Plasma Cell Neoplasm; Myelodysplastic Syndromes; Myelodysplastic/Myeloproliferative Neoplasms; and the like.
[0081] In some instances, a subject to which the provided methods may be applied may be a subject having a carcinoma (e.g., an adenocarcinoma or a squamous cell carcinoma). Non-limiting examples of carcinomas include: acinar carcinoma, acinic cell carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, adenosquamous carcinoma, adnexal carcinoma, adrenocortical carcinoma, alveolar carcinoma, ameloblastic carcinoma, apocrine carcinoma, basal cell carcinoma, bronchioloalveolar carcinoma, bronchogenic carcinoma, cholangiocellular carcinoma, chorionic carcinoma, clear cell carcinoma, colloid carcinoma, colorectral carcinoma, cribriform carcinoma, ductal carcinoma in situ, embryonal carcinoma, carcinoma en cuirasse, endometrioid carcinoma, epidermoid carcinoma, carcinoma ex mixed tumor, carcinoma ex pleomorphic adenoma, follicular carcinoma of thyroid gland, hepatocellular carcinoma, carcinoma in si'tu, intraductal carcinoma, Hrthle cell carcinoma, inflammatory carcinoma of the breast, large cell carcinoma, invasive lobular carcinoma, lobular carcinoma, lobular carcinoma in situ (LCIS), medullary carcinoma, meningeal carcinoma, Merkel cell carcinoma, mucinous carcinoma, mucoepidermoid carcinoma, nasopharyngeal carcinoma, non-small cell carcinoma, non-small cell lung carcinoma (NSCLC), oat cell carcinoma, papillary carcinoma, renal cell carcinoma, scirrhous carcinoma, sebaceous carcinoma, carcinoma sim'plex, signet-ring cell carcinoma, small cell carcinoma, small cell lung carcinoma, spindle cell carcinoma, squamous cell carcinoma, terminal duct carcinoma, transitional cell carcinoma, tubular carcinoma, verrucous carcinoma, and the like.
[0082] In some instances, a subject to which the provided methods may be applied may be a subject having a melanoma. Non-limiting examples of melanomas include: cutaneous melanoma (e.g., superficial spreading melanoma, nodular melanoma, acral lentiginous melanoma, lentigo maligna melanoma), mucosal melanoma and ocular melanoma.
[0083] The provided methods may include obtaining a cellular sample of a neoplasia from the subject, including e.g., where the neoplasia is a cancer (e.g., a blood cancer, a carcinoma, a melanoma, etc.), including a cancer described above. Any convenient means of obtaining a cellular sample may be employed. For example, where the neoplasia is a blood cancer the cellular sample may be obtained by collecting a blood sample from the subject. Peripheral blood samples may or may not be fractionated to isolated specific cell populations, e.g., white blood cells. In another example, where the neoplasia is solid tumor the cellular sample may be obtained through a biopsy of the solid tumor.
[0084] A method of measuring MYC expression may be applied directly to the obtained cellular sample or the cellular sample may be prepared in some manner prior to the MYC expression measurement. In some embodiments, a sample may be prepared for quantitative or qualitative assessment of MYC expression by contacting the sample with a reagent that specifically binds MYC protein (e.g., an anti-MYC antibody) or a reagent that specifically binds a MYC encoding nucleic acid (e.g., a nucleic acid probe that specifically hybridizes to a MYC encoding mRNA). Such reagents may or may not be detectably labeled. For example, in some instances, the cellular sample may be applied to a slide and MYC expression may be evaluated by staining the slide with one or more reagents specific for MYC protein or MYC encoding mRNA. Staining of a cellular sample applied to a slide may make use of one or more histological techniques such as tissue embedding/freezing, sectioning (e.g., plastic sectioning, cryosectioning, etc.) fixation, permeabilization, histological staining, immunostaining/immunofluorescence (i.e., antibody staining), and the like. Staining of a cellular sample to detect expression of MYC encoding nucleic acids may make use of a variety of nucleic acid detection techniques such as fixation, permeabilization, in situ hybridization (e.g., fluorescent in situ hybridization (FISH)), and the like.
[0085] Cellular samples need not necessarily be applied to a slide and/or stained for evaluation of MYC expression. For example, in some instances, liquid based and/or cytological techniques may be employed including e.g., cytometry (e.g., flow cytometry, fluorescence activated cell sorting (FACS), mass cytometry (CyTOF), and the like), well-based cell sorting, microfluidics, and the like, and the cellular sample may be appropriately prepared using e.g., fixation, permeabilization, tissue dissociation, staining, cell suspension preparation, etc. In some instances, molecular techniques (e.g., microarray, PCR, sequencing, mass spectrometry, enzyme-linked immunosorbent assay (ELISA), Western Blot, etc.) may be employed for evaluation of MYC expression and the cellular sample may be correspondingly prepared, e.g., using tissue/cell dissociation, cell lysis, nucleic acid purification/isolation/extraction (e.g., solid or liquid phase), protein purification/isolation/extraction (e.g., solid or liquid phase), cDNA preparation, nucleic acid amplification, nucleic acid labeling, protein labeling, etc.
[0086] In embodiments where a MYC encoding nucleic acid is detected and/or quantified through amplification, the sample may be contacted with one or more nucleic acid primers (e.g., two nucleic acid primers) that specifically hybridize to a MYC encoding mRNA or a produced MYC cDNA (e.g., produced in a reverse transcription (RT) reaction, such as e.g., RT-PCR). Accordingly, in some instances, detection of MYC overexpression and/or measurement of MYC expression may include the amplification of a MYC encoding nucleic acid using one or more MYC-specific nucleic acid primers.
[0087] In some instances, preparation of the sample may include contacting the sample with one or more detectably labeled probes (e.g., antibody probes, nucleic acid probes, etc.) for MYC. Detectably labeled probes include e.g., alkaline phosphatase conjugated probes, horseradish peroxidase conjugated probes, fluorophore-conjugates probes (e.g., probes conjugated to a fluorophore such as e.g., Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680, 7-diethylaminocoumarin-3-carboxylic acid, Fluorescein, Oregon Green 488, Oregon Green 514, Tetramethylrhodamine, Rhodamine X, Texas Red dye, QSY 7, QSY33, Dabcyl, BODIPY FL, BODIPY 630/650, BODIPY 650/665, BODIPY TMR-X, BODIPY TR-X, Dialkylaminocoumarin, Cy5.5, Cy5, Cy3.5, Cy3, etc.) and the like.
[0088] Methods and reagents for use in processing of cellular samples for MYC expression analysis may, but need not necessarily, include those methods and reagents described in Li et al., Am J Clin Pathol. 2015; 143(4):598-604; Oberly et al., Histopathology. 2013; 63(4):499-508; Mahmoud et al. Mod Pathol. 2015; 28(4):545-51; as well as US Patent Application Pub. Nos: 20170029904, 20170016074, 20160177396, 20150240315, 20150197819, 20150080269, 20120270914; the disclosures of which are incorporated herein by reference in their entirety.
[0089] In some embodiments, MYC expression levels may be employed in stratifying subjects for clinical trials. For example, in some instances, MYC expression levels may be employed in stratifying subject for clinical trials involving the use of an immune checkpoint inhibitor. According to some embodiments, subjects in a clinical trial testing an immune checkpoint inhibitor may be stratified based on whether the subjects overexpress MYC. In some instances, MYC expression may be determined for a cellular sample of a neoplasia from a subject for a clinical trial to detect whether the subject overexpresses MYC and the subject may be included or excluded from the trial based on the determined MYC expression. For example, in some instances, subjects overexpressing MYC or subjects expressing MYC at various levels may be included and/or stratified in a clinical trial testing a PD-L1 inhibitor. In some instances, subjects overexpressing MYC or subjects expressing MYC at various levels may be included and/or stratified in a clinical trial testing a CD47 inhibitor.
[0090] As summarized above, the provided methods include methods of treating a subject for a neoplasia. Thus, an individual to be treated according to the present methods will generally be an individual with a neoplasia. As used herein neoplasia includes any form of abnormal new tissue formation; and the like. In some cases, the individual has recently undergone treatment for neoplasia (e.g., cancer, a tumor, etc.) and are therefore at risk for recurrence. In some instances, the individual has not recently or previously undergone treatment for a neoplasia (e.g., cancer, a tumor, etc.) but has been newly diagnosed with a neoplasia. Any and all neoplasia are suitable neoplasia to be treated by the subject methods e.g., utilizing one or more therapeutic agents, e.g., as described below, or a herein described kit.
[0091] Subjects that may be treated according to the described methods include subject that have previously undergone or are currently undergoing treatment for a neoplasia. Such subjects may display symptoms of cancer reoccurrence or regrowth of a neoplasia. Such subject may also have been nonresponsive to the prior or current therapy. In some instances, cancer reoccurrence and/or neoplasia regrowth and/or treatment non-responsiveness may be a result of immune evasion of the cancer or neoplasia. In some instances, the prior therapy to which a subject may have been non-responsive or from which the cancer/neoplasia has reoccurred/regrown may have been a conventional cancer therapy (e.g., surgery, radiation therapy, chemotherapy, etc.). In some instances, the subject may have been non-responsive to prior or concurrent chemotherapy, including but not limited to e.g., prior chemotherapy involving one or more of prednisone, cytoxan, cisplatin, vincristine and the like.
[0092] In some embodiments, the methods of treatment include identifying whether the neoplasia will be responsive to an immune checkpoint inhibitor (e.g., according to the methods of detecting MYC overexpression as described above) and administering an effective amount of an immune checkpoint inhibitor when the neoplasia is identified as responsive or likely to be responsive (e.g., is identified as over expressing MYC).
[0093] In some embodiments, the provided methods of treatment include treating a subject having a MYC-regulated immune-evasive cancer by administering to the subject a therapeutic agent that is effective against the MYC-regulated immune-evasive cancer. In some instances, the methods may include determining whether a cellular sample of an immune-evasive cancer obtained from a subject overexpresses an immune checkpoint protein (e.g., CD47, PD-L1 or both) and administering an effective amount of an agent to the subject to treat the immune-evasive cancer. In some instances, the methods may include determining whether a cellular sample of an neoplasm obtained from a subject overexpresses an immune checkpoint protein (e.g., CD47, PD-L1 or both) and MYC and administering an effective amount of an agent to the subject to treat the neoplasm.
[0094] As described above, without being bound by theory, the subject method takes advantage of the discovery that MYC regulates the expression of immune checkpoint proteins in cancer cells. Thus, detection of overexpression of one or more immune checkpoint proteins may be indicative of MYC misregulation (e.g., overexpression). Accordingly, the provided methods include treating a subject for a neoplasia identified as overexpressing an immune checkpoint protein by administering to the subject an effective amount of a MYC inhibitor. In some instances, the overexpressed immune checkpoint protein may be CD47. In some instances, the overexpressed immune checkpoint protein may be PD-L1. In some instances, the subject may overexpress two or more immune checkpoint proteins, including but not limited to e.g., both CD47 and PD-L1.
[0095] In some embodiments, the methods of treating may involve administering to a subject having a neoplasia that overexpresses an immune checkpoint protein a therapeutic agent that is not an immune checkpoint inhibitor to treat the subject for the neoplasia. Such agents include agents that do not directly target an immune checkpoint protein or the immune cell receptor thereof. An example of a therapeutic agent that is not an immune checkpoint inhibitor but may be employed in the methods of treating a subject having a neoplasia that overexpresses one or more immune checkpoint proteins is a MYC inhibitor. However, such therapeutic agents that are not immune checkpoint inhibitors are not limited to MYC and may include e.g., therapeutic agents identified that are effective during MYC-regulated immune evasion but do not directly target an immune checkpoint protein, including e.g., agents uncovered utilizing the screening methods described below.
[0096] Accordingly, in some embodiments, the provided methods may include determining whether a cellular sample of a neoplasm obtained from a subject overexpresses an immune checkpoint protein. As summarized herein, overexpression of an immune checkpoint protein in a cellular sample of the neoplasm may be indicative of the subject being responsive to a therapeutic agent, such as an agent other than an inhibitor of the immune check point protein, e.g., a MYC inhibitor or other non-immune-checkpoint-inhibitor agent.
[0097] Such methods may include identifying a subject as responsive (or likely to be responsive) to treatment with a therapeutic agent other than an immune checkpoint inhibitor (e.g., a MYC inhibitor) based on detected over expression of the immune checkpoint inhibitor within a cellular sample of a neoplasm from the subject. Similarly, the methods may include identifying a subject as non-responsive (or unlikely to be responsive) to treatment with a therapeutic agent other than an immune checkpoint inhibitor (e.g., a MYC inhibitor) based on a detected level of expression of the immune checkpoint inhibitor within a cellular sample of a neoplasm from the subject that does not amount to over expression.
[0098] By overexpresses an immune checkpoint protein is generally meant that a cell or a population of cells expresses an immune checkpoint protein above a known (i.e., predetermined) level, e.g., threshold level or a normal level. Immune checkpoint protein overexpression may include expression of an immune checkpoint protein encoding mRNA above a predetermined level, expression of an immune checkpoint protein above a predetermined level or a combination thereof. A predetermined level of an immune checkpoint protein, above which a cell or a population of cells may be identified as overexpressing the immune checkpoint protein, includes e.g., a normal level of expression of the immune checkpoint protein, a minimal detectable level or the like.
[0099] Predetermined, normal and/or minimal detectable levels of immune checkpoint protein expression may be obtained through a variety of means. In some instances, a predetermined or a normal level of immune checkpoint protein expression may be obtained from a cell known not to be a neoplastic cell or from a population of cells known not to be a neoplastic population of cells. In some instances, a predetermined or a normal level of immune checkpoint protein expression may be obtained from a cell known not to be an immune evasive cell (e.g., known not to be an immune evasive neoplastic cell) or from a population of cells known not to be an immune evasive population of cells (e.g., known not to be an immune evasive population of neoplastic cells). Normal and/or minimal levels of immune checkpoint protein expression, whether in neoplastic or non-neoplastic cells, may also be referred to as baseline expression levels. Neoplastic cells, and populations thereof, that do not overexpress immune checkpoint protein include but are not limited to e.g., neoplastic cells obtained from cancers that are not immune evasive; neoplastic cells where inhibitory immune checkpoint protein encoding gene(s) have been disrupted; and the like. Cells with known and/or predetermined levels of immune checkpoint protein expression, including normal levels and overexpression levels, may be referred to as a control or control cells (e.g., including positive and negative controls), where control cells may, but need not necessarily, be the same or an equivalent cell type to cells under examination to which they are compared.
[0100] Levels of immune checkpoint protein expression in cells that do not overexpress the immune checkpoint protein may be employed to establish a threshold for immune checkpoint protein expression above which a cell or a population of cells may be identified as immune checkpoint protein overexpressing. Such thresholds may be absolute or relative. Non-limiting examples of relative immune checkpoint protein expression thresholds above which a cell or a population of cells may be identified as overexpressing an immune checkpoint protein include 1.1 times baseline or control immune checkpoint protein expression or greater, including e.g., 1.2 times or greater, 1.3 times or greater, 1.4 times or greater, 1.5 times or greater, 1.6 times or greater, 1.7 times or greater, 1.8 times or greater, 1.9 times or greater, 2.0 times or greater, 2.1 times or greater, 2.2 times or greater, 2.3 times or greater, 2.4 times or greater, 2.5 times or greater, 2.6 times or greater, 2.7 times or greater, 2.8 times or greater, 2.9 times or greater, 3.0 times or greater, 3.5 times or greater, 4 times or greater, 4.5 times or greater, 5 times or greater, 6 times or greater, 7 times or greater, 8 times or greater, 9 times or greater, 10 times or greater, etc.
[0101] Levels of immune checkpoint protein expression in cells that overexpress an immune checkpoint protein may be employed to establish a threshold for immune checkpoint protein expression below which a cell or a population of cells may be identified as not immune checkpoint protein-overexpressing. Such thresholds may be absolute or relative. Non-limiting examples of relative immune checkpoint protein expression thresholds below which a cell or a population of cells may be identified as not overexpressing an immune checkpoint protein include 0.9 times the level of immune checkpoint protein overexpression or less, including e.g., 0.8 times or less, 0.7 times or less, 0.6 times or less, 0.5 times or less, 0.4 times or less, 0.3 times or less, 0.2 times or less, 0.1 times or less, etc.
[0102] Relative levels of immune checkpoint protein expression, including protein levels and/or mRNA levels, may be determined through the use of various qualitative or quantitative methods including but not limited to e.g., differential expression microarray analysis, semi-quantitative PCR, quantitative PCR (qPCR), next generation sequencing (NGS), immuno-assays, fluorescence activated cell sorting (FACS), mass cytometry (CyTOF), mass spectrometry, and the like. Absolute levels of immune checkpoint protein expression, including protein and/or mRNA, may be determined through the use of various quantitative methods including but not limited to e.g., qPCR, quantitative NGS, quantitative mass spectrometry, and the like.
[0103] Accordingly, the provided methods may include measuring the level of expression of an immune checkpoint protein in a cellular sample obtained from a subject and/or measuring the level of expression of an immune checkpoint protein in a cell of the cellular sample, wherein the measuring may be performed by any convenient method of measuring expression. Useful methods of measuring an immune checkpoint protein expression include methods of measuring an immune checkpoint protein encoding mRNA and/or an immune checkpoint protein levels including but not limited to e.g., those methods of measuring mRNA and/or protein levels described above, including those employing techniques and reagents described in relation to measuring MYC expression.
[0104] In some instances, the provided methods may include measuring the level and/or detecting overexpression of the immune checkpoint protein PD-L1. In humans, PD-L1 (also known as CD274, B7-H, B7H1, B7-H and B7H1) is encoded by the PD-L1/CD274 gene (NCBI Gene ID: 29126) present on chromosome 9 at 9p24.1. PD-L1 is immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation.
[0105] Human PD-L1 protein (GenBank Accession No. NP_001254635.1, NP_001300958.1, NP_054862.1; UniProt Q9NZQ7) has the following three isoform amino acid sequences:
Isoform 1:
[0106]
TABLE-US-00004 (SEQ ID NO: 4) MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDL AALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQ ITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSE HELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRIN TTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLC LGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET;
Isoform 2:
[0107]
TABLE-US-00005 (SEQ ID NO: 5) MRIFAVFIFMTYWHLLNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAE VIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRL DPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKG RMMDVKKCGIQDTNSKKQSDTHLEET;
Isoform 3:
[0108]
TABLE-US-00006 (SEQ ID NO: 6) MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDL AALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQ ITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSE HELTCQAEGYPKAEVIWTSSDHQVLSGD.
[0109] In mice, PD-L1 is encoded by the CD274 gene (also known as B7h1, Pdl1, Pdcd1l1, Pdcd1lg1 and A530045L16Rik; NCBI Gene ID: 60533) present on chromosome 19 at 19 C1. Mouse PD-L1 protein (GenBank Accession No. NP_068693.1; UniProt Q9EP73) has the following amino acid sequence:
TABLE-US-00007 (SEQ ID NO: 7) MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDL LALVVYWEKEDEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQ ITDVKLQDAGVYCCIISYGGADYKRITLKVNAPYRKINQRISVDPATSEH ELICQAEGYPEAEVIWTNSDHQPVSGKRSVTTSRTEGMLLNVTSSLRVNA TANDVFYCTFWRSQPGQNHTAELIIPELPATHPPQNRTHWVLLGSILLFL IVVSTVLLFLRKQVRMLDVEKCGVEDTSSKNRNDTQFEET.
[0110] In some instances, the provided methods may include measuring the level and/or detecting overexpression of the immune checkpoint protein CD47. In humans, CD47 (also known as integrin-associated protein (IAP), OA3 and MERG) is encoded by the CD47 gene (NCBI Gene ID: 961) present on chromosome 3 at 3q13.12. CD47 is a ubiquitously expressed membrane glycoprotein of the immunoglobulin superfamily that plays a critical role in self-recognition. Various solid and hematologic cancers exploit CD47 expression in order to evade immunological eradication, and its overexpression is clinically correlated with poor prognoses. One essential mechanism behind CD47-mediated immune evasion is that it can interact with signal regulatory protein-alpha (SIRP) expressed on myeloid cells.
[0111] Human CD47 protein (GenBank Accession No. NP_001768.1, NP_942088.1; UniProt Q08722) has the following four different isoform amino acid sequences: Isoform OA3-323:
TABLE-US-00008 (SEQ ID NO: 8) MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQN TTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKM DKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI FAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPG EYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYI LAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ PPRKAVEEPLNAFKESKGMMNDE;
Isoform OA3-293:
[0112]
TABLE-US-00009 (SEQ ID NO: 9) MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQN TTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKM DKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI FAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPG EYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYI LAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFV;
Isoform OA3-305:
[0113]
TABLE-US-00010 (SEQ ID NO: 10) MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQN TTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKM DKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI FAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPG EYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYI LAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ PPRNN;
Isoform OA3-312:
[0114]
TABLE-US-00011 (SEQ ID NO: 11) MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQN TTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKM DKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI FAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPG EYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYI LAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ PPRKAVEEPLN.
[0115] In mice, CD47 is encoded by the CD47 gene (also known as IAP, Itgp, AA407862, A1848868, AW108519, 9130415E20Rik and B430305P08Rik; NCBI Gene ID: 16423) present on chromosome 16 at 16 B5. Mouse CD47 protein (GenBank Accession No. NP_034711.1; UniProt Q61735) has the following amino acid sequence:
TABLE-US-00012 (SEQ ID NO: 12) MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQS TEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKM DKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKILIVIFPILA ILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPGEK PVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLA LVGLCLCIMACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPP RNR.
[0116] In some instances, the above provided proteins, the amino acid sequences thereof (e.g., related to MYC, PD-L1, CD47, etc.) and/or nucleic acids encoding the proteins or amino acid sequences may be targeted with one or more therapeutic agents, as described in more detail below.
[0117] Therapeutic Agents
[0118] In some instances, the methods of the present disclosure include treating a subject for a neoplasm by administering the subject an effective amount of one or more therapeutic agents. Therapeutic agents useful in the subject methods of treatment include inhibitors, i.e., agents that inhibit the production, function or activity of a target molecule. For example, useful inhibitors include immune checkpoint inhibitors that inhibit the production, function or activity of an immune checkpoint molecule and MYC inhibitors that inhibit the production, function or activity of MYC.
[0119] Any useful inhibitor of a subject target gene (e.g., an immune checkpoint gene or a MYC gene) and/or an encoded product thereof (e.g., an immune checkpoint protein or a MYC protein) may be employed in the subject methods. Non-limiting examples of useful inhibitors include but are not limited to e.g., non-peptide small molecule antagonists, peptide antagonists, interfering RNAs (e.g., siRNA, shRNA, etc.), antibodies (e.g., neutralizing antibodies, function blocking antibodies, etc.), aptamers, and the like. Accordingly, as non-limiting examples, in some instances, useful inhibitors may include a non-peptide small molecule antagonist of an immune checkpoint protein, a non-peptide small molecule antagonist of MYC, a peptide antagonist of an immune checkpoint protein, a peptide antagonist of MYC, an interfering RNA targeting an RNA expressed from an immune checkpoint protein encoding gene, an interfering RNA targeting an RNA expressed from a MYC encoding gene, an anti-immune checkpoint protein antibody (e.g., an antibody that specifically binds to an immune checkpoint protein), an anti-MYC antibody (e.g., an antibody that specifically binds to a MYC protein), an anti-immune checkpoint protein aptamer, an anti-MYC aptamers, and the like. In some instances, the effectiveness of an inhibitor may be confirmed using an in vitro or in vivo assay, including e.g., where the effectiveness of the inhibitor is compared to an appropriate control or standard, e.g., a conventional immune checkpoint inhibitor, a conventional MYC inhibitor, a conventional therapy for the condition, etc.
[0120] An inhibitory agent may specifically bind to the target molecule (e.g., protein or mRNA) that it inhibits. For example, a MYC inhibitor may specifically bind MYC protein or a nucleic acid encoding MYC, a PD-L1 inhibitor may specifically bind PD-L1 protein or a nucleic acid encoding PD-L1, a CD47 inhibitor may specifically bind CD47 protein or a nucleic acid encoding CD47.
[0121] In some instances, the inhibitor (e.g., an antibody) may specifically bind to a protein having 100% or less amino acid sequence identity with a MYC amino acid sequence (including e.g., SEQ ID NOs:1-3), including e.g., where the protein has 80% or greater amino acid sequence identity with the MYC amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc. In some instances, the inhibitor (e.g., an interfering RNA) may specifically bind to a nucleic acid encoding MYC or a protein having 100% or less amino acid sequence identity with a MYC amino acid sequence (including e.g., SEQ ID NOs:1-3), including e.g., where the protein has 80% or greater amino acid sequence identity with the MYC amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc.
[0122] In some instances, the inhibitor (e.g., an antibody) may specifically bind to a protein having 100% or less amino acid sequence identity with a PD-L1 amino acid sequence (including e.g., SEQ ID NOs:4-7), including e.g., where the protein has 80% or greater amino acid sequence identity with the PD-L1 amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc. In some instances, the inhibitor (e.g., an interfering RNA) may specifically bind to a nucleic acid encoding PD-L1 or a protein having 100% or less amino acid sequence identity with a PD-L1 amino acid sequence (including e.g., SEQ ID NOs:4-7), including e.g., where the protein has 80% or greater amino acid sequence identity with the PD-L1 amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc.
[0123] In some instances, the provided methods may include administering an inhibitor of a PD-L1 receptor, e.g., PD1. In humans, PD1 (programmed cell death protein 1, also known as CD279 (cluster of differentiation 279), SLEB2, hPD-1, hPD-I and hSLE1) is a cell surface receptor that plays an important role in down-regulating the immune system and promoting self-tolerance by suppressing T cell inflammatory activity. PD1 is an immune checkpoint and guards against autoimmunity through a dual mechanism of promoting apoptosis (programmed cell death) in antigen specific T-cells in lymph nodes while simultaneously reducing apoptosis in regulatory T cells (anti-inflammatory, suppressive T cells).
[0124] PD1 is encoded by the PDCD1 gene (NCBI Gene ID: 5133) in humans, present on chromosome 2 at 2q37.3. Human PD1 protein (GenBank Accession No. NP_005009.2; UniProt Q15116) has the following amino acid sequence:
TABLE-US-00013 (SEQ ID NO: 13) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTI GARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYAT IVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL.
[0125] In some instances, the inhibitor (e.g., an antibody) may specifically bind to a protein having 100% or less amino acid sequence identity with a PD1 amino acid sequence (including e.g., SEQ ID NO:13), including e.g., where the protein has 80% or greater amino acid sequence identity with the PD1 amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc. In some instances, the inhibitor (e.g., an interfering RNA) may specifically bind to a nucleic acid encoding PD1 or a protein having 100% or less amino acid sequence identity with a PD1 amino acid sequence (including e.g., SEQ ID NO:13), including e.g., where the protein has 80% or greater amino acid sequence identity with the PD1 amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc.
[0126] In some instances, the inhibitor (e.g., an antibody) may specifically bind to a protein having 100% or less amino acid sequence identity with a CD47 amino acid sequence (including e.g., SEQ ID NOs:8-12), including e.g., where the protein has 80% or greater amino acid sequence identity with the CD47 amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc. In some instances, the inhibitor (e.g., an interfering RNA) may specifically bind to a nucleic acid encoding CD47 or a protein having 100% or less amino acid sequence identity with a CD47 amino acid sequence (including e.g., SEQ ID NOs:8-12), including e.g., where the protein has 80% or greater amino acid sequence identity with the CD47 amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc.
[0127] In some instances, the provided methods may include administering an inhibitor of a CD47 receptor, e.g., SIRP. In humans, SIRP (Signal regulatory protein , also known as Tyrosine-protein phosphatase non-receptor type substrate 1,) is an immunoglobulin-like cell surface receptor regulatory membrane glycoprotein from SIRP family that acts as inhibitory receptor and interacts with CD47, also called the don't eat me signal. This interaction negatively controls effector function of innate immune cells such as host cell phagocytosis, analogous to the self-signals provided by MHC class I molecules to NK cells via Ig-like or Ly49 receptors.
[0128] SIRP is encoded by the signal regulatory protein alpha gene (NCBI Gene ID: 140885), in humans present on chromosome 20 at 20p13. Human SIRP protein (GenBank Accession No. NP_001035111.1, NP_001035112.1, NP_001317657.1, NP_542970.1; UniProt P78324) has the following 3 different isoform amino acid sequences:
Isoform 1:
[0129]
TABLE-US-00014 (SEQ ID NO: 14) MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGET ATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSA PVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDP VGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETI RVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVS AHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKK AQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNH TEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQ VPRK;
Isoform 2:
[0130]
TABLE-US-00015 (SEQ ID NO: 15) MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGET ATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSA PVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDP VGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETI RVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVS AHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKK AQGSTSSTRLHEPEKNAREITQVQSLDTNDITYADLNLPKGKKPAPQAAE PNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEY ASVQVPRK;
Isoform 3:
[0131]
TABLE-US-00016 (SEQ ID NO: 16) MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGET ATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRIGNITPADAGTYYCVKFRKGSPDVEFKSGAGTELSVRAKPSAP VVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPV GESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIR VPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST VTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSA HPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKA QGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHT EYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQV PRK.
[0132] In some instances, the inhibitor (e.g., an antibody) may specifically bind to a protein having 100% or less amino acid sequence identity with a SIRP amino acid sequence (including e.g., SEQ ID NOs:14-16), including e.g., where the protein has 80% or greater amino acid sequence identity with the SIRP amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc. In some instances, the inhibitor (e.g., an interfering RNA) may specifically bind to a nucleic acid encoding SIRP or a protein having 100% or less amino acid sequence identity with a SIRP amino acid sequence (including e.g., SEQ ID NOs:14-16), including e.g., where the protein has 80% or greater amino acid sequence identity with the SIRP amino acid sequence, including 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, etc.
[0133] As summarized above, the provided methods may, in some embodiments, involve the administration of one or more MYC inhibitors, including e.g., two or more MYC inhibitors, e.g., 3 or more, 4 or more, 5 or more, etc., to a subject. Any MYC inhibitor, including inhibitors that directly target MYC and those that indirectly inhibit MYC signaling may be employed.
[0134] Useful MYC inhibitors include but are not limited to small molecule direct and indirect inhibitors of MYC. Non-limiting examples of small molecule direct and indirect inhibitors of MYC include: IIA6B17 (Berg et al., 2002) and analogs thereof (e.g., mycmycin-1;), IIA4B20 (Berg et al., 2002) and analogs thereof (e.g., mycmycin-2); 2-[3-oxo-3-(1-piperidinyl)propyl]-1H-isoindole-1,3(2H)-dione (MW 286.3) and analogs thereof; 5-(4-chlorobenzylidene)-2-thioxo-1,3-thiazolidin-4-one (MW 255.7) and analogs thereof; 2-(4-ethylphenoxy)-N-(2-phenylethyl)acetamide (MW 283.4) and analogs thereof; 4-methyl-2-[2-(6-methyl-2-phenyl-2,3-dihydro-4H-chromen-4-ylidene)hydrazino]-N-(3-nitrophenyl)-1,3-thiazole-5-carboxamide hydrobromide (MW 594.5) and analogs thereof; 5-(3,4-dihydroxybenzylidene)-2-thioxo-1,3-thiazolidin-4-one (MW 253.3) and analogs thereof; 5-(4-isopropylbenzylidene)-2-thioxo-1,3-thiazolidin-4-one (MW 263.4) and analogs thereof; 3-[3-(3,6-dichloro-9H-carbazol-9-yl)-2-hydroxypropyl]-1,3-thiazolidine-2,4-dione (MW 409.3) and analogs thereof; N-2-biphenylyl-7-nitro-2,1,3-benzoxadiazol-4-amine (MW 332.3) and analogs thereof; 3-[2-(4-ethylphenyl)-2-oxoethyl]-6,7-dimethoxy-2-benzofuran-1(3H)-one (MW 340.4) and analogs thereof; 1-(3-chlorophenyl)-3-(diethylamino)-2,5-pyrrolidinedione (MW 280.8) and analogs thereof; N-(2-bromo-4-methylphenyl)-2-(4-ethylphenoxy)acetamide (MW 348.2) and analogs thereof; 5-(4-ethylbenzylidene)-2-thioxo-1,3-thiazolidin-4-one (MW 249.4) and analogs thereof; 6-bromo-3-[3-(3-nitrophenyl)acryloyl]-4-phenyl-2(1H)-quinolinone (MW 475.3) and analogs thereof; 1-[2,5-dioxo-1-(4-propoxyphenyl)-3-pyrrolidinyl]-4-piperidinecarboxylic acid (MW 360.4) and analogs thereof; N-[2-(4-nitrophenyl)ethyl]bicyclo[2.2.1]heptan-2-amine (MW 260.3) and analogs thereof; N-(4-methoxybenzyl)-5-(2-thienyl)-7-(trifluoromethyl)pyrazolo[1,5-a]pyrimidine-2-carboxamide (MW 432.4) and analogs thereof; 2-(4-ethylphenoxy)-N-(1-naphthylmethyl)acetamide (MW 319.4) and analogs thereof; butyl 3-[5-(4-ethylbenzylidene)-4-oxo-2-thioxo-1,3-thiazolidin-3-yl]propanoate (MW 377.5) and analogs thereof; 1-[2-(2,5-dimethylphenoxy)ethyl]-1H-indole-3-carbaldehyde (MW 293.4) and analogs thereof; N-1,3-benzothiazol-2-yl-2-(4-isopropylphenoxy)acetamide (MW 326.4) and analogs thereof; methyl 1-(4-ethylphenyl)-5-oxo-3-pyrrolidinecarboxylate (MW 247.3) and analogs thereof; 5-(4-ethylbenzylidene)-3-(2-propyn-1-yl)-1,3-thiazolidine-2,4-dione (MW 271.3) and analogs thereof; 3-allyl-5-(4-ethylbenzylidene)-2-thioxo-1,3-thiazolidin-4-one (MW 289.4) and analogs thereof; N-[2-(4-methoxyphenyl)ethyl]-4-(methylthio)benzenesulfonamide (MW 337.5) and analogs thereof; NZY2267 (Xu et al., 2006) and analogs thereof; Mycro1 (Kiessling et al., 2006) and analogs thereof; Mycro2 (Kiessling et al., 2006) and analogs thereof; Compounds 1-5 as described in Kiessling et al., Chem Med Chem. 2007; 2(5):627-30 and analogs thereof; 10058-F4 (Yin et al., 2003) and analogs thereof; 10074-G5 (Yin et al., 2003) and analogs thereof; JY-3-094 (Yap et al., 2013) and analogs thereof; SF-4-017 (Yap et al., 2013) and analogs thereof; bromodomain and extra-terminal (BET) domain inhibitors (e.g., JQ1 and analogs thereof; I-BET762 and analogs thereof; I-BET151 and analogs thereof; MS417 and analogs thereof; and MS436 and analogs thereof; and the like); PKUMDL-YC-1101 (Yu et al. 2016) an analogs thereof, PKUMDL-YC-1201 (Yu et al. 2016) an analogs thereof, PKUMDL-YC-1202 (Yu et al. 2016) an analogs thereof, PKUMDL-YC-1203 (Yu et al. 2016) an analogs thereof, PKUMDL-YC-1204 (Yu et al. 2016) an analogs thereof, and PKUMDL-YC-1301 (Yu et al. 2016) an analogs thereof; PKUMDL-YC-1205 (Yu et al. 2016) an analogs thereof;
[0135] Useful MYC inhibitors may also include, in some instances, small molecules that bind c-Myc promoter G-quadruplexes, including but not limited to e.g., CX-3543 (Quarfloxin; see e.g., Chen et al., Int J Biol Sci. 2014; 10(10): 1084-1096). C-Myc promoter G-quadruplexe binding MYC inhibitors include but are not limited to e.g., those molecules depicted in
[0136] Useful MYC inhibitors may also include, in some instances, small molecules that prevent or interfere with the association of MYC with its binding partner MAX (i.e., molecules that prevent MYC/MAX binding). Such molecules may directly/specifically bind MYC (e.g., at a MAX binding site) or may directly/specifically bind MAX (e.g., at a MYC binding site). Non-limiting examples include but are not limited to e.g., those described in U.S. Pat. No. 8,637,556; the disclosure of which is incorporated herein by reference in its entirety.
[0137] Useful MYC inhibitors may also include peptide inhibitors of MYC. Non-limiting examples of peptide inhibitors of MYC include Myc H1 DNA-binding region based peptide MYC inhibitors (including e.g., peptides having the H1 DNA-binding region of c-Myc containing Ser to Ala, and Phe to Ala substitutions and cell permeable versions thereof; see e.g., Giorello, et al.; Cancer Res. 58, 3654 (1998)). Examples of Helix 1 (H1) MYC inhibitory peptides include Bac-ELP1-H1 and Bac-ELP2-H1, such peptides have the following amino acid sequence:
TABLE-US-00017 (SEQ ID NO: 17) MRRIRPRPPRLPRPRPRPLPFPRPGGCYPG-(VPGXG).sub.n-WPGSGNELK RAFAALRDQI,
where ELP1-H1 contains V, G, or A at the X position in a 5:3:2 ratio, respectively, and n is 150 and Bac-ELP2-H1 contains V, G, or A at the X position in a 1:7:8 ratio, respectively, and n is 160 (see e.g., Bidwell, et al., PLoS One. 2013; 8(1):e55104). MYC inhibitory peptides generally include any peptide that prevents MYC binding of endogenous DNA targets preventing MYC transcription factor activity.
[0138] Other examples of peptide inhibitors of MYC include but are not limited to e.g., basic-helix-loop-helix-leucine zipper (bHLHZ) motif containing peptides. Such peptides may include a MYC bHLHZ domain or a MAX bHLHZ domain but exclude one or more MYC or MAX functional domains, including e.g., where such a peptide includes a MYC bHLHZ domain but excludes a MYC transactivation domain (TAD). MYC or MAX bHLHZ domains may be mutated at one or more amino acid residues, including e.g., 1, 2, 3, 4, 5, 6, 7, 8, or more residues. Peptide inhibitors of MYC containing a bHLHZ motif may function as a dominate negative MYC. In some instances, a bHLHZ motif containing peptide inhibitor of MYC may include the following mutated MYC bHLHZ domain amino acid sequence:
TABLE-US-00018 (SEQ ID NO: 18) QAETQKLISEIDLLRKQNEQLKHKLEQL,
or have 100% or less amino acid sequence identity, including 99% or greater sequence identity, 95% or greater sequence identity, 90% or greater sequence identity, 85% or greater sequence identity, etc., with the mutated MYC bHLHZ domain amino acid sequence of SEQ ID NO:18). One non-limiting example of a bHLHZ motif containing peptide inhibitors of MYC is OmoMYC, which has the following amino acid sequence:
TABLE-US-00019 (SEQ ID NO: 19) TEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKA TAYILSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA.
In some instances, useful peptide inhibitors of MYC will include analogs or mutants of OmoMYC including but not limited to e.g., those having one or more mutated amino acid residues as compared to SEQ ID NO:19, including e.g., 1, 2, 3, 4, 5, 6, 7, 8, or more mutated residues and those having less than 100% sequence identity with SEQ ID NO:19, including 99% or greater sequence identity, 95% or greater sequence identity, 90% or greater sequence identity, 85% or greater sequence identity, etc., and the like. Useful bHLHZ MYC/MAX inhibitors include but are not limited to e.g., those describe in US Patent Application Pub. No. US 2016/0122415 A1, Soucek et al., Oncogene. 1998; 17(19):2463-72; Soucek et al., Cancer Res. 2002; 62(12):3507-10; Savino et al., PLoS One. 2011; 6(7):e22284; the disclosures of which are incorporated herein by reference in their entirety.
[0139] Useful MYC inhibitors may also include MYC inhibitory nucleic acids. By MYC inhibitory nucleic acids is generally meant nucleic acid molecules that prevent the expression and/or translation of MYC protein. MYC inhibitory nucleic acids include MYC interfering RNAs of about 5 to 50 bp or 10 to 30 bp, which are capable of binding to c-Myc gene or transcript thereof including e.g., MYC-directed siRNA, MYC-directed shRNA and the like. Non-limiting examples of MYC interfering RNAs include e.g., those anti-MYC shRNAs and siRNAs directed to MYC encoding nucleic acids, including e.g., c-Myc siRNA, shRNA and Lentiviral Particle Gene Silencers (available from Santa Cruz Biotechnology, Inc.; Santa Cruz, Calif.)). Non-limiting examples of c-Myc siRNA include but are not limited to e.g., those described in U.S. Pat. No. 9,457,043; the disclosure of which is incorporated herein by reference in its entirety.
[0140] MYC inhibitors include but are not limited to those described in Berg et al., Proc Natl Acad Sci USA. 2002; 99(6):3830-5; Wang et al., Oncogene. 2008; 27:1905-1915; Yin et al., Oncogene. 2003; 22(40):6151-9; Shi et al., Bioorg. Med. Chem. Lett. 2009; 19:6038-6041; Xu et al., Bioorg Med Chem. 2006 Apr. 15; 14(8):2660-73; Kiessling et al., Chem Biol. 2006; 13(7):745-51; Kiessling et al., Chem Med Chem. 2007; 2(5):627-30; Yap et al., Bioorg Med Chem Lett. 2013; 23(1):370-4; Segura et al., Cancer Res. 2013; 73(20):6264-76; Fletcher & Prochownik, Biochim Biophys Acta. 2015; 1849(5): 525-543; Yu et al., Sci Rep. 2016 Mar. 2; 6:22298; Chen et al., Int J Biol Sci. 2014; 10(10): 1084-1096; Bidwell, et al., PLoS One. 2013; 8(1):e55104; Prochownik & Vogt, Genes Cancer. 2010 June; 1(6): 650-659; U.S. Pat. Nos. 9,567,301; 9,457,043; 9,387,213; 9,506,060; 9,278,940; 9,228,189 and 9,155,724; the disclosures of which are incorporated herein by reference in their entirety.
[0141] MYC inhibitors may be administered to a subject in an effective amount, where an effective amount of a MYC inhibitor may be an amount effective to achieve the desired response and/or treat the individual. Effective amounts of MYC inhibitors may be determined empirically, e.g., through one or more clinical trials, inferred from one or more pharmacological studies and/or preclinical animal studies, or other means.
[0142] In certain embodiments, an effective amount of a MYC inhibitor for administration one or more times a day to a 70 kg adult human may comprise about 0.0001 mg to about 3000 mg, about 0.0001 mg to about 2000 mg, about 0.0001 mg to about 1000 mg, about 0.001 mg to about 1000 mg, about 0.01 mg to about 1000 mg, about 0.1 mg to about 1000 mg, about 1 mg to about 1000 mg, about 1 mg to about 100 mg, about 10 mg to about 1000 mg, or about 100 mg to about 1000 mg, of a compound per unit dosage form.
[0143] In certain embodiments, a MYC inhibitor may be administered at dosage levels sufficient to deliver from about 0.001 mg/kg to about 100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, preferably from about 0.1 mg/kg to about 40 mg/kg, preferably from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, and more preferably from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic effect.
[0144] Any other anti-MYC therapy may be employed in the subject methods where inhibition of MYC and/or targeting of MYC overexpressing cells is desired, including but not limited to e.g., targeting c-MYC using T cells as described in e.g., Helm et al., PLoS ONE 8(10): e77375; the disclosure of which is incorporated by reference herein in its entirety.
[0145] As summarized above, the provided methods may include administering to a subject one or more immune checkpoint inhibitors, including but not limited to e.g., where the subject is administered two or more immune checkpoint inhibitors, e.g., 3 or more, 4 or more, 5 or more, etc. Useful immune checkpoint inhibitors include inhibitors of one or more immune checkpoint proteins, including e.g., agents that specifically bind an immune checkpoint ligand or an immune checkpoint receptor or otherwise prevents the association of an immune checkpoint ligand with its receptor. Non-limiting examples of immune checkpoint inhibitors include drugs that target PD1, drugs that target PD-L1, drugs that target CLTA4 (e.g., Ipilimumab (Yervoy)), drugs that target CD47, drugs that target Signal Regulatory Protein (SIRP, aka CD172a or SHPS-1), and the like.
[0146] The provided methods may, in some embodiments, involve the administration of one or more PD1/PD-L1 pathway inhibitors, including e.g., two or more PD1/PD-L1 pathway inhibitors, e.g., 3 or more, 4 or more, 5 or more, etc., to a subject. Any PD1/PD-L1 pathway inhibitor, including inhibitors that directly target PD1 or PD-L1 and those that indirectly inhibit PD1/PD-L1 pathway signaling may be employed. As such, useful inhibitors of the PD1/PD-L1 pathway include agents (e.g., small molecules, antibodies, inhibitory nucleic acids, etc.) that specifically bind PD-L1, specifically bind PD1 and/or prevent the association of PD-L1 with PD1, inhibit the expression PD-L1, inhibit the expression of PD1, and the like.
[0147] Useful PD-L1/PD1 pathway inhibitors include antibodies that specifically bind to PD-L1 or PD1, inhibit the PD-L1/PD1 interaction and/or otherwise prevent PD-L1/PD1 pathway signaling. Non-limiting examples of such antibodies include: Durvalumab (aka, anti-B7H1 monoclonal antibody, MEDI-4736; AstraZeneca/Medlmmune); avelumab (aka, MSB-0010718C; a fully human monoclonal PD-L1 antibody of isotype IgG1; Merck); Atezolizumab (aka, MPDL3280A, Tecentriq); Nivolumab (aka Opdivo, BMS-936558 or MDX1106b; a human IgG4 antibody against PD-1, lacking detectable antibody-dependent cellular toxicity (ADCC); Bristol-Myers Squibb); Pembrolizumab (aka MK-3475, lambrolizumab, KEYTRUDA; an highly specific anti-PD-1 humanized IgG4 isotype antibody that contains a mutation at C228P designed to prevent Fc-mediated cytotoxicity); Pidilizumab (aka CT-011, MDV9300; a humanized monoclonal antibody (mAb) that modulates the immune response and inhibits tumor growth and the spread of metastases; CureTech Ltd.); and the like.
[0148] Useful PD-L1/PD1 pathway inhibitors include small molecules (e.g., peptidomimetics, macrocyclic peptides, nonpeptidic molecules, and the like) that specifically bind to PD-L1 or PD1, inhibit the PD-L1/PD1 interaction and/or otherwise prevent PD-L1/PD1 pathway signaling. Non-limiting examples of small molecule PD-L1/PD1 pathway inhibitors include 2-methyl-3-biphenylyl)methanol based derivatives (e.g., BMS-202, BMS-8 (
[0149] PD-L1/PD1 inhibitors include but are not limited to those described in Zak et al., Oncotarget. 2016; 7(21):30323-35; Zhan et al., Drug Discov Today. 2016 June; 21(6):1027-36; Chang et al., Angew Chem Int Ed. 2015; 54:11760-11764; Zarganes-Tzitzikas et al., Expert Opin Ther Pat. 2016 September; 26(9):973-7; U.S. Pat. Nos. 6,808,710; 7,029,674; 7,101,550; 7,488,802; 7,722,868; 8,008,449; 8,088,905; 8,168,757; 8,383,796; 8,709,416; 8,741,295; 8,951,518; 8,952,136; 8,993,731; 9,102,728; 9,163,087; 9,175,082; 9,181,342; 9,205,148; 9,212,224; 9,217,034; 9,220,776; 9,273,135; 9,492,539; US Patent Application Pub. Nos. 20110318373; 20130095098; 20130133091; 20130323249; 20140227262; 20140234296; 20140335093; 20140348743; 20140356363; 20150073024; 20150118234; 20150152180; 20150203579; 20150203580; 20150210769; 20150315274; 20150346208; 20150355184; 20160031990; 20160068586; 20160075782; 20160075783; 20160130348; 20160137731; 20160222113; 20160304606; 20160333096; 20160362495; 20160376367; 20170007693; 20170044259; 20170044260; PCT Pub. Nos. WO/2015/034820 and WO/2011/082400; the disclosures of which are incorporated herein by reference in their entirety.
[0150] PD-L1/PD1 inhibitors may be administered to a subject in an effective amount, where an effective amount of a PD-L1/PD1 inhibitor may be an amount effective to achieve the desired response and/or treat the individual. Effective amounts of PD-L1/PD1 inhibitors may be determined empirically, e.g., through one or more clinical trials, inferred from one or more pharmacological studies and/or preclinical animal studies, or other means.
[0151] In certain embodiments, an effective amount of a PD-L1/PD1inhibitor for administration one or more times a day to a 70 kg adult human may comprise about 0.0001 mg to about 3000 mg, about 0.0001 mg to about 2000 mg, about 0.0001 mg to about 1000 mg, about 0.001 mg to about 1000 mg, about 0.01 mg to about 1000 mg, about 0.1 mg to about 1000 mg, about 1 mg to about 1000 mg, about 1 mg to about 100 mg, about 10 mg to about 1000 mg, or about 100 mg to about 1000 mg, of a compound per unit dosage form.
[0152] In certain embodiments, a PD-L1/PD1inhibitor may be administered at dosage levels sufficient to deliver from about 0.001 mg/kg to about 100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, preferably from about 0.1 mg/kg to about 40 mg/kg, preferably from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, and more preferably from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic effect.
[0153] The provided methods may, in some embodiments, involve the administration of one or more CD47/SIRP pathway inhibitors, including e.g., two or more CD47/SIRP pathway inhibitors, e.g., 3 or more, 4 or more, 5 or more, etc., to a subject. Any CD47/SIRP pathway inhibitor, including inhibitors that directly target CD47 or SIRP, inhibit the interaction of CD47 and SIRP and/or those that indirectly inhibit CD47/SIRP pathway signaling may be employed. As such, useful inhibitors of the CD47/SIRP pathway include agents (e.g., small molecules, antibodies, inhibitory nucleic acids, etc.) that specifically bind CD47, specifically bind SIRP and/or prevent the association of CD47 with SIRP, inhibit the expression CD47, inhibit the expression of SIRP, and the like.
[0154] Useful CD47/SIRP pathway inhibitors include but are not limited to antibodies, including e.g., antibodies that specifically bind CD47, antibodies that specifically bind SIRP, and the like. Non-limiting examples of such antibodies include e.g., CC-900002 (an anti-CD47 antibody developed by Celgene Corporation, Summit, N.J.), Hu5F9-G4 (humanized monoclonal antibody against CD47; Forty Seven, Inc., Menlo Park, Calif.), anti-CD47 antibodies developed by Tioma Therapeutics (Brisbane, Calif.), as well as other anti-CD47/SIRP antibodies developed by these and other companies.
[0155] Useful CD47/SIRP pathway inhibitors include inhibitory peptides. Inhibitory peptides, as generally referred to herein with regards to CD47/SIRP and other listed target molecules (e.g., PD1, PD-L1, MYC, etc.), include peptides that are fused to a heterologous peptide/polypeptide (i.e., fusion proteins) as well as peptides that are not fused a heterologous peptide/polypeptide. For example, useful CD47/SIRP peptides fused to a heterologous peptide/polypeptide include SIRPFc (aka TTI-621), a fusion protein consisting of a portion of the SIRP receptor linked to an immunoglobulin Fc region forming a antibody-like molecule binds to CD47 on the tumor cells with high affinity and functions as a decoy receptor (developed by Trillium Therapeutics Inc., Mississauga, ON). Other useful CD47/SIRP pathway peptide inhibitors include e.g., those derived from the C-terminal domain of TSP1 which bind to CD47 and perturb its interactions/signaling (e.g., as described in Frazier et al., UCSD Nature Molecule. 2010; and peptidomimetics derived therefrom), those that mimic CD47- or SIRP-binding antibodies (e.g., an inhibitory peptide containing the following amino acid sequence CERVIGTGWVRC (SEQ ID NO:20); as described in Liu et al., J Immunol. 2004; 172(4):2578-2585; and analogs thereof), and the like.
[0156] Useful CD47/SIRP pathway inhibitors include CD47/SIRP inhibitory nucleic acids (such as e.g., CD47 morpholino oligonucleotides (e.g., as described in Isenberg et al., Ann Surg. 2008; 247(1):180-90; Isenberg et al., Circ Res. 2007; 100(5):712-20; Isenberg et al., Ann Surg. 2008; 247(5):860-8; and derivatives thereof), siRNA against human CD47 (e.g., as described in Toledano et al., PLoS One. 2013 Sep. 20; 8(9):e75595, and derivatives thereof); and the like.
[0157] Useful CD47/SIRP pathway inhibitors include small molecule CD47/SIRP inhibitors. Non-limiting examples of such include PSTx-23 and analogs thereof (such as e.g., those developed by Paradigm Shift Therapeutics (PSTx; Rockville, Md.).
[0158] Non-limiting examples of CD47/SIRP pathway inhibitors include those described in e.g., Zhao et al., Proc Natl Acad Sci USA. 2011; 108(45):18342-7; Sagawa et al., Cancer Sci. 2011; 102(6):1208-15; Majeti et al., Cell. 2009; 138(2):286-99; Willingham et al., Proc Natl Acad Sci USA. 2012; 109(17):6662-7; van Ravenswaay Claasen et al., Gynecol Oncol. 1994; 52(2):199-206; Chao et al., Cancer Res. 2011 Feb. 15; 71(4):1374-84; Ide et al., Proc Natl Acad Sci USA. 2007; 104(12):5062-6; Fortin et al., J Exp Med. 2009; 206(9):1995-2011; Kikuchi et al., Leuk Res. 2005; 29(4):445-50; Soto-Pantoja et al., Expert Opin Ther Targets. 2013; 17(1): 89-103; US Patent Application Pub. Nos. 20070111238, 20120225073, 20130011401, 20130189253, 20140065169, 20140161825, 20140296477, 20140303354, 20140369924, 20150071905, 20150238604, 20150266942, 20150329616, 20150353642, 20150376288, 20160008429, 20160009815, 20160045532, 20160060342, 20160069898, 20160137734, 20160144009, 20160177276, 20160251435, 20160257751, 20160304609, 20160319256, 20160333093, U.S. Pat. Nos. 7,282,556; 8,562,997; 8,758,750; 8,759,025; 8,951,527; 9,017,675; 9,045,541; 9,382,320; 9,518,117; 9,527,901; PCT Pub. Nos. WO 2014094122 and WO 2013109752; the disclosures of which are incorporated herein by reference in their entirety.
[0159] CD47/SIRP inhibitors may be administered to a subject in an effective amount, where an effective amount of a CD47/SIRP inhibitor may be an amount effective to achieve the desired response and/or treat the individual. Effective amounts of CD47/SIRP inhibitors may be determined empirically, e.g., through one or more clinical trials, inferred from one or more pharmacological studies and/or preclinical animal studies, or other means.
[0160] In certain embodiments, an effective amount of a CD47/SIRP inhibitor for administration one or more times a day to a 70 kg adult human may comprise about 0.0001 mg to about 3000 mg, about 0.0001 mg to about 2000 mg, about 0.0001 mg to about 1000 mg, about 0.001 mg to about 1000 mg, about 0.01 mg to about 1000 mg, about 0.1 mg to about 1000 mg, about 1 mg to about 1000 mg, about 1 mg to about 100 mg, about 10 mg to about 1000 mg, or about 100 mg to about 1000 mg, of a compound per unit dosage form.
[0161] In certain embodiments, a CD47/SIRP inhibitor may be administered at dosage levels sufficient to deliver from about 0.001 mg/kg to about 100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, preferably from about 0.1 mg/kg to about 40 mg/kg, preferably from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, and more preferably from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic effect.
[0162] As will be readily understood, the methods of treating described herein may, in some instances, be combined with or performed before, during or after one or more conventional treatments. For example, in the case of oncology, the methods described herein may, in some instances, be combined with or performed before, during or after a conventional cancer therapy including but not limited to e.g., conventional chemotherapy, conventional radiation therapy, conventional immunotherapy, surgery, etc.
[0163] In some instances, as summarized above, the methods described herein may be used before or after a conventional therapy. For example, the methods described herein may be used as an adjuvant therapy, e.g., after a subject has seen improvement from a conventional therapy, or may be used when a subject has not responded to a conventional therapy. For example, the provided methods may be employed before, during or after a subject has been treated with conventional chemotherapy, including e.g., a chemotherapy regimen that includes one or more of prednisone, cytoxan, cisplatin, vincristine, and the like. In some instances, the subject may have not responded to prior treatment with a conventional chemotherapeutic, including e.g., prednisone, cytoxan, cisplatin, vincristine, and the like. In some instances, the methods described herein may be used prior to an additional therapy, e.g., to prepare a subject for an additional therapy, e.g., a conventional therapy as described herein.
[0164] In some instances, the provided methods may be used without any additional conventional therapy including e.g., where the method described herein is the sole method used to treat the subject. For example, in the case of oncology, the methods described herein may, in some instances, be the sole method used to treat the subject for a cancer.
[0165] In some embodiments, the provided methods may include administration of one or more conventional agents along with one or more of the therapeutic agents described herein. Such conventional agents may be co-administered. Agents useful in co-administration as described herein are agents used in conventional treatment of one or more of the cancers described herein. Such agents include but are not limited to e.g., conventional agents for treating cancer (e.g., chemotherapy agents), hormone agents (e.g., hormone therapy agents conventionally used for treating breast cancer, hormone therapy agents conventionally used for treating prostate cancer, etc.), agents for treating side effects of cancer therapy (e.g., analgesics, anti-nausea agents (e.g., corticosteroids, serotonin antagonists, dopamine antagonists, NK-1 inhibitors, cannabinoids, motion-sickness agents, sedatives, histamine H2-receptor antagonists, etc.), anti-neutropenia agents (e.g., antibiotics, antifungals, granulocyte colony-stimulating factors (G-CSFs), etc.)) agents for treating symptoms of a particular cancer or tumor, and the like. Additional agents useful in co-administration also include agents useful in treating or preventing conditions associated with radiation therapy.
[0166] Screening Methods
[0167] As summarized above, methods are also provided for identifying therapeutic agents that are effective during cancer cell MYC-regulated immune evasion. Such methods may be generally referred to as methods of screening. Methods are also provided which include treating a subject, as described above, through administering to the subject a therapeutic agent identified using such screening methods. Accordingly, therapeutic agents of the present disclosure include those agents identified as effective during MYC-regulated immune evasion of a cancer cell.
[0168] Methods of identifying a therapeutic agent that is effective during MYC-regulated immune evasion of a cancer cell will vary. Such methods may include contacting two different tumor cell lines conditionally expressing MYC with one or more candidate agents. For example, a method may include contacting a first tumor cell line conditionally expressing a MYC oncogene and a second tumor cell line conditionally expressing a MYC oncogene with a candidate therapeutic agent, where the second tumor cell line differs from the first. In some instances, the second tumor cell line may differ from the first in its expression of one or more immune checkpoint proteins. For example, the second tumor cell line may constitutively express one or more immune checkpoint proteins, including e.g., where the one or more immune checkpoint proteins are expressed in a MYC-independent manner.
[0169] Accordingly, the provided screening methods may include parallel or sequential assays of two substantially similar conditionally MYC expressing tumor cell lines that differ in their expression of one or more immune checkpoint proteins. Without being bound by theory, the provided screening methods incorporate the discovery that MYC regulates the expression of immune checkpoint proteins in tumor cells. Thus, in some embodiments, the provided methods involve screening candidate agents in two similar tumor cell lines, where, immune checkpoint protein expression is regulated by MYC in the first, and in the second, immune checkpoint protein expression is constitutive. Using this approach candidate agents that, e.g., affect the ability of MYC to induce immune checkpoint protein expression or other aspects of MYC-driven immune cell evasion, and candidate agents that are ineffective or act independently of MYC and/or the MYC-driven immune cell evasion pathway can be differentiated. For example, such methods may identify a candidate agent as a therapeutic agent that is effective during MYC-regulated immune evasion, where the agent produces a desired effect in a first tumor cell line (e.g., where immune checkpoint protein expression remains MYC-driven) but does not produce the effect in a second tumor cell line (e.g., where immune checkpoint protein expression is constitutive, i.e., not MYC driven). A desired effect may be a cellular behavior or cellular parameter, as described in more detail below. When identifying a candidate agent as one that is effective during MYC-regulated immune evasion, such cellular behavior(s) or cellular parameter(s) may be increased or reduced in one cell line as compared to another, depending on the context analyzed.
[0170] The term tumor cell lines, as used herein, is generally used to refer to neoplastic cell lines broadly and is not limiting to cell lines derived from solid tumors. As such, tumor cell lines utilized in the provided methods may be derived from any convenient source and established for essentially any neoplasia, including solid tumors and blood cancers. Thus, tumor cell lines utilized in the subject methods may include neoplastic cell lines generated from any cancer, including e.g., those cancers identified herein in relationship to other (i.e., non-screening) methods. In some instances, the tumor cell lines of the provided screening methods may be generated from a blood cancer (e.g., a lymphoma, a leukemia, etc.), a carcinoma, a melanoma, or the like. In some instances, the tumor cell lines are generated from an acute lymphoblastic leukemia. In some instances, the tumor cell lines are generated from a hepatocellular carcinoma, non-small cell lung carcinoma, renal cell carcinoma, colorectal carcinoma, or the like.
[0171] As summarized above, in some embodiments, a cell line employed in the methods may constitutively express an immune checkpoint protein independently of MYC. Such a protein may be referred to as a MYC-independent constitutively expressed immune checkpoint protein and may be expressed from the endogenous locus of the immune checkpoint protein of an introduced heterologous nucleic acid encoding the immune checkpoint protein. Through constitutive expression of the immune checkpoint protein the regulation of MYC and the immune checkpoint protein is uncoupled. Any convenient immune checkpoint protein may be employed as a MYC-independent constitutively expressed immune checkpoint protein and conventional methods for constitutively expressing a desired protein may be employed (such as e.g., configuring the immune checkpoint protein coding sequence such that it is operably linked to a constitutive promoter). In some instances, the MYC-independent constitutively expressed immune checkpoint protein is CD47. In some instances, the MYC-independent constitutively expressed immune checkpoint protein is PD-L1. In some instances, a cell line may be configured to constitutively express both CD47 and PD-L1 in a MYC independent manner.
[0172] Conditional control of the expression of MYC may be performed using any convenient method of conditional expression, either reversible or irreversible. For example, in some instances, a MYC coding sequence may be placed under the control of (i.e., may be operably linked to) an inducible or conditionally active promoter. Conventional conditional expression systems may be employed including e.g., where the conditional expression of MYC is controlled by a tetracycline-based system, a tamoxifen-based system or the like. As such, conditional expression of MYC may be controlled (i.e., activated or repressed) by contacting the cells with an agent that activates or represses the expression of MYC in the cell lines, such as but not limited to e.g., tetracycline or one of its derivatives (e.g. doxycycline), tamoxifen or one of its derivatives (e.g., 4-hydroxytamoxifen), and the like.
[0173] Contacting of the tumor cell lines with the candidate agent(s) may be performed in vitro or in vivo. For example, in some instances, the tumor cell lines may be cultured, including e.g., in a two-dimensional or a three-dimensional cell culture environment (e.g., in a well, dish, flask, etc.) and the agent(s) may be added to the culture (e.g., added to the culture medium). In some instances, the tumor cell lines may be introduced, including e.g., transplanted (e.g., grafted or xeno-grafted) into a host animal (e.g., a rodent such as a mouse or a rat, or a non-human primate or other mammal) and the agent(s) may be administered to the host animal (e.g., through any convenient route of administration, including e.g., those described herein).
[0174] The provided methods may include a step of determining the effect of contacting the tumor cell line(s), whether performed in vitro or in vivo, with the candidate agent. In some embodiments, the determining will include comparing a cellular behavior or cell parameter of two cell lines where both cell lines conditionally express MYC but only one cell line constitutively expresses one or more immune checkpoint proteins. For example, the two cell lines may be compared in both a MYC ON state where the conditional expression of MYC is activated or de-repressed and a MYC OFF state where the conditional expression of MYC is deactivated or repressed. Any convenient parameter or behavior of the individual cells or the cells as a population may be analyzed, including e.g., cell growth, cell division, cell line expansion, cell viability, cell line survival, gene expression (e.g., immune checkpoint gene expression), etc. In some instances, one or more parameters or behaviors may be quantified.
[0175] A wide variety of assays may be used for screening purposes, including immunoassays for protein binding; determination of cell growth, differentiation and functional activity; production of factors; and the like. Screening assays may utilize cells, proteins, polynucleotides, etc. In some embodiments, isolated polypeptides corresponding to a candidate or combination of candidates of the present invention are useful in drug screening assays.
[0176] In screening assays for biologically active agents, tumor cell lines conditionally expressing a MYC oncogene, are contacted with the agent of interest, and the effect of the agent assessed by monitoring output parameters on cells (also referred to as cellular behaviors), such as expression of markers, cell viability, and the like. The cells may be freshly isolated, cultured, genetically altered, or transplanted as xenografts, and the like. The cells may be environmentally induced variants of clonal cultures: e.g. split into independent cultures and grown under distinct conditions, for example with or without drugs; in the presence or absence of cytokines or combinations thereof. The manner in which cells respond to an agent, particularly a pharmacologic agent, including the timing of responses, is an important reflection of the physiologic state of the cell.
[0177] Parameters are quantifiable or qualitatively assessable components of cells, including components that can be accurately measured or easily distinguished, e.g., in a high throughput system. A parameter can be any cell population feature or cell component or cell product including e.g., cell survival, cell line expansion, a cell surface determinant, a receptor, a protein or conformational or posttranslational modification thereof, a lipid, a carbohydrate, an organic or inorganic molecule, a nucleic acid, e.g. mRNA, DNA, etc., or a portion derived from such a cell component or combinations thereof. While many parameters will provide a quantitative readout, in some instances a semi-quantitative or qualitative result will be acceptable. Readouts may include a single determined value, or may include mean, median value or the variance, etc. Characteristically a range of parameter readout values will be obtained for each parameter from a multiplicity of the same assays. Variability is expected and a range of values for each of the set of test parameters will be obtained using standard statistical methods with a common statistical method used to provide single values.
[0178] Agents of interest for screening include known and unknown compounds that encompass numerous chemical classes, primarily organic molecules, which may include organometallic molecules, inorganic molecules, genetic sequences, etc. One aspect of some embodiments is to evaluate candidate drugs, including biological activity assays, toxicity testing; and the like.
[0179] In addition to complex biological agents, candidate agents may include organic molecules comprising functional groups necessary for structural interactions, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, frequently at least two of the functional chemical groups. The candidate agents may comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups. Candidate agents are also found among biomolecules, including peptides, polynucleotides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof.
[0180] Included are pharmacologically active drugs, genetically active molecules, etc. Compounds of interest include chemotherapeutic agents, hormones or hormone antagonists, etc. Exemplary of pharmaceutical agents suitable for this invention are those described in, The Pharmacological Basis of Therapeutics, Goodman and Gilman, McGraw-Hill, New York, N.Y., (1996), Ninth edition, under the sections: Water, Salts and Ions; Drugs Affecting Renal Function and Electrolyte Metabolism; Drugs Affecting Gastrointestinal Function; Chemotherapy of Microbial Diseases; Chemotherapy of Neoplastic Diseases; Drugs Acting on Blood-Forming organs; Hormones and Hormone Antagonists; Vitamins, Dermatology; and Toxicology, all incorporated herein by reference. Also included are toxins, and biological and chemical warfare agents, for example see Somani, S. M. (Ed.), Chemical Warfare Agents, Academic Press, New York, 1992).
[0181] Test compounds include all of the classes of molecules described above, and may further comprise samples of unknown content. Of interest are complex mixtures of naturally occurring compounds derived from natural sources such as plants. While many samples will comprise compounds in solution, solid samples that can be dissolved in a suitable solvent may also be assayed. Samples of interest include environmental samples, e.g., ground water, sea water, mining waste, etc.; biological samples, e.g. lysates prepared from crops, tissue samples, etc.; manufacturing samples, e.g. time course during preparation of pharmaceuticals; as well as libraries of compounds prepared for analysis; and the like. Samples of interest include compounds being assessed for potential therapeutic value, i.e. drug candidates.
[0182] The term samples also includes the fluids described above to which additional components have been added, for example components that affect the ionic strength, pH, total protein concentration, etc. In addition, the samples may be treated to achieve at least partial fractionation or concentration. Biological samples may be stored if care is taken to reduce degradation of the compound, e.g. under nitrogen, frozen, or a combination thereof. The volume of sample used is sufficient to allow for measurable detection. In some instances, from about 0.01 to 1 ml of a biological sample may be sufficient.
[0183] Compounds, including candidate agents, are obtained from a wide variety of sources including libraries of synthetic or natural compounds. For example, numerous means are available for random and directed synthesis of a wide variety of organic compounds, including biomolecules, including expression of randomized oligonucleotides and oligopeptides. Alternatively, libraries of natural compounds in the form of bacterial, fungal, plant and animal extracts are available or readily produced. Additionally, natural or synthetically produced libraries and compounds are readily modified through conventional chemical, physical and biochemical means, and may be used to produce combinatorial libraries. Known pharmacological agents may be subjected to directed or random chemical modifications, such as acylation, alkylation, esterification, amidification, etc., to produce structural analogs.
[0184] In some embodiments, agents are screened for biological activity by adding the agent to at least two, i.e., a plurality of cell samples, including e.g., a MYC expressing cell line and a cell line that expresses both MYC and an immune checkpoint protein, usually in conjunction with cells lacking the agent. The change in parameters in response to the agent is measured, and the result evaluated by comparison to reference cultures, e.g. in the presence and absence of the agent, obtained with other agents, etc.
[0185] The agents are conveniently added in solution, or readily soluble form, to the medium of cells in culture. The agents may be added in a flow-through system, as a stream, intermittent or continuous, or alternatively, adding a bolus of the compound, singly or incrementally, to an otherwise static solution. In a flow-through system, two fluids are used, where one is a physiologically neutral solution, and the other is the same solution with the test compound added. The first fluid is passed over the cells, followed by the second. In a single solution method, a bolus of the test compound is added to the volume of medium surrounding the cells. The overall concentrations of the components of the culture medium should not change significantly with the addition of the bolus, or between the two solutions in a flow through method.
[0186] Preferred agent formulations do not include additional components, such as preservatives, that may have a significant effect on the overall formulation. Thus preferred formulations consist essentially of a biologically active compound and a physiologically acceptable carrier, e.g. water, ethanol, DMSO, etc. However, if a compound is liquid without a solvent, the formulation may consist essentially of the compound itself.
[0187] A plurality of assays may be run in parallel with different agent concentrations to obtain a differential response to the various concentrations. As known in the art, determining the effective concentration of an agent typically uses a range of concentrations resulting from 1:10, or other log scale, dilutions. The concentrations may be further refined with a second series of dilutions, if necessary. Typically, one of these concentrations serves as a negative control, i.e., at zero concentration or below the level of detection of the agent or at or below the concentration of agent that does not give a detectable change in the phenotype.
[0188] Therapeutic agents identified in the provided screening methods may have a wide variety of mechanisms of action to produce the identified effect. For example, in some instances, a therapeutic agent identified as overcoming MYC-regulated immune evasion may inhibit MYC-induced expression of one or more immune checkpoint genes, including e.g., where the agent directly or indirectly inhibits MYC-induced expression of one or more immune checkpoint genes. In another example, the therapeutic agent may overcome MYC-regulated immune evasion by inhibiting MYC-induced expression of CD47. In another example, the therapeutic agent may overcome MYC-regulated immune evasion by inhibiting MYC-induced expression of PD-L1. In another example, the therapeutic agent may overcome MYC-regulated immune evasion by inhibiting MYC-induced expression of CD47 and PD-L1. It will be readily understood that mechanisms of action of identified candidate agents may vary.
[0189] Pharmaceutical Compositions
[0190] The provided compositions (e.g., those including one or more therapeutic agents, including previously described agents and newly identified therapeutic candidates) can be supplied in the form of a pharmaceutical composition. Any suitable pharmaceutical composition may be employed, described in more detail below. As such, in some instances, methods of the present disclosure may include administering an inhibitor in a composition comprising an excipient (e.g., an isotonic excipient) prepared under sufficiently sterile conditions for administration to a mammal, e.g., a human.
[0191] Administration of an inhibitor to a subject, as described herein, may be performed employing various routes of administration. The route of administration may be selected according to a variety of factors including, but not necessarily limited to, the condition to be treated, the formulation and/or device used, the patient to be treated, and the like. Routes of administration useful in the disclosed methods include but are not limited to oral and parenteral routes, such as intravenous (iv), intraperitoneal (ip), rectal, topical, ophthalmic, nasal, and transdermal. Formulations for these dosage forms are described herein.
[0192] An effective amount of a subject compound will depend, at least, on the particular method of use, the subject being treated, the severity of the affliction, and the manner of administration of the therapeutic composition. A therapeutically effective amount of a composition is a quantity of a specified compound sufficient to achieve a desired effect in a subject (host) being treated.
[0193] Therapeutically effective doses of a subject compound or pharmaceutical composition can be determined by one of skill in the art, with a goal of achieving local (e.g., tissue) concentrations that are at least as high as the IC50 of an applicable compound disclosed herein.
[0194] The specific dose level and frequency of dosage for any particular subject may be varied and will depend upon a variety of factors, including the activity of the subject compound, the metabolic stability and length of action of that compound, the age, body weight, general health, sex and diet of the subject, mode and time of administration, rate of excretion, drug combination, and severity of the condition of the host undergoing therapy.
[0195] Conversion of an animal dose to human equivalent doses (HED) may, in some instances, be performed using the conversion table and/or algorithm provided by the U.S. Department of Health and Human Services, Food and Drug Administration, Center for Drug Evaluation and Research (CDER) in, e.g., Guidance for Industry: Estimating the Maximum Safe Starting Dose in Initial Clinical Trials for Therapeutics in Adult Healthy Volunteers (2005) Food and Drug Administration, 5600 Fishers Lane, Rockville, Md. 20857; (available at www(dot)fda(dot)gov/cder/guidance/index(dot)htm, the disclosure of which is incorporated herein by reference).
TABLE-US-00020 Conversion of Animal Doses to Human Equivalent Doses Based on Body Surface Area To Convert Animal To Convert Animal Dose in mg/ Dose in mg/kg to kg to HED.sup.a in mg/kg, Either: Dose in mg/m.sup.2, Divide Multiply Species Multiply by k.sub.m Animal Dose By Animal Dose By Human 37 Child (20 kg).sup.b 25 Mouse 3 12.3 0.08 Hamster 5 7.4 0.13 Rat 6 6.2 0.16 Ferret 7 5.3 0.19 Guinea pig 8 4.6 0.22 Rabbit 12 3.1 0.32 Dog 20 1.8 0.54 Primates: Monkeys.sup.c 12 3.1 0.32 Marmoset 6 6.2 0.16 Squirrel 7 5.3 0.19 monkey Baboon 20 1.8 0.54 Micro-pig 27 1.4 0.73 Mini-pig 35 1.1 0.95 .sup.aAssumes 60 kg human. For species not listed or for weights outside the standard ranges, HED can be calculated from the following formula: HED = animal dose in mg/kg (animal weight in kg/human weight in kg)0.33. .sup.bThis km value is provided for reference only since healthy children will rarely be volunteers for phase 1 trials. .sup.cFor example, cynomolgus, rhesus, and stumptail.
[0196] A pharmaceutical composition comprising a subject compound (i.e., an inhibitory agent or a combination thereof) may be administered to a patient alone, or in combination with other supplementary active agents. The pharmaceutical compositions may be manufactured using any of a variety of processes, including, without limitation, conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping, and lyophilizing. The pharmaceutical composition can take any of a variety of forms including, without limitation, a sterile solution, suspension, emulsion, lyophilisate, tablet, pill, pellet, capsule, powder, syrup, elixir or any other dosage form suitable for administration.
[0197] A subject compound may be administered to the host using any convenient means capable of resulting in the desired reduction in disease condition or symptom. Thus, a subject compound can be incorporated into a variety of formulations for therapeutic administration. More particularly, a subject compound can be formulated into pharmaceutical compositions by combination with appropriate pharmaceutically acceptable carriers or diluents, and may be formulated into preparations in solid, semi-solid, liquid or gaseous forms, such as tablets, capsules, powders, granules, ointments, solutions, suppositories, injections, inhalants and aerosols.
[0198] Formulations for pharmaceutical compositions are well known in the art. For example, Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, Pa., 19th Edition, 1995, describes exemplary formulations (and components thereof) suitable for pharmaceutical delivery of disclosed compounds. Pharmaceutical compositions comprising at least one of the subject compounds can be formulated for use in human or veterinary medicine. Particular formulations of a disclosed pharmaceutical composition may depend, for example, on the mode of administration and/or on the location of the infection to be treated. In some embodiments, formulations include a pharmaceutically acceptable carrier in addition to at least one active ingredient, such as a subject compound. In other embodiments, other medicinal or pharmaceutical agents, for example, with similar, related or complementary effects on the affliction being treated can also be included as active ingredients in a pharmaceutical composition.
[0199] Pharmaceutically acceptable carriers useful for the disclosed methods and compositions are conventional in the art. The nature of a pharmaceutical carrier will depend on the particular mode of administration being employed. For example, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (e.g., powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can optionally contain minor amounts of non-toxic auxiliary substances (e.g., excipients), such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like; for example, sodium acetate or sorbitan monolaurate. Other non-limiting excipients include, nonionic solubilizers, such as cremophor, or proteins, such as human serum albumin or plasma preparations.
[0200] Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol, and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and/or polyanhydrides; and (22) other non-toxic compatible substances employed in pharmaceutical formulations.
[0201] The disclosed pharmaceutical compositions may be formulated as a pharmaceutically acceptable salt of a disclosed compound. Pharmaceutically acceptable salts are non-toxic salts of a free base form of a compound that possesses the desired pharmacological activity of the free base. These salts may be derived from inorganic or organic acids. Non-limiting examples of suitable inorganic acids are hydrochloric acid, nitric acid, hydrobromic acid, sulfuric acid, hydroiodic acid, and phosphoric acid. Non-limiting examples of suitable organic acids are acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, methyl sulfonic acid, salicylic acid, formic acid, trichloroacetic acid, trifluoroacetic acid, gluconic acid, asparagic acid, aspartic acid, benzenesulfonic acid, p-toluenesulfonic acid, naphthalenesulfonic acid, and the like. Lists of other suitable pharmaceutically acceptable salts are found in Remington's Pharmaceutical Sciences, 17th Edition, Mack Publishing Company, Easton, Pa., 1985. A pharmaceutically acceptable salt may also serve to adjust the osmotic pressure of the composition.
[0202] A subject compound can be used alone or in combination with appropriate additives to make tablets, powders, granules or capsules, for example, with conventional additives, such as lactose, mannitol, corn starch or potato starch; with binders, such as crystalline cellulose, cellulose derivatives, acacia, corn starch or gelatins; with disintegrators, such as corn starch, potato starch or sodium carboxymethylcellulose; with lubricants, such as talc or magnesium stearate; and if desired, with diluents, buffering agents, moistening agents, preservatives and flavoring agents. Such preparations can be used for oral administration.
[0203] A subject compound can be formulated into preparations for injection by dissolving, suspending or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other similar oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives. The preparation may also be emulsified or the active ingredient encapsulated in liposome vehicles. Formulations suitable for injection can be administered by an intravitreal, intraocular, intramuscular, subcutaneous, sublingual, or other route of administration, e.g., injection into the gum tissue or other oral tissue. Such formulations are also suitable for topical administration.
[0204] In some embodiments, a subject compound can be delivered by a continuous delivery system. The term continuous delivery system is used interchangeably herein with controlled delivery system and encompasses continuous (e.g., controlled) delivery devices (e.g., pumps) in combination with catheters, injection devices, and the like, a wide variety of which are known in the art.
[0205] A subject compound can be utilized in aerosol formulation to be administered via inhalation. A subject compound can be formulated into pressurized acceptable propellants such as dichlorodifluoromethane, propane, nitrogen and the like.
[0206] Furthermore, a subject compound can be made into suppositories by mixing with a variety of bases such as emulsifying bases or water-soluble bases. A subject compound can be administered rectally via a suppository. The suppository can include vehicles such as cocoa butter, carbowaxes and polyethylene glycols, which melt at body temperature, yet are solidified at room temperature.
[0207] The term unit dosage form, as used herein, refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of a subject compound calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle. The specifications for a subject compound depend on the particular compound employed and the effect to be achieved, and the pharmacodynamics associated with each compound in the host.
[0208] The dosage form of a disclosed pharmaceutical composition will be determined by the mode of administration chosen. For example, in addition to injectable fluids, topical or oral dosage forms may be employed. Topical preparations may include eye drops, ointments, sprays and the like. In some instances, a topical preparation of a medicament useful in the methods described herein may include, e.g., an ointment preparation that includes one or more excipients including, e.g., mineral oil, paraffin, propylene carbonate, white petrolatum, white wax and the like, in addition to one or more additional active agents.
[0209] Oral formulations may be liquid (e.g., syrups, solutions or suspensions), or solid (e.g., powders, pills, tablets, or capsules). Methods of preparing such dosage forms are known, or will be apparent, to those skilled in the art.
[0210] Certain embodiments of the pharmaceutical compositions comprising a subject compound may be formulated in unit dosage form suitable for individual administration of precise dosages. The amount of active ingredient administered will depend on the subject being treated, the severity of the affliction, and the manner of administration, and is known to those skilled in the art. Within these bounds, the formulation to be administered will contain a quantity of the extracts or compounds disclosed herein in an amount effective to achieve the desired effect in the subject being treated.
[0211] Each therapeutic compound can independently be in any dosage form, such as those described herein, and can also be administered in various ways, as described herein. For example, the compounds may be formulated together, in a single dosage unit (that is, combined together in one form such as capsule, tablet, powder, or liquid, etc.) as a combination product. Alternatively, when not formulated together in a single dosage unit, an individual subject compound may be administered at the same time as another therapeutic compound or sequentially, in any order thereof.
Cell Lines, Transgenic Animals and Kits
[0212] As summarized above, also provided are cell lines, transgenic animals and kits for use in the subject methods. The subject cell lines include neoplastic cell lines (e.g., tumor cell lines, cancer cell lines, etc.). In some instances, the subject cell lines may include neoplasms derived from a mammalian neoplasia such as e.g., a human neoplasia, a mouse neoplasia, a rat neoplasia, a primate neoplasia, or the like. The subject transgenic animals include non-human transgenic animals, such as transgenic non-human mammals, e.g., transgenic non-human rodents (e.g., mice, rats, etc.), transgenic non-human primates, and the like. The subject kits may include any combination of components (e.g., therapeutic agents, reagents, cell lines, etc.) for performing the subject methods. Provided kits include kits useful in methods of treating a subject for a neoplasm and/or methods of identifying a neoplasm as immune evasive and/or likely to be responsive to an immune checkpoint inhibitor. Also provided are kits for use in generating one or more of the described cell lines and/or transgenic animals.
[0213] As summarized above, the provided cell lines may include cancer cell lines or tumor cell lines. The terms cancer cell lines and tumor cell lines, as used herein, is generally used to refer to neoplastic cell lines broadly. The subject terms are not limiting to cell lines derived from solid tumors or specific cancers. As such, cancer and tumor cell lines utilized in the provided methods may be derived from any convenient source and established for essentially any neoplasia, including solid tumors and blood cancers. Thus, cancer and tumor cell lines utilized in the subject methods may include neoplastic cell lines generated from essentially any cancer, including e.g., those cancers identified herein in relationship to the above methods. In some instances, the cell lines of the provided screening methods may be generated from a blood cancer (e.g., a lymphoma, a leukemia, etc.), a carcinoma, a melanoma, or the like. In some instances, the tumor cell lines are generated from an acute lymphoblastic leukemia. In some instances, the cell lines are generated from a hepatocellular carcinoma, non-small cell lung carcinoma, renal cell carcinoma, colorectal carcinoma, or the like.
[0214] In some embodiments, the cell lines will include an inducible MYC locus, allowing for the inducible or conditional expression of MYC. Accordingly, at a minimum an inducible MYC locus will generally include a nucleic acid sequence encoding MYC operably linked to a inducible, or otherwise conditionally active, transcriptional response element. Transcriptional response elements include e.g., promoters and enhancers. As such, a transcriptional response element to which a MYC coding sequence may be operably linked in an inducible MYC locus may be an inducible promoter, which may or may not include one or more operably linked enhancer elements.
[0215] In some embodiments, the cell lines will include a constitutively active locus, allowing for continued expression of a desired coding sequence. For example, a cell line may include a constitutively active locus encoding one or more immune checkpoint proteins. Such constitutively active loci encoding one or more immune checkpoint proteins may be MYC-independent such that the expression of MYC does not affect the expression of the encoded one or more immune checkpoint proteins. Accordingly, in some embodiments, cell lines may include a MYC-independent, constitutively active immune checkpoint encoding locus. At a minimum such a locus will include an immune checkpoint protein encoding nucleic acid sequence operably linked to a constitutively active transcriptional response element, e.g., a constitutively active promoter, that may or may not include one or more operably linked enhancer elements. In some instances, the immune checkpoint protein encoding nucleic acid sequence employed encodes CD47. In some instances, the immune checkpoint protein encoding nucleic acid sequence employed encodes PD-L1. In some instances, the immune checkpoint protein encoding nucleic acid sequence employed encodes both CD47 and PD-L1. In some instances, two separate immune checkpoint protein encoding nucleic acid sequences may be employed, e.g., one encoding CD47 and one encoding PD-L1, e.g., each operably linked to the same or different constitutively active transcriptional response elements.
[0216] Suitable transcriptional response elements will vary depending on the context in which they are employed. Suitable promoter and enhancer elements include e.g., those conventionally employed for expression in a eukaryotic cell, including but are not limited to e.g., cytomegalovirus immediate early promoter; herpes simplex virus thymidine kinase promoter; early and late SV40 promoters; promoter present in long terminal repeats from a retrovirus; mouse metallothionein-I promoter; and the like.
[0217] Any convenient and appropriate inducible and/or reversible promoter, including reversible/inducible promoters may be employed. Such promoters may be isolated and derived from many organisms, e.g., eukaryotes and prokaryotes. Modification of reversible promoters derived from a first organism for use in a second organism, e.g., a first prokaryote and a second a eukaryote, a first eukaryote and a second a prokaryote, etc., can be performed. Such promoters, and systems based on such promoters but also comprising additional control proteins, include, but are not limited to, alcohol regulated promoters (e.g., alcohol dehydrogenase I (alcA) gene promoter, promoters responsive to alcohol transactivator proteins (AlcR), etc.), tetracycline regulated (e.g., tetracycline-dependent) promoters, (e.g., promoter systems including TetActivators, TetON, TetOFF, etc.), steroid regulated promoters (e.g., rat glucocorticoid receptor promoter systems, human estrogen receptor-based promoter systems, retinoid promoter systems, thyroid promoter systems, ecdysone promoter systems, mifepristone promoter systems, etc.), metal regulated promoters (e.g., metallothionein promoter systems, etc.), pathogenesis-related regulated promoters (e.g., salicylic acid regulated promoters, ethylene regulated promoters, benzothiadiazole regulated promoters, etc.), temperature regulated promoters (e.g., heat shock inducible promoters (e.g., HSP-70, HSP-90, soybean heat shock promoter, etc.), light regulated promoters, synthetic inducible promoters, and the like.
[0218] In some instances, the locus or construct or transgene containing the suitable promoter is irreversibly switched through the induction of an inducible system. Suitable systems for induction of an irreversible switch include, e.g., those that involve induction of an irreversible switch and make use of a Cre-lox-mediated recombination (see, e.g., Fuhrmann-Benzakein, et al., PNAS (2000) 28:e99, the disclosure of which is incorporated herein by reference). Any suitable combination of recombinase, endonuclease, ligase, recombination sites, etc. may be used in generating an irreversibly switchable promoter. Methods, mechanisms, and requirements for performing site-specific recombination, described elsewhere herein, find use in generating irreversibly switched promoters and are well known in the art, see, e.g., Grindley et al. (2006) Annual Review of Biochemistry, 567-605 and Tropp (2012) Molecular Biology (Jones & Bartlett Publishers, Sudbury, Mass.), the disclosures of which are incorporated herein by reference.
[0219] Useful transcriptional response elements in the subject cells include but are not limited to e.g., a transcriptional response element that is a tetracycline-dependent promoter. For example, the tetracycline-dependent promoter may be operably linked to a MYC encoding nucleic acid such that when active (e.g., through the presence or absence of tetracycline of a derivative thereof) MYC is conditionally expressed.
[0220] Useful transcriptional response elements in the subject cells include but are not limited to e.g., a transcriptional response element that is a GAL4 responsive upstream activating sequence (UAS). For example, the GAL4 responsive UAS may be operably linked to a MYC encoding nucleic acid such that when active (e.g., through the presence of GAL4) MYC is conditionally expressed. Correspondingly, the expression of GAL4 may be controlled by a promoter (e.g., an inducible or conditional promoter) operably linked to a GAL4 coding sequence.
[0221] An inducible MYC locus may be reversibly or irreversibly inducible as desired. For example, in some instances, an inducible or conditional MYC may be configured such that, upon a recombination event, the MYC encoding locus is irreversibly switched ON or OFF, e.g., through the use of a conditional genetic stop sequence. In some embodiments, a conditional genetic stop sequence may be configured between a transcriptional response element and a MYC encoding nucleic acid sequence and flanked by recombination sites (e.g., floxed) such that upon a recombination event (e.g., mediated by Cre) the stop sequence is removed and MYC is controlled by the transcriptional response element (and may be expressed or repressed accordingly). In some instances, the recombination activity of a Cre recombinase may be controlled using a tamoxifen-based system, e.g., by fusing the Cre to a portion of the estrogen receptor (Cre-ER). An ordinary skilled artisan will readily understand how the described cells may be combined with and adapted to systems for reversible and/or irreversible conditional and/or inducible expression of desired coding sequences.
[0222] As summarized above, the provided non-human transgenic animals include transgenic non-human mammals, e.g., transgenic non-human rodents (e.g., mice, rats, etc.), transgenic non-human primates. Such animals will generally be permanently or transiently genetically modified with one or more heterologous nucleic acid sequences to generate an inducible MYC expressing locus and/or a constitutive immune checkpoint expressing locus in the animal. Any convenient method of genetic manipulation may be employed.
[0223] The provided transgenic animals may utilize endogenous or exogenous coding sequencing, e.g., MYC coding sequences, CD47 coding sequences, PD-L1 coding sequences, etc. For example, a heterologous transcriptional response element may be genetically inserted such that it is operably linked to an endogenous coding sequence. Alternatively, an exogenous coding sequence may be introduced already operably linked to a heterologous transcriptional response element. Where exogenous coding sequences are introduced into a subject animal, the corresponding endogenous coding sequence may or may not be replaced or otherwise genetically disrupted as desired.
[0224] In some embodiments, the animals will include an inducible MYC locus, allowing for the inducible or conditional expression of MYC. Accordingly, at a minimum an inducible MYC locus will generally include a nucleic acid sequence encoding MYC operably linked to an inducible, or otherwise conditionally active, transcriptional response element. Transcriptional response elements include e.g., promoters and enhancers. As such, a transcriptional response element to which a MYC coding sequence may be operably linked in an inducible MYC locus may be an inducible promoter, which may or may not include one or more operably linked enhancer elements.
[0225] In some embodiments, the animals will include a constitutively active locus, allowing for continued expression of a desired coding sequence. For example, an animal may include a constitutively active locus encoding one or more immune checkpoint proteins. Such constitutively active loci encoding one or more immune checkpoint proteins may be MYC-independent such that the expression of MYC does not affect the expression of the encoded one or more immune checkpoint proteins. Accordingly, in some embodiments, animals may include a MYC-independent, constitutively active immune checkpoint encoding locus. At a minimum such a locus will include an immune checkpoint protein encoding nucleic acid sequence operably linked to a constitutively active transcriptional response element, e.g., a constitutively active promoter, that may or may not include one or more operably linked enhancer elements. In some instances, the immune checkpoint protein encoding nucleic acid sequence employed encodes CD47. In some instances, the immune checkpoint protein encoding nucleic acid sequence employed encodes PD-L1. In some instances, the immune checkpoint protein encoding nucleic acid sequence employed encodes both CD47 and PD-L1. In some instances, two separate immune checkpoint protein encoding nucleic acid sequences may be employed, e.g., one encoding CD47 and one encoding PD-L1, e.g., each operably linked to the same or different constitutively active transcriptional response elements.
[0226] Provided kits include those containing one or more reagents for identifying whether a cancer will be responsive to an immune checkpoint inhibitor. Such kits may further include, e.g., in addition to one or more reagents for identifying whether the cancer will be responsive to an immune checkpoint inhibitor, one or more therapeutic agents (e.g., an immune checkpoint inhibitor) to be administered to a subject when the cancer is identified as likely to be responsive.
[0227] Provided kits include those containing one or more reagents for determining whether a cellular sample from a subject is an immune-evasive cancer or whether a cellular sample of a cancer from a subject is immune-evasive. Such kits may include, for example, reagents useful for determining whether a cellular sample overexpresses CD47, PD-L1 or both. Such kits may further include, e.g., in addition to one or more reagents for determining whether a cellular sample from a subject is an immune-evasive cancer or whether a cellular sample of a cancer from a subject is immune-evasive, one or more therapeutic agents (e.g., a MYC inhibitor) to be administered to a subject when the cancer is identified as immune evasive and/or as overexpressing CD47, PD-L1 or both. In some instances, such kits may include one or more therapeutic agents, e.g., a bromodomain and extra-terminal (BET) inhibitor, including but not limited to e.g., JQ1 or an analog thereof. In some instances, the subject kits may further include one or more conventional cancer therapeutics, e.g., one or more chemotherapeutics.
[0228] In addition to the above components, the subject kits and/or cell lines may further include (in certain embodiments) instructions for practicing the subject methods. These instructions may be present in the subject kits or provided with the subject cell lines in a variety of forms, one or more of which may be present in the kit or provided with the subject cell lines. One form in which these instructions may be present is as printed information on a suitable medium or substrate, e.g., a piece or pieces of paper on which the information is printed, in the packaging of the kit or cell line(s), in a package insert, and the like. Yet another form of these instructions is a computer readable medium, e.g., diskette, compact disk (CD), flash drive, and the like, on which the information has been recorded. Yet another form of these instructions that may be present is a website address which may be used via the internet to access the information at a removed site.
EXAMPLES
[0229] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Celsius, and pressure is at or near atmospheric. Standard abbreviations may be used, e.g., room temperature (RT); base pairs (bp); kilobases (kb); picoliters (pl); seconds (s or sec); minutes (m or min); hours (h or hr); days (d); weeks (wk or wks); nanoliters (nl); microliters (ul); milliliters (ml); liters (L); nanograms (ng); micrograms (ug); milligrams (mg); grams ((g), in the context of mass); kilograms (kg); equivalents of the force of gravity ((g), in the context of centrifugation); nanomolar (nM); micromolar (uM), millimolar (mM); molar (M); amino acids (aa); kilobases (kb); base pairs (bp); nucleotides (nt); intramuscular (i.m.); intraperitoneal (i.p.); subcutaneous (s.c.); and the like.
Example: Myc Regulates the Antitumor Immune Response Through CD47 and PD-L1
[0230] Materials and Methods
[0231] Transgenic Mice
[0232] Animals were identically raised and housed; immunocompromised mice were maintained on Bactrim chow. The Tet-off system transgenic lines used for conditional MYC expression and oncogene addiction have been previously described (Felsher et al. 1999, Shachaf et al. 2004, Weinstein et al. 2008). Ep-tTA/tet-O-MYC mice develop lymphoma/leukemia (MYC T-ALL) and LAP-tTA/tet-O-MYC mice develop HCC (MYC HCC). RAG1 KO mice on an FVB background were generously provided. Genotyping was performed using genomic DNA from animal tails. For transgenic primary tumors, a minimum of 3 mice were used per treatment condition group. Male mice were used for all transgenic mouse experiments and tumors arose at approximately 2-3 months of age.
[0233] Cell Culture
[0234] Hematopoietic tumor cell lines (MYC T-ALL 4188 cells derived from the transgenic mouse model, human P493-6, human T-ALL Jurkat, and human T-ALL CCRF-CEM) were grown in RPMI 1640 supplemented with 10% FBS, 1% penicillin/streptomycin, 50 M 2-mercaptoethanol at 37 C. in 5% CO2. Solid human tumor cell lines (H1299, SKMEL28), mouse MYC HCC, and human HEPG2 were grown in DMEM supplemented with 10% FBS and 1% penicillin/streptomycin at 37 C. in 5% CO2. To turn off expression of the MYC transgene, cells were treated with 20 ng/mL Dox. Primary human T-ALL cells were obtained from four deidentified patient samples and were cultured as previously described (Bruserud et al. 2003). Briefly, cells were cultured in StemSpan H3000 (StemCell) supplemented with human stem cell factor (50 ng/ml), human IL-7 (20 ng/ml), human IL-3 (20 ng/ml), and human FLT3 ligand (20 ng/ml) (Peprotech). Human cell lines were purchased from ATCC.
[0235] Overexpressions and Knockdowns
[0236] For forced expression of CD47 and PD-L1, cDNAs were cloned into MSCV-Hygro or MSCVPuro backbones. The plasmids (CD47, PD-L1, or empty control MSCV) were transfected into 293T cells and virus-containing medium supernatants were used to infect tumor cells using polybrene methodology. Infected cells were selected, expanded, forced expression confirmed, and prepared for injection. For forced expression, one cohort was collected at day 0 and day 4 after turning MYC off with doxycycline. These tissues were used for gene expression analysis and immunostaining. Another, separate cohort was followed for survival analysis.
[0237] shRNA-mediated knockdowns were performed with the pLKO.1 lentiviral vector containing either control, CD47, or PD-L1-specific shRNA. shRNA-mediated knockdown of human MYC was performed with the pLKO.1 lentiviral vector containing a scrambled control or MYC shRNA (Sigma). PD-L1 shRNA on a pLKO.1-puro backbone was purchased from Sigma and CD47 shRNA (Sigma) was cloned into a pLKO.1-Hygro backbone (Addgene). The plasmids were transfected into packaging cells and virus-containing medium supernatants were used to infect tumor cells using polybrene methodology. For conditional knockdowns, stable cell lines were generated and the time course following MYC inactivation with 20 ng/mL Dox is indicated. For stable knockdowns, the time course is indicated as the time post-viral infection.
[0238] Tumor Growth Assays
[0239] 1010.sup.6 tumor cells were injected subcutaneously in a volume of 100 ul into 4-6 week old female FVB animals and were allowed to form tumors of 1.5 cm in diameter. At that time, mice were either euthanized and tissues collected or treated with Dox in their drinking water (100 g/mL final concentration).
[0240] Reconstitutions of RAG1 KO Mice
[0241] 4-6 week old female FVB RAG1 KO mice were injected intravenously with 410.sup.6 purified CD4+ T cells that had been magnetically enriched from CAG-luc-eGFP L2G85 mice (Miltenyi Biotec beads and columns). Tumor cells were injected one week after reconstitution.
[0242] In Vivo Bioluminescence Imaging
[0243] Bioluminescence imaging was performed as previously described (Rakhra et al. 2010). Briefly, cell lines (
[0244] RNA Isolation, cDNA Preparation, and qPCR
[0245] All tissues and cells were flash-frozen in liquid nitrogen and stored at 80 C. until RNA preparation. RNA was isolated using the TRIzol Reagent (Invitrogen) according to manufacturer instructions. cDNA was synthesized using SuperScriptIII (ThermoFisher). qPCR was performed using specific primers (Table 51) and the SYBR Green qPCR Kit (Roche) in an Applied Biosystems Real-Time PCR System (Life Technologies) with QuantStudio12K Flex Software. Data was analyzed using the cycle threshold method (normalized to UBC). A minimum of 3 biological and 3 technical replicates were used for all qPCR experiments.
[0246] Lymphocyte Analysis and Flow Cytometry
[0247] Tissues were manually dissociated between microscope slides and strained to remove debris. Lysis buffer (0.15 M NH.sub.4Cl, 10 mM KHCO3, 0.1 mM EDTA pH 7.3) was used to remove red blood cells. Cells were washed and resuspended in cold flow cytometry buffer (1% FBS, 0.1% sodium azide in PBS). Staining was performed according to manufacturer instructions with the indicated antibodies (eBioscience). Labeled cells were analyzed on a FACSCalibur (Becton Dickinson), and data was analyzed using FlowJo (Treestar). Each plot is representative of three or more animals. Annexin-V and 7-AAD were used according to manufacturer's protocol (eBioscience).
[0248] Immunohistochemistry and Immunofluorescence
[0249] Immunohistochemistry and immunofluorescence were performed as previously described (Rakhra et al. 2010). Briefly, senescence-associated -galactosidase staining was performed on tissue sections that had been embedded in OCT freezing medium (Tissue Tek) and stored at 80 C. Tissue sections were warmed to room temperature, fixed in 0.5% glutaraldehyde in PBS, and washed in PBS pH 5.5. Sections were stained for 8 h in a solution containing 250 mM potassium ferricyanide, potassium ferrocyanide, and MgCl2 in PBS pH 5.5, mounted in 50% glycerol/PBS and promptly imaged.
[0250] CD31 staining was also performed on frozen sections. Briefly, slides were thawed, fixed in acetone, blocked in Dako serum-free blocking reagent, incubated in rat anti-mouse CD31 (1:50, BD Pharmingen) for 1.5 hours at room temperature, incubated with anti-rat biotinylated IgG (1:300) and Cy3-streptavidin (1:300) for 30 min at room temperature), and counterstained with DAPI.
[0251] CC3, PH3 (Cell Signaling), F4/80 (Invitrogen), CD69 (AbCam), CD47, and PD-L1 (R&D Systems) primary antibodies were used according to manufacturer recommendations. Tumors were fixed in 4% paraformaldehyde, embedded in paraffin, and sectioned. Sections were stained as previously described (4). CD47, PD-L1, CC3, and PH3 stainings were counterstained with DAPI and CD69 and F4/80 stainings were counterstained with hematoxylin.
[0252] Pictures were taken with 20-40 objectives on a Leica DM16000 microscope with LASAF software. At least 5 random fields per section and at least 3 tumors per experimental condition were imaged.
[0253] ChIP
[0254] ChIP-sequencing reads were aligned to the murine mm9 or the human hg19 reference genome using Bowtie v0.12.7 and binding traces were obtained using MACS v1.4.2. To allow comparisons across samples, all files were normalized to the same number of mappable reads. Binding profiles were visualized using the Integrated Genome Browser software (Nicol et al. 2009).
[0255] Nuclear Run-on
[0256] The nuclear run-on assay was performed as previously reported (Fan et al. 2010, Fan et al. 2012, Ji et al. 2011). Briefly, P493-6 nuclei were isolated using cell lysis buffer. The nascent RNA was labeled with Biotin-UTP. Total nuclear RNA was purified with the Qiagen RNeasy kit. Capture of Biotin-labeled nascent RNA was followed by cDNA synthesis, cRNA synthesis, and cRNA purification (Ambion TotalPrep RNA Amplification) before hybridization to the Affymetrix microarray platform.
[0257] Correlation of Gene Expression in Human Tumors
[0258] Correlation of MYC expression with immune-related surface receptors was determined using the R2 platform (R2: Genomics Analysis and Visualization Platform (http(colon)//r2(dot)amc(dot)nl)) with datasets for human liver (Wurmbach et al. 2007), kidney (Kort et al. 2008), and colon tumors (Julien et al. 2012). For each gene, one highly expressed probe was used to determine the Pearsons correlation coefficients and P-values.
[0259] Statistics
[0260] Differences between groups were analyzed using one-way ANOVA with a Tukey's post hoc test. A logrank test was performed for survival analysis (
[0261] Results
[0262] The MYC oncogene codes for a transcription factor that is overexpressed in many human cancers. Here we show that MYC regulates the expression of two immune checkpoint proteins on the tumor cell surface, the innate immune regulator, CD47 (Cluster of Differentiation 47) and the adaptive immune checkpoint, PD-L1 (programmed death-ligand 1). Suppression of MYC in mouse tumors and human tumor cells caused a reduction in the levels of CD47 and PD-L1 mRNA and protein. MYC was found to bind directly to the promoters of the CD47 and PD-L1 genes. MYC inactivation in mouse tumors downregulated CD47 and PD-L1 expression and enhanced the anti-tumor immune response. In contrast, when MYC was inactivated in tumors with enforced expression of CD47 or PD-L1, the immune response was suppressed and tumors continued to grow. Thus MYC appears to initiate and maintain tumorigenesis in part through the modulation of immune regulatory molecules.
[0263] MYC is a transcription factor that regulates the expression of a multitude of gene products involved in cell proliferation, growth, differentiation, and apoptosis (Felsher et al. 2009, Jain et al. 2002, Shachaf et al. 2004, Wu et al. 2007). The MYC gene is genetically activated and overexpressed in many human cancers (Felsher et al. 2009, Jain et al. 2002, Shachaf et al. 2004, Wu et al. 2007) and this overexpression has been causally linked to tumorigenesis (Sharma et al. 2006, Wang et al. 2006). Work with inducible transgenic mouse models has shown that growth of MYC-induced tumors is dependent on continuous expression of MYC (Felsher et al. 2009, Jain et al. 2002, Shachaf et al. 2004, Wu et al. 2007, Marinkovic et al. 2004, Hennighausen et al. 1995, Pelengaris et al. 2002, D'Cruz et al. 2001). For example, in the tetracycline-off mouse model (where MYC expression can be turned off by the addition of tetracycline or doxycycline), tumors grow only when MYC is on. When MYC is turned off, tumors regress.
[0264] MYC inactivation in mouse models results in tumor regression through the induction of proliferative arrest and apoptosis (Felsher et al. 2009, Jain et al. 2002, Shachaf et al. 2004, Marinkovic et al. 2004, Hennighausen et al. 1995, D'Cruz et al. 2001, Fisher et al. 2001, Huettner et al. 2000). We have demonstrated that complete tumor clearance following the inactivation of oncogenes, including MYC, requires the recruitment of CD4+ T cells and the secretion of Thrombospondin-1 (Rakra et al, 2010, Giuriato et al. 2006). Hence, a host-dependent immune response is required for sustained tumor regression. However, the mechanism by which oncogene inactivation elicits this immune response is unknown.
[0265] The host immune system generally serves as a barrier against tumor formation (Balkwill et al. 2001). Activation of the immune response can contribute to tumor regression (Rakhra et al. 2010, Gattinoni et al. 2006, Galon et al. 2014) through both adaptive and innate immune effectors (Shanker et al. 2007, Corthay et al. 2005, Qin et al. 2000). Programmed death-ligand 1 (or PD-L1, also known as CD274 and B7-H1) is a critical don't find me signal to the adaptive immune system (Parsa et al. 2007, Topalian et al. 2012, Tsushima et al. 2007), whereas CD47 is a critical don't eat me signal to the innate immune system as well as a regulator of the adaptive immune response (Jaiswal et al. 2009, Majeti et al. 2009) (
[0266] To explore whether and how MYC regulates the anti-tumor response, we examined its effect on the expression of CD47 and PD-L1 in the Tet-off transgenic mouse model of MYCinduced T cell acute lymphoblastic leukemia (MYC T-ALL). When MYC was on, both CD47 and PD-L1 were expressed. However, in vitro or in vivo MYC inactivation resulted in a rapid downregulation of CD47 and PD-L1, both at the mRNA level, as detected by quantitative realtime PCR (qPCR), and at the protein level, as detected by flow cytometry (
[0267] We next investigated the effect of MYC inactivation on CD47 and PD-L1 in mouse and human solid tumors. In a Tet-off transgenic mouse model of hepatocellular carcinoma (HCC) (Shachaf et al. 2004), inhibition of MYC expression resulted in decreased levels of CD47 and PD-L1 protein (
[0268] In additional experiments we found that MYC shRNA knockdown (
[0269] MYC can act as a general transcriptional amplifier (that is, it can generally increase expression of many genes rather than specific target genes), but dosage-dependent specific effects have been reported (Nie et al. 2012, Lin et al. 2012, Walz et al. 2014, Wiese et al. 2013, Choi et al. 2014). We applied ChIP (Chromatin ImmunoPrecipitation)-Seq analysis to mouse MYC T-ALL cells (Walz et al. 2014) and the human B cell line P493-6 (Schuhmacher et al. 1999, Sabo et al. 2014) and found high levels of MYC bound to the promoter regions of the genes coding for CD47 and PD-L1 (
[0270] PD-L1 expression was too low to measure changes in this experiment. Thus, we conclude that MYC binds to the promoters and directly regulates the expression of the CD47 and PD-L1 genes. An alternative but not mutually exclusive possibility is that MYC suppression acutely affects CD47 and PD-L1 surface protein expression by reducing the half-lives of the two proteins. However, we did not observe the increased turnover of CD47 or PD-L1 proteins compared to other immune surface proteins in mouse MYC T-ALL cells when we inhibited protein synthesis by cycloheximide treatment (
[0271] We have shown previously that MYC inactivation in mouse tumor models results in recruitment of immune cells to the tumors (Rakhra et al. 2010). To investigate the role of CD47 and PD-L1 in this process, we engineered MYC T-ALL 4188 cells to constitutively express CD47 or PD-L1 (
[0272] MYC inactivation induces tumor regression through both cell autonomous mechanisms, including proliferative arrest and induction of apoptosis, as well as through host-dependent mechanisms such as inhibition of tumor angiogenesis and induction of tumor cell senescence. We investigated the effect of enforced expression of CD47 or PD-L1 on these mechanisms. We found that CD47 or PD-L1 expression prevented the shutdown of angiogenesis following MYC inactivation, as measured by the presence of CD31+ microvessels (
[0273] We conclude that MYC regulation of CD47 and PD-L1 expression has a direct role in the initiation and maintenance of MYC-driven tumorigenesis (
[0274] Because transcription of their genes is regulated by MYC, CD47 and PD-L1 may be expressed at higher levels at steady state than other membrane proteins in tumors. Notably, MYC activation of the CD47 and PD-L1 genes appears to require higher levels of MYC binding to the CD47 and PD-L1 promoters compared with genes involved in normal cell growth; they may, therefore, represent promoters that have been invaded by oncogenic MYC levels (Lin et al. 2012, Wolf et al. 2015). Thus, these genes may be particularly sensitive to MYC withdrawal.
[0275] MYC activation may influence cancer immunoediting through the suppression of immune surveillance against tumor cells. We propose that during tumor evolution, high MYC expression results in increased expression of CD47 and PD-L1, suppressing both the innate and the adaptive immune response and favoring tumor growth (
[0276] Although the effects of MYC on the expression of CD47 and PD-L1 were modest, the consequences on tumor regression were dramatic, consistent with reports that small influences on immune regulators can have marked effects (Majeti et al. 2005). CD47 and PD-L1 both may also contribute to the tumor microenvironment through influence on T cell activation and angiogenesis (Rakhrs et al. 2010, Giuriato et al. 2006, Topalian et al. 2012, Waclavicek et al. 1997, Avice et al. 2001, Kaur et al. 2013). CD47 is the receptor for Thrombospondin-1, which may regulate cellular programs including angiogenesis, self-renewal and senescence (Rakhra et al. 2010, Giuriato et al. 2006, Kaur et al. 2013). We speculate that therapies suppressing MYC expression and activity may restore an immune response against human cancers. MYC-overexpressing human cancers may be especially vulnerable to an immune checkpoint blockade.
[0277]
[0278]
[0279]
[0280]
[0281]
[0282]
[0283]
[0284]
[0285]
[0286]
[0287]
[0288]
[0289]
[0290]
[0291]
[0292]
[0293]
[0294]
[0295]
[0296]
[0297]
TABLE-US-00021 TABLE 1 Primer sequences used for qPCR analysis of mRNA expression. SEQ ID Primer Sequence NO: Transgenic MYC Forward CTGCGACGAGGAGGAGAACT 21 Transgenic MYC Reverse GGCAGCAGCTCGAATTTCTT 22 Ang2 Forward AGCAGATTTTGGATCAGACCAG 23 Ang2 Reverse GCTCCTTCATGGACTGTAGCTG 24 Tie2 Forward CGGCTTAGTTCTCTGTGGAGTC 25 Tie2 Reverse GGCATCAGACACAAGAGGTAGG 26 p151nk4b Forward TCTTGGATCTCCACAAGC 27 p151nk4b Reverse CTCCAGGTTTCCCATTTAC 28 p19ARF Forward GTCGCAGGTTCTTGGTCACT 29 p19ARF Reverse ATCGCACGAACTTCACCAA 30 C047 Forward TGCGGTTCAGCTCAACTACTG 31 C047 Reverse GCTTTGCGCCTCCACATTAC 32 PO-L 1 Forward GCTCCAAAGGACTTGTACGTG 33 PO-L 1 Reverse TGATCTGAAGGGCAGCATTTC 34 UBC Forward AGCCCAGTGTTACCACCAAG 35 UBC Reverse ACCCAAGAACAAGCACAAGG 36 hC047 Forward GGCAATGACGAAGGAGGTTA 37 hC047 Reverse ATCCGGTGGTATGGATGAGA 38 hPD-L1 Forward GGCATTTGCTGAACGCAT 39 hPD-L1 Reverse CAATTAGTGCAGCCAGGT 40
[0298] Notwithstanding the appended clauses, the disclosure is also defined by the following clauses:
1. A method of identifying whether a subject having a cancer will be responsive to an immune checkpoint inhibitor, the method comprising:
[0299] (a) determining whether a cellular sample from the cancer overexpresses a MYC oncogene; and
[0300] (b) identifying the subject as (i) responsive to the immune checkpoint inhibitor when the determining indicates that the cancer overexpresses the MYC oncogene or (ii) as nonresponsive to the immune checkpoint inhibitor when the determining indicates that the cancer does not overexpress the MYC oncogene.
2. The method according to Clause 1, wherein the immune checkpoint inhibitor is a CD47 inhibitor.
3. The method according to Clause 1, wherein the immune checkpoint inhibitor is a PD-L1 inhibitor.
4. The method according to any of Clauses 1 to 3, wherein the method further comprises measuring the level of expression of the MYC oncogene in the cellular sample.
5. The method according to Clause 4, wherein the level of expression comprises an mRNA expression level.
6. The method according to Clauses 4 or 5, wherein the level of expression comprises a protein expression level.
7. The method according to any of Clauses 1 to 6, wherein the cancer is selected from the group consisting of: a lymphoma/leukemia, a carcinoma and a melanoma.
8. The method according to Clause 7, wherein the lymphoma/leukemia is acute lymphoblastic leukemia.
9. The method according to Clause 7, wherein the carcinoma is selected from the group consisting of: a hepatocellular carcinoma, a non-small cell lung carcinoma, a renal cell carcinoma and a colorectal carcinoma.
10. A method of treating a subject for a cancer, the method comprising:
[0301] (a) identifying whether the cancer will be responsive to an immune checkpoint inhibitor according to any of Clauses 1 to 9; and
[0302] (b) administering an effective amount of an agent to the subject to treat the cancer, wherein when the cancer is identified as responsive the agent is the immune checkpoint inhibitor.
11. A method of treating a subject for an immune-evasive cancer, the method comprising:
[0303] (a) determining whether a cellular sample of the immune-evasive cancer obtained from the subject overexpresses CD47, PD-L1 or both; and
[0304] (b) administering an effective amount of an agent to the subject to treat the immune-evasive cancer, wherein when the cellular sample is determined to overexpress CD47, PD-L1 or both the agent is a MYC inhibitor.
12. The method according to Clause 11, wherein the immune-evasive cancer is a recurrent cancer.
13. The method according to Clauses 11 or 12, wherein the immune-evasive cancer is a cancer that was nonresponsive to a prior cancer therapy.
14. The method according to Clause 13, wherein the prior cancer therapy comprised administering to the subject a chemotherapeutic agent selected from the group consisting of: prednisone, cytoxan, cisplatin, and vincristine.
15. The method according to any of Clauses 11 to 14, wherein the MYC inhibitor is a bromodomain and extra-terminal (BET) inhibitor.
16. The method according to Clause 15, wherein the BET inhibitor is JQ1 or an analog thereof.
17. The method according to any of Clauses 11 to 16, wherein the method further comprises administering to the subject a chemotherapeutic agent.
18. The method according to Clause 17, wherein the chemotherapeutic agent is selected from the group consisting of: prednisone, cytoxan, cisplatin, and vincristine.
19. The method according to any of Clauses 11 to 18, wherein the method further comprises measuring a level of expression of CD47, PD-L1 or both in the cellular sample.
20. The method according to Clause 19, wherein the level of expression comprises an mRNA expression level.
21. The method according to Clauses 19 or 20, wherein the level of expression comprises a protein expression level.
22. The method according to any of Clauses 11 to 21, wherein the immune-evasive cancer is selected from the group consisting of: a lymphoma/leukemia, a carcinoma and a melanoma.
23. The method according to Clause 22, wherein the lymphoma/leukemia is acute lymphoblastic leukemia.
24. The method according to Clause 22, wherein the carcinoma is selected from the group consisting of: a hepatocellular carcinoma, a non-small cell lung carcinoma, a renal cell carcinoma and a colorectal carcinoma.
25. A method of identifying a therapeutic agent that is effective during MYC-regulated immune evasion of a cancer cell, the method comprising:
[0305] (a) contacting (i) a first tumor cell line conditionally expressing a MYC oncogene and (ii) a second tumor cell line conditionally expressing a MYC oncogene and a MYC-independent constitutively expressed immune checkpoint protein with a candidate therapeutic agent;
[0306] (b) determining the effect of the contacting on a behavior of the contacted conditional tumor cell lines;
[0307] (c) identifying the candidate agent as a therapeutic agent that is effective during MYC-regulated immune evasion of a cancer cell if the determined behavior of the first conditional tumor cell line (i) is reduced as compared to a non-contacted control and the determined behavior of the second conditional tumor cell line (ii) is not reduced as compared to a non-contacted control.
26. The method according to Clause 25, wherein the contacting is performed in vitro.
27. The method according to Clause 26, wherein the in vitro contacting comprises three-dimensional cell culture.
28. The method according to Clause 25, wherein the contacting is performed in vivo.
29. The method according to Clause 28, wherein the contacting is performed in a non-human mammal.
30. The method according to Clause 29, wherein the non-human mammal is a rodent.
31. The method according to Clause 30, wherein the rodent is a mouse.
32. The method according to any of Clauses 25 to 31, wherein the MYC-independent constitutively expressed immune checkpoint protein is CD47.
33. The method according to any of Clauses 25 to 32, wherein the MYC-independent constitutively expressed immune checkpoint protein is PD-L1.
34. The method according to any of Clauses 25 to 33, wherein the second tumor cell line constitutively expresses both CD47 and PD-L1.
35. The method according to any of Clauses 25 to 34, wherein the behavior comprises cell line expansion.
36. The method according to Clause 35, wherein the method comprises quantifying cell line expansion.
37. The method according to any of Clauses 25 to 36, wherein the behavior comprises cell line survival.
38. The method according to Clause 37, wherein the method comprises quantifying cell line survival.
39. The method according to any of Clauses 25 to 38, wherein the therapeutic agent that overcomes MYC-regulated immune evasion inhibits MYC induced expression of one or more immune checkpoint genes.
40. The method according to Clause 39, wherein the one or more immune checkpoint genes is CD47, PD-L1 or both.
41. The method according to any of Clauses 25 to 40, wherein the method further comprises quantifying the expression of the one or more immune checkpoint genes.
42. The method according to Clause 41, wherein the quantifying comprises mRNA expression analysis of the one or more immune checkpoint genes.
43. The method according to Clauses 41 or 42, wherein the quantifying comprises protein expression analysis of the one or more immune checkpoint genes.
44. The method according to any of Clauses 25 to 43, wherein the method further comprises providing the first and second tumor cell lines.
45. The method according to any of Clauses 25 to 44, wherein the conditional MYC expression of the first and second cell lines is controlled by a tetracycline-based system.
46. The method according to any of Clauses 25 to 44, wherein the conditional MYC expression of the first and second cell lines is controlled by a tamoxifen-based system.
47. The method according to any of Clauses 25 to 46, wherein the first and second tumor cell lines are derived from a cancer selected from the group consisting of: lymphoma/leukemia, carcinoma and melanoma.
48. The method according to Clause 47, wherein the lymphoma/leukemia is acute lymphoblastic leukemia.
49. The method according to Clause 47, wherein the carcinoma is selected from the group consisting of: hepatocellular carcinoma, non-small cell lung carcinoma, renal cell carcinoma and colorectal carcinoma.
50. A cancer cell line comprising:
[0308] (a) an inducible MYC locus comprising a MYC encoding nucleic acid sequence operably linked to a transcriptional response element; and
[0309] (b) a MYC-independent constitutively active locus comprising an immune checkpoint protein encoding nucleic acid sequence operably linked to a constitutively active promoter.
51. The cancer cell line according to Clause 50, wherein the immune checkpoint protein encoding nucleic acid sequence encodes CD47.
52. The cancer cell line according to Clause 50, wherein the immune checkpoint protein encoding nucleic acid sequence encodes PD-L1.
53. The cancer cell line according to any of Clauses 50 to 52, wherein the immune checkpoint protein encoding nucleic acid sequence encodes CD47 and PD-L1.
54. The cancer cell line according to any of Clauses 50 to 53, wherein the transcriptional response element is a tetracycline-dependent promoter.
55. The cancer cell line according to any of Clauses 50 to 53, wherein the transcriptional response element is a GAL4 responsive upstream activating sequence (UAS).
56. The cancer cell line according to any of Clauses 50 to 55, wherein the inducible MYC locus further comprises a conditional genetic stop sequence between the transcriptional response element and the MYC encoding nucleic acid sequence.
57. The cancer cell line according to any of Clauses 50 to 56, wherein the cancer cell line is a lymphoma/leukemia cell line, a carcinoma cell line or a melanoma cell line.
58. The cancer cell line according Clause 57, wherein the lymphoma/leukemia cell line is an acute lymphoblastic leukemia cell line.
59. The cancer cell line according to Clause 57, wherein the carcinoma cell line is a hepatocellular carcinoma cell line, a non-small cell lung carcinoma cell line, a renal cell carcinoma cell line or a colorectal carcinoma cell line.
60. A transgenic non-human mammal comprising a cancer cell comprising:
[0310] (a) an inducible MYC locus comprising a MYC encoding nucleic acid sequence operably linked to a transcriptional response element; and
[0311] (b) a MYC-independent constitutively active locus comprising an immune checkpoint protein encoding nucleic acid sequence operably linked to a constitutively active promoter.
61. The transgenic non-human mammal according to Clause 60, wherein the transgenic non-human mammal is a rodent.
62. The transgenic non-human mammal according to Clause 61, wherein the rodent is a mouse.
63. The transgenic non-human mammal according to Clause 60, wherein the transgenic non-human mammal is a non-human primate.
64. The transgenic non-human mammal according to any of Clauses 60 to 63, wherein the immune checkpoint protein encoding nucleic acid sequence encodes CD47.
65. The transgenic non-human mammal according to any of Clauses 60 to 63, wherein the immune checkpoint protein encoding nucleic acid sequence encodes PD-L1.
66. The transgenic non-human mammal according to any of Clauses 60 to 65, wherein the immune checkpoint protein encoding nucleic acid sequence encodes CD47 and PD-L1.
67. The transgenic non-human mammal according to any of Clauses 60 to 66, wherein the transcriptional response element is a tetracycline-dependent promoter.
68. The transgenic non-human mammal according to any of Clauses 60 to 66, wherein the transcriptional response element is a GAL4 responsive upstream activating sequence (UAS).
69. The transgenic non-human mammal according to any of Clauses 60 to 68, wherein the inducible MYC locus further comprises a conditional genetic stop sequence between the transcriptional response element and the MYC encoding nucleic acid sequence.
70. The transgenic non-human mammal according to any of Clauses 60 to 69, wherein the cancer cell is a lymphoma/leukemia cell, a carcinoma cell or a melanoma line.
71. The transgenic non-human mammal according to Clause 70, wherein the lymphoma/leukemia cell is an acute lymphoblastic leukemia cell.
72. The transgenic non-human mammal according to Clause 70, wherein the carcinoma cell is a hepatocellular carcinoma cell, a non-small cell lung carcinoma cell, a renal cell carcinoma cell or a colorectal carcinoma cell.
73. A kit comprising:
[0312] a reagent for measuring the expression of MYC in a cellular sample from a subject; and
[0313] an immune checkpoint inhibitor.
74. The kit according to Clause 73, wherein the reagent for measuring the expression of MYC is a reagent that specifically binds MYC protein.
75. The kit according to Clause 74, wherein the reagent that specifically binds MYC protein is detectably labeled.
76. The kit according to Clauses 73 or 74, wherein the reagent that specifically binds MYC protein is an anti-MYC antibody.
77. The kit according to Clause 73, wherein the reagent for measuring the expression of MYC is a reagent that specifically binds a MYC encoding mRNA.
78. The kit according to Clause 76, wherein the reagent that specifically binds the MYC encoding mRNA is detectably labeled.
79. The kit according to Clauses 77 or 78, wherein the reagent that specifically binds the MYC encoding mRNA is a nucleic acid probe that specifically hybridizes to the MYC encoding mRNA.
80. The kit according to any of Clauses 73 to 79, wherein the immune checkpoint inhibitor is selected from the group consisting of: a PD-L1 inhibitor, a PD1 inhibitor, a CD47 inhibitor and a SIRP inhibitor.
81. The kit according to any of Clause 73 to 80, wherein the kit comprises two or more immune checkpoint inhibitors.
82. The kit according to Clause 81, wherein the two or more immune checkpoint inhibitors comprise a first immune checkpoint inhibitor selected from a PD-L1 inhibitor or a PD1 inhibitor and a second immune checkpoint inhibitor selected from a CD47 inhibitor or a SIRP inhibitor.
[0314] The preceding merely illustrates the principles of the invention. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope. Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of the invention and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present invention, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of the present invention is embodied by the appended claims.