Inhibition of a xylosyltransferase to improve saccharification efficiency

10233457 ยท 2019-03-19

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides compositions and methods for inhibiting the expression of the gene XAX1 in grass plants. Plants with inhibited expression of XAX1 have use, e.g., in biofuel production by increasing the amount of soluble sugar that can be extracted from the plant.

Claims

1. A method of improving the amount of soluble sugar obtained from rice plant biomass material, the method comprising: inhibiting endogenous XAX1 in a rice plant; determining that the rice plant has reduced levels of ferulic acid in the cell wall compared to a wildtype rice plant; selecting the rice plant; providing biomass material from the rice plant; performing a saccharification reaction; and obtaining soluble sugar at a level at least 10% higher than that obtained from a wildtype rice plant in which endogenous XAX1 gene expression is not inhibited.

2. A method of improving the amount of soluble sugar obtained from grass plant biomass material, the method comprising: deleting or mutating an endogenous XAX1 gene encoding amino acid SEQ ID NO:2; or deleting or mutating the promoter of the endogenous XAX1 gene, in a rice plant; determining that the rice plant has reduced levels of ferulic acid in the cell wall compared to a wildtype rice plant; selecting the rice plant; providing biomass material from the rice plant performing a saccharification reaction; and obtaining soluble sugar at a level at least 50% higher than that obtained from the wildtype rice plant that does not have the genetic alteration.

3. The method of claim 2, wherein the rice plant comprises an exogenous XAX1 gene encoding the amino acid sequence of SEQ ID NO:2 operably linked to a vessel-specific promoter.

4. The method of claim 2, wherein the endogenous XAX1 gene is knocked out.

5. The method of claim 2, wherein the endogenous XAX1 gene is deleted.

6. The method of claim 2, wherein the endogenous XAX1 gene is deleted.

7. The method of claim 2, wherein the endogenous XAX1 gene promoter is mutagenized.

8. The method of claim 2, wherein the rice plant has at least a 10% reduction in the level of hydroxycinnamate esters compared to a corresponding wildtype rice plant.

9. The method of claim 2, wherein the rice plant has at least a 10% reduction in lignin content in comparison to a corresponding wildtype rice plant.

10. The method of claim 1, wherein the rice plant is genetically modified to express a polynucleotide that encodes the amino acid sequence of SEQ ID NO:2 and the polynucleotide is operably linked to a vessel-specific promoter.

11. The method of claim 1, wherein the rice plant has at least a 10% reduction in the level of hydroxycinnamate esters compared to a corresponding wildtype rice plant.

12. The method of claim 1, wherein the plant has at least a 10% reduction in lignin content in comparison to a corresponding wildtype rice plant.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1. XAX1 T-DNA insertional rice mutant. (A) Dwarfed phenotype of XAX1 plants at 5 weeks. (B) Monosaccharide composition of total plant cell wall after TFA hydrolysis, separated and quantified on the HPAEC. (C) Ferulic and p-coumaric acid amounts released upon base-hydrolysis of total cell wall preparations and acid-catalyzed depolymerization of carbohydrate-free residues. (D) Saccharification of cell wall after 120 C. pretreatment and cellulase and hemicellulase enzymatic digestion; quantified by DNS. Error bars represent SD with at least 3 biological reps.

(2) FIG. 2. Xylan fingerprinting and characterization of oligomer lacking in mutant. (A) HPAEC profiles of oligosaccharides released after endoxylanase treatment of xylan, showing peak 1 not found in mutant plants. Profile consistent between three biological replicates. (B) LC-MS of isolated peak 1 fraction from wild type rice. (C) Proposed structure of peak 1 lacking in XAX1 mutant plants consistent with mass and insensitivity to arabinofurosidase.

(3) FIG. 3. Characterization of XAX1 protein localization and function. (A) Subcellular localization of fluorescently tagged XAX1 proteins. Confocal imaging (40) of onion epidermal cells expressing, XAX1-YFP and GmMan1-CFP, the -mannosidae Golgi marker. Scale bar is 50 m. (B) Relative expression of XAXT in wild type rice. Key: col=coleoptile, sdl=7 dpg seedling, till=30 dpg tiller, yl=30 dpg young leaf, ol=30 dpg old leaf, ip4=immature panicle of 4 cm, ip6=developing panicle of 6 cm, elp=emerging panicle, fl=flag leaf, ml=mature leaf, ms=mature stem. (C) Xylosyltransferase activity reaction products. UDP-[.sup.14C]Xylose incorporation to microsomes with an endogenous acceptor. Negative control is leaves infiltrated without XAX1 and represents the endogenous xylosyltransferase activity. Error bars are SEM with n=3 biological reps.

(4) FIG. 4. XAX1 T-DNA insertional rice mutant. (A) Location of the T-DNA insertion. Image modified from RiceGE. (B) Protein structure of XAX1: N-terminal transmembrane domain and C-terminal DUF563 domain characteristic of GT61 family genes. (C) Confirmation of XAX1 knock out. Segregating wild type plants were used as negative control.

(5) FIG. 5. Cell wall composition analysis. (A) Total sugar composition with total TFA hydrolysis with sugar separation and quantification on the HPAEC (B) Total sugar composition with 0.1% TFA partial hydrolysis (C) Cellular fractionation: CDTA fraction (D) Na.sub.2CO.sub.3 fraction (E) 1M KOH fraction (F) Sulfuric acid treatment of pellet (G) Saccharification assay and DNS quantification of sugars using an enzyme mixture of cellulases and -mannosidases. Error bars represent SD (n=4).

(6) FIG. 6. Xylan composition analysis. (A) Size-exclusion chromatography (SEC) profiles of wild-type and mutant. Fractions soluble in 1 M KOH were analyzed by SEC using a Superose 12 column. The elution times of dextran molecular markers are indicated. Three biological replicates of both WT and mutant were analyzed and only insignificant differences could be observed. (B) HPAEC profile of arabinofuranosidase treatment of isolated peak 1 from wild type rice showing no shift in retention time consistent with no arabinose release indicating that peak 1 has no terminal arabinose. (C) HPAEC profile of TFA hydrolysis of isolated peak 1 from wild type rice showing xylose and arabinose peaks. (D) Analysis of endogenous products after UDP-[.sup.14C]Xylose incubation with microsomes. TFA hydrolyzed product of activity assay (FIG. 3C), run on a TLC plate to separate sugars. Fraction 2 is where Arabinose runs and fraction 4 is where xylose runs. Less than 22% of the counts are in the arabinose fraction, indicating that the epimerase activity is minimal. (E) HPAEC profile of Xylan fingerprinting of Selaginella leaves after xylanase treatment showing lack of peaks that contain arabinose (as seen in FIG. 2A).

DETAILED DESCRIPTION OF THE INVENTION

Definitions

(7) The term XAX1 gene, in the context of this invention, refers to a nucleic acid that encodes a grass-specific member of family GT6 that has xylosyltransferase activity. In some embodiments, an XAX1 gene or XAX1 nucleic acid comprises the nucleic acid sequence of SEQ ID NO:1 or SEQ ID NO:3 or a fragment thereof, or is substantially identical to SEQ ID NO:1 or SEQ ID NO:3 or a fragment thereof. Thus, a XAX1 gene can, for example, (1) have at least 70% identity, 75% identity, 80% identity, 85% identity, 90% identity, at least 95% or greater, identity to SEQ ID NO:1 or SEQ ID NO:3 or to a fragment thereof over a comparison window of at least 200, 250, 300, 350, 400, 450, or more nucleotides; or (2) comprise at least 200, 250, 300, 350, 400, 450, or more, contiguous nucleotides of SEQ ID NO:1 or SEQ ID NO:3. In some embodiments, an XAX1 gene encodes a polypeptide that has at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or greater identity to SEQ ID NO:2. In some embodiments, an XAX1 gene encodes a polypeptide that has at least region 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or greater identity to residues 605-780 of SEQ ID NO:2.

(8) A XAX1 polypeptide is an amino acid sequence encoded by a XAX1 nucleic acid. In some embodiments, an XAX1 polypeptide comprises the amino acid sequence of SEQ ID NO:2, or is substantially identical to SEQ ID NO:2 or a fragment or domain thereof that has xylosytransferase activity.

(9) As used herein, a homolog or ortholog of an XAX1 gene is a second gene in the same plant type or in a different plant type that is substantially identical (determined as described below) to a sequence in a first gene.

(10) The terms nucleic acid and polynucleotide are used interchangeably and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5 to the 3 end. A nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs may be used that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphosphoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); positive backbones; non-ionic backbones, and non-ribose backbones. Thus, nucleic acids or polynucleotides may also include modified nucleotides that permit correct read-through by a polymerase. Polynucleotide sequence or nucleic acid sequence includes both the sense and antisense strands of a nucleic acid as either individual single strands or in a duplex. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc.

(11) The terms decreased expression, reduced expression, or inhibited expression of an endogenous XAX1 gene refer interchangeably to a reduction in the level of expression of the XAX1 gene in an engineered plant in which XAX1 gene expression has been disrupted compared to the level of expression in a wild-type plant in which XAX1 expression has not been disrupted. Thus, decreased expression can be a reduction in expression of an XAX1 gene of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% or greater. Decreased expression can be assessed by measuring decreases in the level of RNA encoded by the gene and/or decreases in the level of XAX1 protein or protein activity. XAX1 protein/protein activity can be assessed directly or indirectly, e.g., by measuring an endpoint such as amount of sugar extractable from a plant in which a XAX1 gene is inhibited, or by assessing levels of ferulic and/or coumaric acids in a plant in which a XAX1 gene is inhibited. Activity may also be assessed by measuring xylosyltransferase activity, for example using microsome from the plant to measure activity onto endogenous xylan acceptors.

(12) In the context of this invention, the phrase functionally inactive with regard to an endogenous XAX1 gene means that the XAX1 gene is deleted or otherwise mutated or inhibited, such that expression of the gene does not occur, or occurs at a low level, e.g., at a level of less than 20% or less than 10% compared to a corresponding in plant in which the XAX1 gene is not deleted or otherwise mutated or inhibited.

(13) The phrase substantially identical, in the context of two nucleic acids or polypeptides, refers to a sequence or subsequence that has at least 50% identity, typically at least 60% sequence identity, to a reference sequence. Percent identity can be any integer from 50% to 100%. In some embodiments, a sequence is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical when compared to a reference sequence. For example, an XAX1 polypeptide may have a sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a sequence of SEQ ID NO:2.

(14) In the case of inhibition of endogenous genes (e.g., by antisense, or sense suppression) one of skill will recognize that the introduced polynucleotide sequence need not be perfectly identical and may be substantially identical to a sequence of the gene from which it was derived. One of skill will also recognize that for inhibition of endogenous genes, the introduced sequence need not be perfectly identical to a sequence of the target endogenous gene. The introduced polynucleotide sequence will typically be at least substantially identical (as determined below) to the target endogenous sequence. Thus, an introduced polynucleotide sequence from an XAX1 gene may not be identical to the target XAX1 gene to be suppressed, but is functional in that it is capable of inhibiting expression of the target XAX1 gene.

(15) Two nucleic acid sequences or polypeptides are said to be identical if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The term complementary to is used herein to mean that the sequence is complementary to all or a portion of a reference polynucleotide sequence.

(16) Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Add. APL. Math. 2:482 (1981), by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. (U.S.A.) 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection. In some embodiments, percent identity is determined using the BLAST2 algorithm set at the default settings.

(17) Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. A comparison window may be, e.g., 20, 50, 100, 400, or more nucleotides ore amino acids in length; or may be the entire length of the sequences being compared.

(18) Proteins that are substantially identical include those that have conservative amino acid substitutions. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, aspartic acid-glutamic acid, and asparagine-glutamine.

(19) Another indication that nucleotide sequences are substantially identical is if two molecules hybridize to each other, or a third nucleic acid, under stringent conditions. Stringent conditions are sequence dependent and will be different in different circumstances. Generally, stringent conditions are selected to be about 5 C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is about 0.02 molar at pH 7 and the temperature is at least about 60 C. For example, stringent conditions for hybridization, such as RNA-DNA hybridizations in a blotting technique are those which include at least one wash in 0.2SSC at 55 C. for 20 minutes, or equivalent conditions.

(20) The term recombinant, when used in reference to, e.g., a cell or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.

(21) The term endogenous in the context of this invention refers to a gene or protein that is originally present in a naturally occurring grass plant. Conversely, an exogenous gene or protein is one that originates outside the grass plant. This may be a gene or protein from another species, but also refers to a gene or protein that is from the same species, but that is encoded by a recombinant construct that is introduced into the plant.

(22) The term expression vector refers to a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a host cell. The expression vector can be part of a plasmid, virus, or nucleic acid fragment. Typically, the expression vector includes a nucleic acid to be transcribed operably linked to a promoter.

(23) The term biomass, as used herein, refers to plant material that is processed to provide a product, e.g., a biofuel such as ethanol, or livestock feed. Such plant material can include whole plants, or parts of plants, e.g., stems, leaves, branches, shoots, roots, tubers, and the like.

(24) The term plant, as used herein, refers to whole plants, shoot vegetative organs and/or structures (e.g., leaves or stems), branches, roots, flowers and floral organs (e.g., bracts, sepals, petals, stamens, carpels, anthers), ovules (including egg and central cells), seed (including zygote, embryo, endosperm, and seed coat), fruit (e.g., the mature ovary), seedlings, and plant tissue (e.g., vascular tissue, ground tissue, and the like). The term also encompasses individual plant cells, groups of plant cells (e.g., cultured plant cells), protoplasts, plant extracts, seeds, and progeny thereof. The term includes plants of a variety of a ploidy levels, including polyploid, diploid and haploid.

(25) The term progeny refers generally to the offspring of a cross, and includes direct F1 progeny, as well as later generations of F2, F3, etc.

(26) The terms saccharification or saccharification reaction refer to a process of converting biomass, usually cellulosic or lignocellulosic biomass, into monomeric sugars, such as glucose and xylose. Soluble sugar refers to the monomeric sugar that is produced from the saccharification of biomass.

(27) The term improving the amount or improved amount, when referring to an amount of sugar or soluble sugar obtained from a plant of the present invention, refers to an increase in the amount or yield of sugar that is obtained from saccharification of biomass per amount of starting material, in comparison to corresponding biomass from a wild-type plant. In the context of the present invention, corresponding biomass from a wild-type plant refers to plant material that is from the same part of the plant as the biomass from a plant having inhibited expression of an endogenous XAX1 gene. As understood in the art, improved amount or improved yield is based upon comparisons of the same amount of corresponding plant material. As used herein, increasing sugar extractability refers to the ability to increase the yield of sugar from saccharification of biomass per amount of starting material.

(28) The term bulk harvested material refers to combined plant material harvested from at least two plants, preferably at least 5, 10, 25, 50, 100, 500, or 1000 or more plants. The plant material may be whole plants, or parts of the plants, e.g., leaves or stems harvested from the plants. In some embodiments, the plant material present in the bulk harvested material is crushed or milled to a desired particle size, e.g., a size that is useful for producing biofuel.

INTRODUCTION

(29) This invention is based, in part, on the discovery that a putative glycosyltransferase in a grass-specific subfamily of family GT6, is a xylosyltransferase, XAX1, and that the inhibition of the gene XAX1 in grass plants results in decreased levels of xylose, ferulic acid, and coumaric acid compared to wildtype plants and in improved saccharification efficiency, an important trait for the production of cellulosic biofuels.

(30) In some embodiments, endogenous XAX1 expression is inhibited in some tissues of a grass plant, e.g., in non-vascular tissues, but expression of an XAX1 polypeptide is maintained in other tissues, e.g., vascular tissues by providing an exogenous XAX1 gene that is expressed in a tissue-specific manner. This provides for a plant that is suitable for biomass energy, and the plant, or biomass material (e.g., stems, leaves, branches, shoots, roots, tubers, and the like) or bulk harvested material from the plant is used in a saccharification reaction to obtain an increased amount of soluble sugar, which can, e.g., be used for biofuel production.

(31) The present invention also provides methods of obtaining an increased amount of soluble sugars from a plant, or from biomass material or bulk harvested material from the plant, by inhibiting endogenous XAX1 expression in the plant. In some embodiments, the amount of soluble sugar that can be extracted from the plant is at least 10% more than what can be extracted from a wild-type plant in which XAX1 expression has not been inhibited.

(32) In some embodiments, e.g., where inhibiting endogenous XAX1 expression results in decreased growth relative to a wildtype plant, a plant can be additionally modified to express an exogenous XAX1 gene in a desired tissue, such as vessels. A plant in which endogenous XAX1 expression is inhibited can also be further bred, e.g., back-crossed, for a desired property such as improved growth.

(33) Plants in which XAX1 Expression can be Inhibited

(34) The expression of XAX1 expression can be inhibited as described herein in various kinds of grass plants, including, but not limited rice, wheat, oats, rye, barley, corn, sorghum, millet, miscanthus, sugarcane, bamboo, turfgrass, brachypodium, switchgrass, hemp, meadow-grass, bluestem grass, brome-grass, festuca, ryegrass, and bentgrass.

(35) Inhibition of XAX1 Expression

(36) The invention employs various routine recombinant nucleic acid techniques. Generally, the nomenclature and the laboratory procedures in recombinant DNA technology described below are those well known and commonly employed in the art. Many manuals that provide direction for performing recombinant DNA manipulations are available, e.g., Sambrook & Russell, Molecular Cloning, A Laboratory Manual (3rd Ed, 2001); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994-1999, updated through 2008).

(37) A. XAX1 Nucleic Acids and Proteins

(38) XAX1 is a member of a grass-specific subfamily of GT61 proteins. An example of a rice XAX1 protein sequence is provided in SEQ ID NO:2. The sequence is closely related to protein sequences in sorghum (e.g., SEQ ID NOS:5 and 8) and Brachypodium (e.g., SEQ ID NOS:4, 6, and 7), For example, the rice XAX1 amino acid sequence SEQ ID NO:2 has 82% identity to SEQ ID NO:6 (Bradi3g11340.1); 78% identity to SEQ ID NO:7 (Bradi1g06560.1) 74% identity to SEQ ID NO:8 (Sb04g000840.1); 70% identity to SEQ ID NO:4 (Bradi4g27360.1); 69% to SEQ ID NO:5 (Sb10g018270.1). SEQ ID NO:2 also has 63% identity to the protein encoded by Sb03g008020.1; 62% identity to the protein encoded by Bradi2g01380.1, 54% identity to the protein encoded by Os12g13640.1, and 51% identity to the protein encoded by Sb03g008010.1_(S.bicolor).

(39) An XAX1 nucleic acid that is targeted for inhibition in the present invention encodes a protein that is substantially identical to SEQ ID NO:2. Substantially identical, as used herein, refers to a sequence or subsequence that has at least 45% or 50% identity, typically at least 60% sequence identity or at least 70% sequence identity or higher, to a reference sequence.

(40) Thus, in some embodiments, a XAX1 nucleic acid that is targeted for inhibition in the present invention encodes a polypeptide comprising a sequence that is at least 70% identical or at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or at least 99% identical to an amino acid of SEQ ID NO:2, or a fragment thereof. In some embodiments, a XAX1 nucleic acid that is targeted for inhibition is at least 70% identical, at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to at least 100 contiguous nucleotides, or at least 200 contiguous nucleotides, of a nucleic acid sequence encoding SEQ ID NO:2.

(41) In some embodiments, a XAX1 nucleic acid that is targeted for inhibition in the present invention comprises a sequence having at least 70%, at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a nucleic acid sequence of SEQ ID NOs:1 or 3, or a fragment thereof. In some embodiments, a XAX1 nucleic acid that is targeted for inhibition is at least 70% identical, at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to at least 200 contiguous nucleotides of a nucleic acid sequence of SEQ ID NO:1 or SEQ ID NO:3.

(42) B. Methods of Inhibiting XAX1 Expression

(43) The invention provides methods of improving the amount of soluble sugar extractable from a grass plant, grass plant biomass material, or bulk harvested material from a grass plant by inhibiting expression of a nucleic acid molecule encoding XAX1. Endogenous expression of the XAX1 gene can be inhibited using any number of techniques well known in the art, such as antisense, siRNA, microRNA, dsRNA, sense suppression, mutagenesis, or use of a dominant negative inhibition strategy. In some embodiments, the level of expression of the protein is reduced.

(44) In some embodiments, XAX1 expression is inhibited by an antisense polynucleotide. In antisense technology, a nucleic acid segment from the desired gene is cloned and operably linked to a promoter such that the antisense strand of RNA will be transcribed. The expression cassette is then transformed into plants and the antisense strand of RNA is produced. In plant cells, it has been suggested that antisense RNA inhibits gene expression by preventing the accumulation of mRNA which encodes the enzyme of interest, see, e.g., Sheehy et al., Proc. Nat. Acad. Sci. USA, 85:8805-8809 (1988); Pnueli et al., The Plant Cell 6:175-186 (1994); and Hiatt et al., U.S. Pat. No. 4,801,340.

(45) The antisense nucleic acid sequence transformed into plants will be substantially identical to at least a portion of the endogenous gene or genes to be repressed. The sequence, however, does not have to be perfectly identical to inhibit expression. Thus, an antisense or sense nucleic acid molecule encoding only a portion of a XAX1-encoding sequence can be useful for producing a plant in which XAX1 expression is suppressed. The vectors of the present invention can be designed such that the inhibitory effect applies to other proteins within a family of genes exhibiting homology or substantial homology to the target gene.

(46) For antisense suppression, the introduced sequence also need not be full length relative to either the primary transcription product or fully processed mRNA. Generally, higher homology can be used to compensate for the use of a shorter sequence. Furthermore, the introduced sequence need not have the same intron or exon pattern, and homology of non-coding segments may be equally effective. In some embodiments, a sequence of at least, e.g., 20, 25, 30, 50, 100, 200, or more continuous nucleotides (up to mRNA full length) substantially identical to an endogenous XAX1 mRNA, or a complement thereof, can be used.

(47) Catalytic RNA molecules or ribozymes can also be used to inhibit expression of a XAX1 gene. It is possible to design ribozymes that specifically pair with virtually any target RNA and cleave the phosphodiester backbone at a specific location, thereby functionally inactivating the target RNA. In carrying out this cleavage, the ribozyme is not itself altered, and is thus capable of recycling and cleaving other molecules, making it a true enzyme. The inclusion of ribozyme sequences within antisense RNAs confers RNA-cleaving activity upon them, thereby increasing the activity of the constructs.

(48) A number of classes of ribozymes have been identified. One class of ribozymes is derived from a number of small circular RNAs that are capable of self-cleavage and replication in plants. The RNAs replicate either alone (viroid RNAs) or with a helper virus (satellite RNAs). Examples include RNAs from avocado sunblotch viroid and the satellite RNAs from tobacco ringspot virus, lucerne transient streak virus, velvet tobacco mottle virus, solanum nodiflorum mottle virus and subterranean clover mottle virus. The design and use of target RNA-specific ribozymes is described in Haseloff et al. Nature, 334:585-591 (1988).

(49) Another method by which XAX1 expression can be inhibited is by sense suppression (also known as co-suppression). Introduction of expression cassettes in which a nucleic acid is configured in the sense orientation with respect to the promoter has been shown to be an effective means by which to block the transcription of target genes. For an example of the use of this method to modulate expression of endogenous genes see, Napoli et al., The Plant Cell 2:279-289 (1990); Flavell, Proc. Natl. Acad. Sci., USA 91:3490-3496 (1994); Kooter and Mol, Current Opin. Biol. 4:166-171 (1993); and U.S. Pat. Nos. 5,034,323, 5,231,020, and 5,283,184.

(50) Generally, where inhibition of expression is desired, some transcription of the introduced sequence occurs. The effect may occur where the introduced sequence contains no coding sequence per se, but only intron or untranslated sequences homologous to sequences present in the primary transcript of the endogenous sequence. The introduced sequence generally will be substantially identical to the endogenous sequence intended to be repressed. This minimal identity will typically be greater than about 65%, but a higher identity can exert a more effective repression of expression of the endogenous sequences. In some embodiments, sequences with substantially greater identity are used, e.g., at least about 80, at least about 95%, or 100% identity are used. As with antisense regulation, further discussed below, the effect can be designed and tested to apply to any other proteins within a similar family of genes exhibiting homology or substantial homology.

(51) For sense suppression, the introduced sequence in the expression cassette, needing less than absolute identity, also need not be full length, relative to either the primary transcription product or fully processed mRNA. Furthermore, the introduced sequence need not have the same intron or exon pattern, and identity of non-coding segments will be equally effective. In some embodiments, a sequence of the size ranges noted above for antisense regulation is used, i.e., 30-40, or at least about 20, 50, 100, 200, 500 or more nucleotides.

(52) Endogenous gene expression may also be suppressed by means of RNA interference (RNAi) (and indeed co-suppression can be considered a type of RNAi), which uses a double-stranded RNA having a sequence identical or similar to the sequence of the target gene. RNAi is the phenomenon in which when a double-stranded RNA having a sequence identical or similar to that of the target gene is introduced into a cell, the expressions of both the inserted exogenous gene and target endogenous gene are suppressed. The double-stranded RNA may be formed from two separate complementary RNAs or may be a single RNA with internally complementary sequences that form a double-stranded RNA. Although complete details of the mechanism of RNAi are still unknown, it is considered that the introduced double-stranded RNA is initially cleaved into small fragments, which then serve as indexes of the target gene in some manner, thereby degrading the target gene. RNAi is known to be also effective in plants (see, e.g., Chuang, C. F. & Meyerowitz, E. M., Proc. Natl. Acad. Sci. USA 97: 4985 (2000); Waterhouse et al., Proc. Natl. Acad. Sci. USA 95:13959-13964 (1998); Tabara et al. Science 282:430-431 (1998); Matthew, Comp Funct Genom 5: 240-244 (2004); Lu, et al., Nucleic Acids Res. 32(21):e171 (2004)).

(53) Thus, in some embodiments, inhibition of a XAX1 gene is accomplished using RNAi techniques. For example, to achieve suppression of the expression of a DNA encoding a protein using RNAi, a double-stranded RNA having the sequence of a DNA encoding the protein, or a substantially similar sequence thereof (including those engineered not to translate the protein) or fragment thereof, is introduced into a plant of interest. As used herein, RNAi and dsRNA both refer to gene-specific silencing that is induced by the introduction of a double-stranded RNA molecule, see e.g., U.S. Pat. Nos. 6,506,559 and 6,573,099, and includes reference to a molecule that has a region that is double-stranded, e.g., a short hairpin RNA molecule. The resulting plants may then be screened for a phenotype associated with the target protein, for example, screening for an increase in the extractability of sugar from the plants as compared to wild-type plants, and/or by monitoring steady-state RNA levels for transcripts encoding the protein. Although the genes used for RNAi need not be completely identical to the target gene, they may be at least 70%, 80%, 90%, 95% or more identical to the target gene sequence. See, e.g., U.S. Patent Publication No. 2004/0029283. The constructs encoding an RNA molecule with a stem-loop structure that is unrelated to the target gene and that is positioned distally to a sequence specific for the gene of interest may also be used to inhibit target gene expression. See, e.g., U.S. Patent Publication No. 2003/0221211.

(54) The RNAi polynucleotides may encompass the full-length target RNA or may correspond to a fragment of the target RNA. In some cases, the fragment will have fewer than 100, 200, 300, 400, 500 600, 700, 800, 900 or 1,000 nucleotides corresponding to the target sequence. In addition, in some embodiments, these fragments are at least, e.g., 50, 100, 150, 200, or more nucleotides in length. In some cases, fragments for use in RNAi will be at least substantially similar to regions of a target protein that do not occur in other proteins in the organism or may be selected to have as little similarity to other organism transcripts as possible, e.g., selected by comparison to sequences in analyzing publicly-available sequence databases. Expression vectors that continually express siRNA in transiently- and stably-transfected have been engineered to express small hairpin RNAs, which get processed in vivo into siRNAs molecules capable of carrying out gene-specific silencing (Brummelkamp et al., Science 296:550-553 (2002), and Paddison, et al., Genes & Dev. 16:948-958 (2002)). Post-transcriptional gene silencing by double-stranded RNA is discussed in further detail by Hammond et al. Nature Rev Gen 2: 110-119 (2001), Fire et al. Nature 391: 806-811 (1998) and Timmons and Fire Nature 395: 854 (1998).

(55) Yet another way to suppress expression of an endogenous plant gene is by recombinant expression of a microRNA that suppresses a target (e.g., a XAX1 gene). Artificial microRNAs are single-stranded RNAs (e.g., between 18-25-mers, generally 21-mers), that are not normally found in plants and that are processed from endogenous miRNA precursors. Their sequences are designed according to the determinants of plant miRNA target selection, such that the artificial microRNA specifically silences its intended target gene(s) and are generally described in Schwab et al, The Plant Cell 18:1121-1133 (2006) as well as the internet-based methods of designing such microRNAs as described therein. See also, US Patent Publication No. 2008/0313773.

(56) Another example of a method to reduce levels of GALS employs riboswitch techniques (see, e.g., U.S. Patent Application Publication Nos. US20100286082, and US20110245326).

(57) In a further embodiment, a tissue-specific promoter that directs expression of a nuclease (zinc-finger or TALEN) that can be engineered to recognize a target XAX1 gene sequence can be used to inhibit XAX1 expression in a tissue of interest).

(58) One of skill in the art will recognize that using technology based on specific nucleotide sequences (e.g., antisense or sense suppression, siRNA, microRNA technology, etc.), families of homologous genes can be suppressed with a single sense or antisense transcript. For instance, if a sense or antisense transcript is designed to have a sequence that is conserved among a family of genes, then multiple members of a gene family can be suppressed. Conversely, if the goal is to only suppress one member of a homologous gene family, then the sense or antisense transcript should be targeted to sequences with the most variance between family members.

(59) Alternatively, random mutagenesis approaches may be used to disrupt or knock-out the expression of a XAX1 gene using either chemical or insertional mutagenesis, or irradiation. One method of mutagenesis and mutant identification is known as TILLING (for targeting induced local lesions in genomes). In this method, mutations are induced in the seed of a plant of interest, for example, using EMS treatment. The resulting plants are grown and self-fertilized, and the progeny are assessed. For example, the plants may be assed using PCR to identify whether a mutated plant has a XAX1 mutation, e.g., that reduces expression of a XAX1 gene, or by evaluating whether the plant has reduced levels of phenolics or increased sugar extractability, or decreased lignin content in a part of the plant that expressed the XAX1 gene. TILLING can identify mutations that may alter the expression of specific genes or the activity of proteins encoded by these genes (see Colbert et al (2001) Plant Physiol 126:480-484; McCallum et al (2000) Nature Biotechnology 18:455-457).

(60) The invention also provides knockout XAX1 plants where mutagenesis, e.g., disruption of a XAX1 gene sequence by, e.g., homologous recombination, leads to loss of expression of the endogenous gene. Methods of generating knockout plants are well-known in the art, see, e.g., Strepp (1998) Proc Natl. Acad. Sci. USA 95:4368-4373; Miao (1995) Plant J7:359-365. See discussion on transgenic plants, below.

(61) Another method for abolishing or decreasing the expression of a XAX1 gene is by insertion mutagenesis using the T-DNA of Agrobacterium tumefaciens. After generating the insertion mutants, the mutants can be screened to identify those containing the insertion in a XAX1 gene. Mutants containing a single mutation event at the desired gene may be crossed to generate homozygous plants for the mutation (Koncz et al. (1992) Methods in Arabidopsis Research. World Scientific).

(62) Another method to disrupt a XAX1 gene is by use of the cre-lox system (for example, as described in U.S. Pat. No. 5,658,772).

(63) In further embodiments, XAX1 gene expression can be disrupted by targeting a promoter that controls expression of the endogenous XAX1 gene. The promoter is 5 to the transcription start site and typically includes from 250-500, or to 1000 or to 1500 base pairs upstream of the transcription start site.

(64) Expression of XAX1 Gene Inhibitors

(65) To use isolated sequences in the above techniques, recombinant expression vectors suitable for transformation of plant cells such as grass plant cells are prepared. For example, a polynucleotide sequence encoding a sequence that inhibits expression of an endogenous XAX1 gene (described in further detail herein) can be combined with other regulatory sequences which will direct the expression of the inhibitory polynucleotide sequence in the intended cells, e.g., rice or other grass plant cells. Typically, plant transformation vectors include one or more cloned plant coding sequences (genomic or cDNA) under the transcriptional control of 5 and 3 regulatory sequences and a dominant selectable marker. Such plant transformation vectors typically contain a promoter (e.g., a regulatory region controlling inducible or constitutive, environmentally-or developmentally-regulated, or cell- or tissue-specific expression).

(66) In some embodiments, a constitutive plant promoter may be used for directing expression of the polynucleotide in all tissues of the plant. Examples of constitutive plant promoters include: the cauliflower mosaic virus (CaMV) 35S promoter, which confers constitutive, high-level expression in most plant tissues (see, e.g., Odel et al., (1985) Nature 313:810); the nopaline synthase promoter (An et al., (1988) Plant Physiol. 88:547); and the octopine synthase promoter (Fromm et al., (1989) Plant Cell 1:977). Additional constitutive regulatory elements, including those for efficient expression in monocots, also are known in the art, for example, the pEmu promoter and promoters based on the rice Actin-1 5 region (Last et al., Theor. Appl. Genet. 81:581 (1991); Mcelroy et al., Mol. Gen. Genet. 231:150 (1991); Mcelroy et al., Plant Cell 2:163 (1990)).

(67) Alternatively, a plant promoter may direct expression of the polynucleotide of the invention in a specific tissue (tissue-specific promoters). For example, in some embodiments, it is desirable to inhibit expression in non-vascular tissues. Tissue-specific promoters are transcriptional control elements that are only active in particular cells or tissues at specific times during plant development, such as in vegetative tissues or reproductive tissues. One of skill will recognize that a tissue-specific promoter may drive expression of operably linked sequences in tissues other than the target tissue. Thus, as used herein a tissue-specific promoter is one that drives expression preferentially in the target tissue, but may also lead to some expression in other tissues as well.

(68) Alternatively, the plant promoter may be under more precise environmental control (inducible promoters). Examples of environmental conditions that may affect transcription by inducible promoters include anaerobic conditions, elevated temperature, drought, or the presence of light. Examples of environmental promoters include drought-inducible promoter of maize (Busk (1997) supra); the cold, drought, and high salt inducible promoter from potato (Kirch (1997) Plant Mol. Biol. 33:897 909). Plant promoters that are inducible upon exposure to plant hormones, such as auxins, may also be employed. For example, the invention can use the auxin response elements E1 promoter fragment (AuxREs) in the soybean (Glycine max L.) (Liu (1997) Plant Physiol. 115:397 407); the auxin-responsive Arabidopsis GST6 promoter (also responsive to salicylic acid and hydrogen peroxide) (Chen (1996) Plant J. 10: 955 966); the auxin-inducible parC promoter from tobacco (Sakai (1996) 37:906 913); a plant biotin response element (Streit (1997) Mol. Plant. Microbe Interact. 10:933 937); and, the promoter responsive to the stress hormone abscisic acid (Sheen (1996) Science 274:1900 1902).

(69) Plant promoters which are inducible upon exposure to chemical reagents that can be applied to the plant, such as herbicides or antibiotics, may also be used in vectors as described herein. For example, the maize In2 2 promoter, activated by benzenesulfonamide herbicide safeners, can be used; application of different herbicide safeners induces distinct gene expression patterns, including expression in the root, hydathodes, and the shoot apical meristem. Other promoters, e.g., a tetracycline inducible promoter; a salicylic acid responsive element promoter, promoters comprising copper-inducible regulatory elements; promoters comprising ecdysone inducible regulatory elements; heat shock inducible promoters, a nitrate-inducible promoter, or a light-inducible promoter may also be used.

(70) Plant expression vectors may also include RNA processing signals that may be positioned within, upstream or downstream of the inhibitory sequence.

(71) Plant expression vectors routinely also include dominant selectable marker genes to allow for the ready selection of transformants. Such genes include those encoding antibiotic resistance genes (e.g., resistance to hygromycin, kanamycin, bleomycin, G418, streptomycin or spectinomycin), herbicide resistance genes (e.g., phosphinothricin acetyltransferase), and genes encoding positive selection enzymes (e.g. mannose isomerase).

(72) Once an expression cassette comprising a polynucleotide encoding an inhibitor of the expression of a XAX1 gene has been constructed, standard techniques may be used to introduce the polynucleotide into a plant in order to modify XAX1 activity and accordingly, the synthesis of phenolics in the plant or plant part in which the XAX1 target nucleic acid is expressed. See protocols described in Ammirato et al. (1984) Handbook of Plant Cell CultureCrop Species. Macmillan Publ. Co. Shimamoto et al. (1989) Nature 338:274-276; Fromm et al. (1990) Bio/Technology 8:833-839; and Vasil et al. (1990) Bio/Technology 8:429-434.

(73) Transformation and regeneration of plants is known in the art, and the selection of the most appropriate transformation technique will be determined by the practitioner. Suitable methods may include, but are not limited to: electroporation of plant protoplasts; liposome-mediated transformation; polyethylene glycol (PEG) mediated transformation; transformation using viruses; micro-injection of plant cells; micro-projectile bombardment of plant cells; vacuum infiltration; and Agrobacterium tumeficiens mediated transformation. Transformation means introducing a nucleotide sequence in a plant in a manner to cause stable or transient expression of the sequence. Examples of these methods in various plants include: U.S. Pat. Nos. 5,571,706; 5,677,175; 5,510,471; 5,750,386; 5,597,945; 5,589,615; 5,750,871; 5,268,526; 5,780,708; 5,538,880; 5,773,269; 5,736,369 and 5,610,042.

(74) Following transformation, plants are preferably selected using a dominant selectable marker incorporated into the transformation vector. Typically, such a marker will confer antibiotic or herbicide resistance on the transformed plants or the ability to grow on a specific substrate, and selection of transformants can be accomplished by exposing the plants to appropriate concentrations of the antibiotic, herbicide, or substrate.

(75) XAX1 nucleic acids can be obtained using many methods known in the art. Such methods can involve amplification reactions such as PCR and other hybridization-based reactions or can be directly synthesized.

(76) In some embodiments, a grass plant in which XAX1 expression is decreased in accordance with the invention, may be further modified to express an exogenous XAX1 in a desired tissue, such as vessel, or to express exogenous XAX1 under desired environmental conditions. Vectors for expressing exogenous XAX1 can be generated using techniques well known in the art. Various regulatory components are described above. In the present invention, a polynucleotide that expresses an exogenous XAX1 typically encodes a polypeptide having at least 50% identity, more typically at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or greater, identity to SEQ ID NO:2.

(77) Expression of a polynucleotide encoding a XAX1 protein in a desired tissue can be achieved using a tissue-specific promoter, such as a promoter described above. Thus, for example, the XAX1 polynucleotide may be introduced into a plant such that expression is controlled by a vessel-specific promoter, e.g., a VND6 or VND7 promoter. (See, e.g., PCT/US2012/023182 for illustrative promoter sequences). Other examples of tissue-specific promoters include promoters that initiate transcription primarily in certain tissues, such as vegetative tissues, e.g., roots or leaves. Other examples are promoters that direct expression specifically to cells and tissues with secondary cell wall deposition, such as xylem and fibers. Examples of tissue-specific include promoters for IRX1, IRX3, IRX5, IRX8, IRX9, IRX14, IRX7, IRX10, GAUT13, or GAUT14 genes.

(78) Screening for Plants Having Suppressed XAX1 Expression

(79) After transformed plants are selected, parts of the plants may be evaluated to determine the level of XAX1 gene expression in a part of the plant that expresses the XAX1 gene, e.g., by evaluating the level of RNA or protein, by determining the amounts of soluble sugars that can be extracted from the plants, or by evaluating the levels of other compounds, such as ferulate and coumarate esters. These analyses can be performed using any number of methods known in the art.

(80) In some embodiments, the amount of soluble sugar that can be extracted from a plant can be measured by a saccharification reaction, e.g., enzymatic saccharification. Methods of enzymatic saccharification are known in the art. Briefly, plants or plant biomass material (e.g., leaves and stems) are pre-treated with hot water or dilute acid, followed by enzymatic saccharification using a mixture of cellulose and beta-glucosidase in buffer and incubation of the plants or plant biomass material with the enzymatic mixture. Following incubation, the yield of the saccharification reaction can be readily determined by measuring the amount of reducing sugar released, using a standard method for sugar detection, e.g. the dinitrosalicylic acid method well known to those skilled in the art. Plants engineered in accordance with the invention provide a higher sugar yield.

(81) Alternatively, the level of XAX1 gene expression can be assessed by measuring the of a plant; or the ferulate and/or coumarate ester content of xylan in the plant. Methods of performing such analyses are known in the art (see, e.g., the EXAMPLES section; and e.g., Harholt, et al., Plant Biotechnology Journal 8:351-362, 2010).

(82) Plants of the invention that exhibit reduced XAX1 gene expression have at least a 5% increase in sugar obtained from a reaction, e.g., as assessed by a saccharification reaction, typically at least 10% increase in sugar extractability, or more often at least 15%, 20%, 30%, 40%, or 50% or more increase in sugar compared to a plant that has not been engineered to decrease expression of the XAX1 gene. As understood in the art, XAX1-mediated increase in sugar extractability may occur in one or more parts of the plants, e.g., sugar extractability may be increased in a leaf and/or a stem.

(83) Plants of the invention that exhibit reduced XAX1 gene expression can also have a lignin content that is reduced by at least 10%, often by at least 15%, at least 20%, at least 30%, at least 40%, or at least 50% compared to a plant that has not been engineered to decrease expression of the XAX1 gene. As understood in the art, XAX1-mediated decrease in lignin content may occur in one or more parts of the plants, e.g., lignin content may be decreased in the stem.

(84) Plants, plant biomass material, or bulk harvested material from grass plants that are genetically modified to reduce expression of an endogenous XAX1 gene can be used in a variety of reactions, including fermentation reactions. Such reactions are well known in the art. For example, fermentation reactions such as yeast or bacterial fermentation reactions may employ plants of the present invention to obtain ethanol, butanol, lipids, and the like. For example, the plants may be used in industrial bioprocessing reactions that include fermentative bacteria, yeast, or filamentous fungi.

(85) Plants, plant biomass material, or bulk harvested material from grass plants that are genetically modified to reduce expression of an endogenous XAX1 gene can be used as forage material for an animal to improve digestion in vivo. In some embodiments, the invention provides animal feed comprising grass plant biomass from a plant of the invention. In some embodiments, the invention provides a fiber fraction obtained from plant material from a plant of the invention. Such a fiber fraction may be used, for example, in food materials for animals, including humans.

(86) In some embodiments, plants in which XAX1 expression is suppressed, have undesirable properties, such as decreased growth relative to a wildtype plant. As understood in the art, one of skill can use standard plant breeding techniques, such as back-crossing, to improve a desired characteristic of XAX1-deficient plants.

EXAMPLES

Example 1: Identification and Characterization of an XAX1 Mutant

(87) XAX1 is a Previously Uncharacterized Xylan Biosynthesis Gene in Rice

(88) We identified a mutant with a mutation in the third exon that knocked out Os02g22380, a gene member that is part of a grass specific clade in the GT61 family. We identified this gene as a putative xylosyltransferase, based on its dwarfed phenotype and xylose deficiency in cell wall alcohol insoluble residue (AIR) in young rice leaves (FIGS. 1A and B). While the majority of all xylose in rice is derived from xylan, we confirmed that the deficiency was seen in the hemicellulose fraction (1M KOH) of sequentially extracted cell wall material (FIG. 6). Based on this biochemical phenotype and subsequent data described below, we named the mutant Xylosyl Arabinosyl substitution of Xylan 1 (XAX1).

(89) To gain further insight into the nature of the xylose deficiency, AIR was subjected to mild TFA hydrolysis, which preferentially cleaves arabinofuranosyl residues from the xylan backbone. A comparison of mild versus complete hydrolysis of AIR showed a stronger decrease in xylose (7.0%) than with total hydrolysis (2.6%), which indicates that the xylose deficiency is a substitution rather than a xylan chain deficiency (FIGS. 5 A and B)). Extraction of saponified AIR revealed a strong decrease in both ferulic acid (59%) and coumaric acid (44%) (FIG. 1C), aromatic compounds known to be attached to arabinose residues in xylan that are substituted with xylose (12). The 4M KOH cell wall fraction of AIR was further characterized by enzymatic fingerprinting with M6 endoxylanase (30). The released oligosaccharides were separated and quantified by high performance anion exchange chromatography with electrochemical detection (HPAEC-PAD) (FIG. 2A). Notably, XAX1 showed an absence of one peak eluting at about 22 min while the four other major peaks were found in both wild type and mutant. The unknown peak 1 was isolated from the wild type and determined by mass spectrometry to be a hexaose composed of pentose sugars (i.e. Xyl and Ara) (FIG. 2B). Unlike the peaks identified as AraXyl2 and AraXyl4, peak 1 was not modified with -arabinofuranosidase treatment (FIG. 6B), an enzyme that hydrolyzes terminal -arabinofuranose linkages (31) indicating that the peak lacked terminal -arabinofuranose residues, even though it contained arabinose based on total hydrolysis of the isolated peak (FIG. 6C). It was concluded from this analysis that peak 1 was the oligomer: -Xyl--Ara(-1,4-Xyl)4 (FIG. 2C) and together with the other monosaccharide composition data indicated that XAX1 transferred -(1,2) xylose onto -(1,3) arabinose. Glycosidic linkage analysis of extracted xylan from XAX1 confirmed a 61% decrease in arabinofuranose residues substituted at O-2 and a concomitant 55% increase in terminal arabinose when compared to wild type, consistent with changes expected from the absence in XAX1 of arabinofuranose residues substituted at the O-2 position with xylose. The -Xyl--Ara residues are a common substitution in grass xylan and have often been found with ferulic acid esters attached to the arabinose residues (12-16).

(90) XAX1 is a Golgi-Localized Protein Specifically Expressed in Young Tissue, and has Xylosyltransferase Activity

(91) To confirm the proposed xylosyltransferase activity of the XAX1 protein, we isolated microsomes from leaves of Nicotiana benthamiana transiently expressing XAX1 and measured xylose incorporation onto endogenous acceptors in the presence of UDP-.sup.14C-xylose. Peak activity was measured at 2H for XAX1 microsomes and 4H for endogenous XylT activity (FIG. 3C). Overall, XAX1 microsomes showed a 62% increase in XylT activity over the endogenously measured activity. To confirm that endogenous xylose-4-epimerase activity was not a significant factor in the results, we hydrolyzed the endogenous product to monosaccharide units and then separated the monosaccharides by TLC to determine radioactivity corresponding to xylose and arabinose. We found that the primary activity was from incorporation of xylose and that incorporation of arabinose was less than 20% of the total activity (FIG. 6D). GT activity studies in mung bean microsomes also found the epimerase activity to have a minimal effect on glucosyltransferase assays with UDP-arabinose (32).

(92) XAX1 is primarily expressed in younger tissue, including seedlings 7 days post germination (dpg) and has the highest expression in the immature panicle, and the lowest expression in mature stems and older leaves (FIG. 3B). In rice, xylan is abundant in both the primary and secondary cell walls. We wanted to determine if XAX1 localizes with other previously characterized xylan synthesis enzymes in the Golgi apparatus (33). As with other members of the GT61 family, XAX1 has an N-terminal putative transmembrane domain (FIG. 4B). To determine cellular localization, the XAX1 protein was fused to a C-terminal YFP and transiently expressed in onion cells. XAX1 co-localized with the GmMan1-CFP, the -mannosidase I cis-Golgi marker (FIG. 3A), indicating that XAX1 is localized where xylan is known to be synthesized.

(93) Absence of Xylose Substitution Improves Saccharification

(94) Cell walls from the XAX1 mutant exhibited a 62% increase in the total sugars released compared to wild type after a 24-h treatment with an enzyme cocktail (Ctec2, Novozymes, Denmark) that contained cellulase, -glucosidase, and hemicellulase (FIG. 1D). The cellulose content of the mutant was the same as wild type (FIG. 5F), and size exclusion chromatography found no difference in the size of the xylan molecules (FIG. 6A), which indicates that the increased extractability is not due to increased carbohydrate content in the mutant. Additionally, CDTA and Na.sub.2CO.sub.3 fractions, which in wild type contains mostly pectin sugars, showed that the xylose was more easily extracted in the mutant, also indicating a more easily extractable hemicellulose (FIGS. 5 C and D). The improved saccharification may be due to a decrease in the diferulic cross-links (34-36) or because a more easily extracted xylan allows cellulase enzymes better access to cellulose (37).

(95) Discussion

(96) Evolution of a Grass Specific Xylan Substitution

(97) XAX1 is a member of glycosyltransferase family GT61, and we have shown it to be essential for the grass specific -(1,2) xylose substitution of -(1,3) arabinosyl residues, a disaccharide substitution on the xylan chain that is unique to grasses. The GT61 family was recently identified through bioinformatic analysis to be highly grass-diverged (28, 29, 38). Enzymes are grouped into the GT61 family based on a transmembrane domain and a DUF563 protein sequence (CAZy database (39), FIG. 4B). We found a single DUF563 sequence in the brown algae E. siliculosus, which suggests that this family originated around the time brown algae evolved or before; we used this brown algae sequence to root our GT61 tree. There are at least three distinct clades identifiable in the GT61 phylogenetic tree (clade A, B, and C). The basal plants are Physcomitrella patens and Selaginella moellendorffii), 13 genomes of dicosts are included and 4 genomes of grasses. The three clades are divided into (A, B, CI, CII, CIII, and CIV). XAX1 is located in the grass specific clade CIV. Clades A and B, which both include moss genes, are represented relatively evenly between grasses and dicots. Clade B genes have diverged far less than other genes in the family, and are generally represented by only a single sequence per genome (At5G5500 and Os08g39380 in Arabidopsis and rice respectively). One member of this clade, At5g55500 has been previously characterized to have -(1,2) xylosyltransferase activity, transferring xylose to N-linked glycans (40). There is nothing yet known about clade A, but it does contain five Selaginella representatives. We found Selaginella leaves to have no detectable arabinose on its xylan (FIG. 6E), and propose that this clade does not contain arabinosyl transferases involved in xylan biosynthesis. Most likely, clade A has a function similar to clade B or an as yet uncharacterized function. However, clade C, which contains Os02g22380 (XAX1), is dramatically expanded in the grasses, which is particularly true for groups III and IV in clade C, which have no known dicot orthologues. The recently characterized -(1,3) arabinosyltransferases are part of clade Cland II. Clade CII contains the only dicot orthologues of clade C (27). Arabinose substitutions on xylan are abundant in grasses, but not unique to them. While O-3 substituted arabinose is characteristic of the grasses, many dicot species have O-2 substituted arabinose, and flax and psyllium seed mucilage have been shown to contain -(1,2) -(1,3) disubstituted or -(1,3) monosubstituted arabinose on xylan, respectively (41, 42). Thus, having dicot orthologues in clade CII is not surprising. That XAX1 is located in the grass-unique clade CIV, appears correct, since the disaccharide substitution is a grass specific trait in xylan and associated with ferulate esters, which are also unique to grass xylans.

(98) The Role of XAX1 in the Context of Ferulic Acid Esters

(99) The decreased content in ferulate and coumarate esters in the XAX1 mutant is interesting and somewhat unexpected. It is not clear how hydroxycinnamate esters are added to xylan, but it is known to take place in the Golgi, and there is evidence that acyltransferases belonging to the BAHD family are involved (16, 43). The BAHD enzymes are cytoplasmic, suggesting that they do not directly ferulate xylan, but adds ferulic acid to an intermediate. A likely intermediate that has been proposed is UDP-arabinofuranose (44), which is also synthesized in the cytoplasmagain somewhat surprisingly since the precursor, UDP-arabinopyranose, is largely synthesized inside the Golgi lumen (45). H owever, if UDP-feruloyl-arabinose were the substrate for feruloylation of xylan, we would not expect to see a decrease in ferulate ester content in XAX1. The decreased hydroxycinnamate in the mutant suggests that ferulic acid is added subsequently to the addition of xylose to the un-feruloylated arabinose residues. In that case, the intermediate for feruloylation would be another as yet unidentified compound. Alternatively, hydroxycinnamates attached to arabinose in XAX1 are more susceptible to being removed by ferulic acid esterases. If the latter is the case, it would suggest a role of -1,2-xylose substitutions on grass xylans in stabilizing the ferulic acid esters.

(100) Rice Xylan Lacking -(1,2) Xyl Substitution have Improved Release of Sugars

(101) Mutant XAX1 plants exhibit an increased saccharification efficiency (FIG. 1D) and an increased extractability of xylan (FIGS. 5 C and D), most likely due to the lower ferulic cross-links (FIG. 1C), but it may also be due to increased solubility of the hemicelluloses and hence possible increased access of cellulases to cellulose. There does appear to be a slight increase in arabinose substitutions (FIG. 1B) possibly as a compensatory mechanism due to the XAX1 mutation. Based on the linkage analysis, there is an increase in di-substituted xylose (2,3,4-Xyl) presumably with -(1,2) and -(1,3) arabinose. This increase in arabinose would account for a degree of the increased extractability of xylan, but we propose that while this 10% increase in arabinose may account for a fraction of the 62% increase in saccharification efficiency, it most likely does not account for the majority of the increased saccharification observed in XAX1. We find it more likely that the increased saccharification is largely a consequence of the 59% decrease in ferulic acid (FIG. 1C).

(102) In conclusion, mutant XAX1 plants show a dwarfed phenotype and increased extractability that demonstrates the importance of the -1,2-xylose substitutions on arabinoxylan. These findings also provide us with new insights into xylan synthesis and a unique capability to modify ferulic cross-links with a glycosyltransferase. As ferulic cross-links inhibit sugar release as well as microbial fermentation, this is a potentially important biotechnological tool for grass biofuel feedstocks.

(103) Materials and Methods

(104) Details of plant material, reagents, quantitative RT-PCR, microscopy, construction of GT61 phylogeny, LC-TOF Mass Spectrometry, and primers are described in SI Materials and Methods.

(105) AIR Preparation and Analysis

(106) AIR was prepared and analyzed with a high-performance anion-exchange chromatography with pulsed amperometric detection (HPAEC-PAD) as described (18) and in the SI Materials and Methods. The phenolic extraction of AIR was performed as described (46) and in the SI Materials and Methods. For the saccharification assay, 5 mg destarched AIR was autoclaved at 120 C. for 1 h. A 500-l enzyme mixture containing 50 mM citrate buffer pH 6.2, 1.6% tetracycline, 2 l Ctec2 enzyme mixture (Novozymes, Denmark), which contains cellulases, -glucosidases, and hemicellulase was added and incubated at 50 C. for 24 h with shaking. After enzyme treatment, samples were pelleted, and released sugars in the supernatant were measured using DNS reagent (1% w/v 3,5-dinitrosalicylic acid, 30% w/v potassium sodium tartrate, 400 mM NaOH) reading absorbance at 540 nm.

(107) Cell Wall Fractionation and Xylan Composition Analysis

(108) Xylan was extracted from AIR as previously described (47) and in the SI Materials and Methods. Extracted xylan (1 mg/ml) was incubated with 1 U endoxylanase (Megazyme, Bray, Ireland) in 0.05 M ammonium acetate buffer (pH 6) at 42 C. for 24 h. The reaction mixture was heated at 100 C. for 10 min to stop the reaction and centrifuged prior to HPAEC analysis. The endoxylanse treated extract was incubated with 0.25 U -L arabinofuranosidase from A. niger (Megazyme, Bray, Ireland) in 0.05 M sodium acetate buffer (pH 4) at 42 C. for 1 h. The reaction was stopped by boiling at 100 C. for 10 min and centrifuged. The released oligosaccharides after enzymatic digestion were separated by HPAEC on a Dionex DX 600 system equipped with a pulsed amperometric detector (PAD). A CarboPac PA200 column (3250 mm) eluted with a gradient of 0-250 mM sodium acetate in 100 mM NaOH over 40 min at 0.4 ml/min was used. Xylose, arabinose and xylooligosaccharides (xylobiose, xylotriose, xylotetraose, xylopentaose and xylohexaose) (Megazyme, Bray, Ireland) were run as standards.

(109) XylT Activity Assay

(110) Infiltration of 4 week-old N. benthamiana leaves was done using Agrobacterium tumefasciens strain C58 (OD=1), following the method described in (48). For details on the plasmid constructs, see the SI Materials and Methods. Leaves were collected 5 days after infiltration, flash frozen, ground in a mortar and pestle in 15 mL of buffer (50 mM HEPES pH 7.0, 400 mM sucrose, 1 mM PMSF, 1% w/v PVPP, Protease Inhibitor Cocktail). This was then filtered through Miracloth mesh and centrifuged at 3,000g for 10 min. The supernatant was then centrifuged at 50,000g for 1 h. (Beckman Ultracentrifuge). The pellets containing the microsomes were resuspended in a 50 mM HEPES pH 7.0, 400 mM sucrose buffer and stored at 80 C. Protein concentration was determined using the Bradford method. Microsomes corresponding to 100 g protein were incubated with 50 mM HEPES pH 7.0, 400 mM sucrose, 5 mM MnCl2, 20 nli UDP-[.sup.14C]Xylose (American Radiolabeled Chemicals, Inc., St. Louis, Mo., USA) in a total reaction volume of 50 L. After incubation at 24 C. for various times, reaction was stopped by adding 70% ice-cold ethanol and 100 g dextran as a carrier. The products were precipitated with ice-cold 70% ethanol and washed until no counts were found in the wash solution. Then the pellet was re-suspended in water, an equal volume of scintillation fluid was added (National Diagnostics), and the amount of activity was determined using scintillation counter set to measure .sup.14C counts for 2 min (Beckman LS 6500).

(111) Supplemental Materials and Methods

(112) Growth of Plants.

(113) Rice plants were grown in the summer at 30 C. in day and 24 C. at night, 60-80% relative humidity in the UC Davis greenhouses. T-DNA insertion lines were obtained from the Postech rice T-DNA insertion library in Korea. Mutant lines were genotyped using primers designed to be just outside each insertion site as well as an insertion internal primer. N. benthamiana plants were grown for 4 weeks at 24 C. with 12 h light (70 mol photons m.sup.2 s.sup.1) and 60% humidity.

(114) Expression Analysis.

(115) Total RNA was extracted using the RNeasy plant mini kit (Qiagen, Valencia, Calif.) following manufacturer's instructions. RNA preparations were treated with DNase1 (Qiagen, Valencia, Calif.) to remove traces of DNA contamination. 1 g of RNA was used for reverse transcription with the Transcriptor high fidelity cDNA synthesis kit (Roche) and oligo dT primers. After synthesis, the cDNA reaction was diluted four times in RNAse-free water, and 2 l was used for PCR using the Fast SYBR Green master mix (Applied Biosystems, Carlsbad, Calif.) and gene-specific primers in a StepONE plus Q-PCR machine (Applied Biosystems).

(116) Cell Wall Isolation and Monosaccharide Composition Analysis.

(117) For rice mutants, 5-week old leaf tissue was collected, frozen in liquid nitrogen and freeze-dried overnight using a lyophilizer. Alcohol Insoluble Residue (AIR) preparation and destarching was done according to methods described in (1). For monosaccharide composition analysis, 5 mg was hydrolyzed in 15% trifluoroacetic acid at 120 C. for 1 h. The released monosaccharides were separated by HPAEC on a Dionex ICS3000 system (Sunnyvale, Calif.) equipped with a pulsed amperometric detector (PAD) as described (2).

(118) Sequential Extraction of Xylan.

(119) Xylan was extracted from AIR as previously described (3). AIR (5 mg) was suspended in 0.5 ml 0.05 M CDTA (pH 6.5) for 24 h at room temperature on thermomixer. The suspension was centrifuged at 48,000g at 4 C. and the pellet washed twice with deionized water. The pellet was subsequently extracted using 0.05 M Na.sub.2CO.sub.3 containing 0.01 M NaBH.sub.4 for 24 h at 4 C., washed twice with deionized water, and then 1M KOH, then 4M KOH for 24 h each at room temperature with shaking on thermomixer. The 1M KOH and 4M KOH fractions were similarly centrifuged at 48,000g at 4 C. The KOH fractions were adjusted to pH 5 with glacial acetic acid. The fraction was further dialyzed against deionized water and then lyophilized.

(120) Extraction, Separation and Quantification of Hydroxycinnamates.

(121) For hydroxycinnamate extraction of plant material, 5 mg destarched AIR was saponified in 2M sodium hydroxide at 22 C. for 24 h in 10-ml Teflon tubes at room temperature on a rocking agitator. After acidification with 0.8 ml concentrated hydrochloric acid samples were extracted 3 times in ethyl acetate. The combined supernatants were vacuum dried and solubilized in 50% (v/v) methanol. HPLC separation was done as described (4) with a gradient of solvent A (0.2% TFA) and solvent B (acetonitrile): 0-5 min, 10% B isocratic; 5-25 min, 10-30% B linear; 25-40 min, 30% B isocratic; 40-45 min, 30-35% B linear; 45-46 min, 35-100% B linear; 46-51 min, 100% B isocratic; 51-53 min 100-10% B linear; 53-60 min 10% B isocratic.

(122) Saccharification Assay.

(123) To determine the amount of sugars released from plant material, water was added to 5 mg destarched AIR and the mixture was autoclaved at 120 C. for 1 h. A 500-l enzyme mixture containing 50 mM citrate buffer pH 6.2, 1.6% tetracycline, 2 l Ctec2 enzyme mixture (Novozymes, Denmark), which contains cellulases, -glucosidases, and hemicellulase was added and incubated at 50 C. for 24 h with shaking. After enzyme treatment, samples were pelleted, and released sugars in the supernatant were measured using DNS reagent (1% w/v 3,5-dinitrosalicylic acid, 30% w/v potassium sodium tartrate, 400 mM NaOH) reading absorbance at 540 nm.

(124) Enzyme Treatment of Cell Wall Extracts.

(125) Xylan extracted from cell walls (1 mg/ml) were incubated with 1 U endoxylanase (Megazyme, Bray, Ireland) in 0.05 M ammonium acetate buffer (pH 6) at 42 C. for 24 h. The reaction mixture was heated at 100 C. for 10 min to stop the reaction and centrifuged prior to HPAEC analysis. The endoxylanse treated extract was incubated with 0.25 U -L arabinofuranosidase from A. niger (Megazyme) in 0.05 M sodium acetate buffer (pH 4) at 42 C. for 1 h. The reaction was stopped by boiling at 100 C. for 10 min and centrifuged.

(126) Xylan Fingerprinting by HPAEC.

(127) The released oligosaccharides after enzymatic digestion were separated by HPAEC on a Dionex DX 600 system equipped with a pulsed amperometric detector (PAD). A CarboPac PA200 column (3250 mm) eluted with a gradient of 0-250 mM sodium acetate in 100 mM NaOH over 40 min at 0.4 ml/min was used. Xylose, arabinose and xylooligosaccharides (xylobiose, xylotriose, xylotetraose, xylopentaose and xylohexaose) (Megazyme, Bray, Ireland) were run as standards.

(128) LC-TOF Mass Spectrometry of Peak 1.

(129) The separation of metabolites was conducted on a Fermentation monitoring HPX-87H column with 8% cross linkage (150 mm length, 7.8 mm internal diameter, and 9 m particle size; Bio-Rad, CA, USA) using an Agilent Technologies 1100 Series HPLC system. A sample injection volume of 10 L was used throughout. The temperature of the sample tray was maintained at 4 C. by an Agilent FC/ALS Thermostat. The column compartment was set to 50 C. Metabolites were eluted isocratically with a mobile phase composition 0.1% formic acid. A flow rate of 0.5 ml min.sup.1 was used throughout. Xylobiose, xylotriose, xylotetraose, xylopentaose and xylohexaose (Megazyme, Bray, Ireland) were run as standards.

(130) The HPLC system was coupled to an Agilent Technologies 6210 time-of-flight mass spectrometer (LC-TOF MS), by a post-column split (Agilent Technologies, CA, USA). Nitrogen gas was used as both the nebulizing and drying gases to facilitate the production of gas-phase ions. The drying and nebulizing gases were set to 12 L/min and 30 psi, respectively, and a drying gas temperature of 330 C. was used throughout. Electrospray ionization (ESI) was conducted in the positive ion mode and a capillary voltage of 3500 V was utilized. MS experiments were carried out in the full scan mode, at 0.86 spectra/s, for the detection of [M+Na].sup.+ ions. The instrument was tuned for a range of 50-1700 m/z. Prior to LC-TOF MS analysis, the TOF MS was calibrated via an ESI-L-low concentration tuning mix (Agilent Technologies, CA, USA). Data acquisition and processing were performed by the MassHunter software package.

(131) Transient Expression of XAX1 in Nicotiana benthamiana.

(132) Infiltration of 4 week-old N. benthamiana leaves was done using Agrobacterium tumefasciens strain C58 (OD=1), following the method described in (1). For details on the plasmid constructs, see the SI Text. Leaves were collected 5 days post infiltration for protein isolation.

(133) Microsomal Extraction of N. Benthamiana Leaves.

(134) For protein isolation, leaves were flash frozen, ground in a mortar and pestle in 15 mL of buffer (50 mM HEPES pH 7.0, 400 mM sucrose, 1 mM PMSF, 1% w/v PVPP, Protease Inhibitor Cocktail). This was then filtered through Miracloth mesh and centrifuged at 3,000g for 10 min. The supernatant was then centrifuged at 50,000g for 1 h. (Beckman Ultracentrifuge). The pellets containing the microsomes were resuspended in a 50 mM HEPES pH 7.0, 400 mM sucrose buffer and stored at 80 C. Protein concentration was determined using the Bradford method.

(135) Endogenous Activity Assay.

(136) Microsomes corresponding to 100 g protein were incubated with 50 mM HEPES pH 7.0, 400 mM sucrose, 5 mM MnCl.sub.2, 740 Bq UDP-[.sup.14C]Xylose (American Radiolabeled Chemicals, Inc., St. Louis, Mo., USA) in a total reaction volume of 50 L. After incubation at 24 C. for various times, reaction was stopped by adding 70% ice-cold ethanol and 100 g dextran as a carrier. The products were precipitated with ice-cold 70% ethanol and washed until no counts were found in the wash solution. Then the pellet was re-suspended in water, an equal volume of scintillation fluid was added (National Diagnostics), and the amount of activity was determined using scintillation counter set to measure .sup.14C counts for 2 min (Beckman LS 6500).

(137) Subcellular Localization of Fluorescent Tagged Proteins.

(138) For the onion bombardments, the XAX1 pENTR clone without a stop codon was recombined into pBullet GW-YFP G-CFP, a customized bombardment vector containing a Gateway recombination site fused to a C-terminal YFP and a GmMan1::CFP, the -mannosidae I cis-Golgi marker from Glycine max (5). Vectors were used to bombard onion peels using a PDS-1000 particle bombardment system (Bio-Rad). Prior to bombardment, onions peels were placed on agar plates containing 0.5 Murashige and Skoog medium and 2% sucrose for 1 hour at 22 C. to recover. Approximately 1 g of plasmid DNA was used to coat 50 l of 60 mg/ml, 1 m gold particles (Bio-Rad) in the presence of 20 mM CaCl.sub.2 and 0.8 mM spermidine for three minutes with mild vortexing. Particles were dehydrated with three ethanol washes and transferred onto plastic discs to dry. Particles were accelerated into onion peels by a burst of helium at 1100 psi under 28 in/Hg vacuum. Plates containing bombarded onions were covered in foil and incubated at 22 C. for 22 hours before being visualized by confocal microscopy. Transformed samples were analyzed using a Zeiss LSM710 meta (QUASAR detector) equipped with a 408 nm diode, argon and In tune laser. Images were taken using the inverted scope with a 1.30NA oil 40 objective. Samples were tagged with CFP and YFP were fixed with formaldehyde and imaged sequentially. The Zen software package (Carl Zeiss Inc.) was used for image acquisition and image analysis. The individual frames from 20 images were Z stacked.

(139) Glycosidic Linkage Analysis.

(140) Xylan was extracted from destarched AIR (5 mg) with 4M KOH and 10 mM NaBH.sub.4 (1 ml) for 4 hours with vigorous shaking at room temperature. The insoluble residue was pelleted by centrifugation for 10 min at 21,000g. The supernatant was neutralized with concentrated HCl and xylan was precipitated by adding water (4 ml) and 95% aqueous ethanol (14.5 ml) and incubating at 20 C overnight. After centrifugation at 3,200g for 10 min the pellet was washed twice with 1 mL 70% ethanol before drying. The methylation procedure modified from the method described by Ciucanu 1984 (6). In brief, the pellet was partially dissolved in a suspension of dry DMSO and NaOH (12.5 mg/ml) and 100 L methyliodide was added twice, with three hours stirring following the first addition and one hour following the second. Water (2 ml) was added to quench the reactions and dichloromethane (2 ml) was used to extract the partially methylated carbohydrates. The residue remaining after evaporation of the dichloromethane was hydrolyzed with 2M trifluoroacetic acid (TFA) at 121 C. for 90 minutes. The TFA was removed by evaporation under nitrogen and the pellet was reduced and acetylated as described (7). The residue was then extracted with 1.2 ml ethyl acetate and 5 ml water. The organic fraction was dried and the partially methylated alditol acetates were dissolved in acetone for GC-MS analysis with a 7890A GC system and a 5975C MS detector (Agilent) in EI mode. An SP-2380 column (Supelco) was used for the separation.

(141) Mass Distribution Analysis.

(142) Destarched alcohol insoluble residue (AIR) was incubated in 1 M KOH, 1% NaBH.sub.4 (30 mg/ml) for 3 h with 1400 rpm shaking at RT. The supernatant was collected after centrifugation for 10 min at 12,000g. The supernatant was neutralized using glacial acetic acid. After neutralization the supernatant was centrifuged for 10 min. at 12,000g and the mass distribution resulting supernatant was analyzed as described (4). Equal amounts of sugar were loaded onto the SEC column.

(143) Construction of GT61 Phylogeny.

(144) GT61 family sequences in rice and Arabidopsis were determined based on a sequence possessing a DUF563 domain as well as a predicted transmembrane domain. To identify other family members, the completed genomes of 4 grass species (B. distachyon, O. sativa, S. bicolor, and S. italica), 13 dicot species (A. coerulea, A. lyrata, A. thaliana, C. papaya, C. sativa, G. max, M. esculenta, M guttatus, M truncatula, P. persica, P. trichocarpa, R. communis, and V. vinifera), the moss P. patens and lycophyte S. moellendorffii were clustered to the GT61 sequences from Arabidopsis and rice at 50% sequence identity using the program uCLUST (8). An alignment of all family members was constructed with MUSCLE (9), and this alignment was used to construct a maximum likelihood phylogeny with PhyML3 (10). The resulting tree was visualized using the tools available from the online resource interactive Tree Of Life (iTOL) (11).

REFERENCES

References Cited by Number

(145) 1. Ebringerova A & Heinze T (2000) Xylan and xylan derivativesbiopolymers with valuable properties, 1. Naturally occurring xylans structures, isolation procedures and properties. Macromol. Rapid Commun. 21:542-556. 2. Vinkx C J A & Delcour J A (1996) Rye (Secale cereale L.) arabinoxylans: A critical review. Journal of Cereal Science 24:1-14. 3. Klein-Marcuschamer D, Holmes B, Simmons B A, & Blanch H W (2011) Biofuel Economics. Plant Biomass Conversion, eds Hood E, Powell R, & P. N (John Wiley & Sons, New York), 1 Ed, pp 329-348 4. Scheller H V & Ulvskov P (2010) Hemicelluloses. Annual Review of Plant Biology 61(1):263-289. 5. Grabber J H, Ralph J, & Hatfield R D (2000) Cross-linking of maize walls by ferulate dimerization and incorporation into lignin. J. Agric. Food Chem. 48(12):6106-6113. 6. Himmel M E, Ding, Shi-You, Johnson, David K., Adney, William S., Nimlos, Mark R., Brady, John W., and Foust, Thomas D. (2007) Biomass recalcitrance: Engineering plants and enzymes for biofuels production. Science 315(5813):804-807. 7. Grabber J H (2005) How do lignin composition, structure, and cross-linking affect degradability? A review of cell wall model studies. Crop Science 45:820-831. 8. Ebringerov A, Hromdkov Z, & Heinze T (2005) Hemicellulose. Advances in Polymer Science 186:1-67. 9. Johansson M H & Samuelson O (1977) Reducing end groups in birch xylan and their alkaline degradation. Wood Science and Technology 11(251-263). 10. Andersson S I, Samuelson O, Ishihara M, & Shimizu K (1983) Structure of the reducing end-groups in spruce xylan. Carbohydr Res. 111:283-288. 11. Pea M J, et al. (2007) Arabidopsis irregular xylem8 and irregular xylem9: Implications for the complexity of glucuronoxylan biosynthesis. Plant Cell 19:549-563. 12. Wende G & Fry S C (1997) 2-O--D-xylopyranosyl-(5-O-feruloyl)-L-arabinose, a widespread component of grass cell walls. Phytochemistry 44:1019-1030. 13. Kusakabe I, Ohgushi, S., Yasui, T. and Kobayashi, T. (1983) Structures of the arabinoxylo-oligosaccharides from the hydrolytic products of corncob arabinoxylan by a xylanase from Streptomyces. Agric. Biol. Chem. 47(12):2713-2723. 14. Yui T, Imada K, Shibuya N, & Ogawa K (1995) Conformation of an arabinoxylan isolated from the rice endosperm cell wall by X-ray diffraction and a conformational analysis. Biosci. Biotech. Biochem 59(6):965-968. 15. Hoije A, Sandstrom, Corine, Roubroeks, Johannes P., Andersson, Roger, Gohil, Suresh, Gatenholm, Paul (2006) Evidence of the presence of 2-O--d-xylopyranosyl--1-arabinofuranose side chains in barley husk arabinoxylan. Carbohydr Res. 341(18):2959-2966. 16. Obel N, Porchia A C, & Scheller H V (2003) Intracellular feruloylation of arabinoxylan in wheat: evidence for feruloyl-glucose as precursor. Planta 216(4):620-629. 17. Persson S, et al. (2007) The Arabidopsis irregular xylem8 mutant is deficient in glucuronoxylan and homogalacturonan, which are essential for secondary cell wall integrity. Plant Cell 19(1):237-255. 18. Brown D M, et al. (2007) Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis. Plant Journal 52:1154-1168. 19. Geisler-Lee J, et al. (2007) A predicted interactome for Arabidopsis. Plant Physiology 145:317-329. 20. Brown D M, Zhang Z N, Stephens E, Dupree P, & Turner S R (2009) Characterization of IRX10 and IRX10-like reveals an essential role in glucuronoxylan biosynthesis in Arabidopsis. Plant Journal 57(4):732-746. 21. Wu A M, et al. (2009) The Arabidopsis IRX10 and IRX10-LIKE glycosyltransferases are critical for glucuronoxylan biosynthesis during secondary cell wall formation. Plant Journal 57(4):718-731. 22. Chen X, et al. (2012) The OsIRX10 glycosyltransferase is critical for xylan biosynthesis in rice. Plant Physiology Submitted. 23. Lee C, Zhong, R, Richardson, E, Himmelsbach, D, McPhail, B, and Ye, Z H (2007) The PARVUS gene is expressed in cells undergoing secondary wall thickening and is essential for glucuronoxylan biosynthesis. Plant Cell Physiology 48:1659-1672. 24. Liepman A H, Wightman R, Geshi N, Turner S R, & Scheller H V (2010) Arabidopsisa powerful model system for plant cell wall research. Plant J 61(6):1107-1121. 25. Mortimer J C, et al. (2010) Absence of branches from xylan in Arabidopsis gux mutants reveals potential for simplification of lignocellulosic biomass. PNAS 107(40):17409-17414. 26. Oikawa A, et al. (2010) An integrative approach to the identification of Arabidopsis and rice genes involved in xylan and secondary wall development. PLoS One 5(11):e15481. 27. Anders N, et al. (2012) Glycosyl transferases in family 61 mediate arabinofuranosyl transfer onto xylan in grasses. PNAS 109(3):989-993. 28. Cao P J, Bartley L E, Jung K H, & Ronald P C (2008) Construction of a rice glycosyltransferase phylogenomic database and identification of rice-diverged glycosyltransferases. Molecular Plant 1(5):858-877. 29. Mitchell R A C, Dupree P, & Shewry P R (2007) A novel bioinformatics approach identifies candidate genes for the synthesis and feruloylation of arabinoxylan. Plant Physiology 144:43-53. 30. Ingelbrecht J A, Verwimp T, & Delcour J A (2000) Endoxylanases in durum wheat semolina processing: Solubilization of arabinoxylans, action of endogenous inhibitors, and effects on rheological properties. J. Agric. Food Chem. 48:2017-2022. 31. Kaneko S, Ishii T, Kobayashi H, & Kusakabe I (1998) Substrate specificities of -L-arabinofuranosidases produced by two species of Aspergillus niger. Biosci. Biotechnol. Biochem 62(4):695-699. 32. Nunan K J & Scheller H V (2003) Solubilization of an arabinan arabinosyltransferase activity from mung bean hypocotyls. Plant Physiology 132(1):331-342. 33. Porchia A C, Sorensen S O, & Scheller H V (2002) Arabinoxylan biosynthesis in wheat. Characterization of arabinosyltransferase activity in Golgi membranes. Plant Physiology 130(1):432-441. 34. Buanafina M M, Langdon T, Hauck B, Dalton S J, & Morris P (2009) Manipulating the phenolic acid content and digestibility of Italian ryegrass (Lolium multiflorum) by vacuolar-targeted expression of a fungal ferulic acid esterase. Appl. Biochem. Biotechnol. 130:416-426. 35. Buanafina M M, Langdon T, Hauck B, Dalton S, & Morris P (2008) Expression of a fungal ferulic acid esterase increases cell wall digestibility of tall fescue (Festuca arundinacea). Plant Biotechnology 6:264-280. 36. Lam T B T, Iiyama K, & Stone B A (2003) Hot alkali-labile linkages in the walls of the forage grass Phalaris aquatica and Lolium perenne and their relation to in vitro wall digestibility. Phytochemistry 64(2):603-607. 37. Kumar R & Wyman C E (2009) Effect of xylanase supplementation of cellulase on digestion of corn stover solids prepared by leading pretreatment technologies. Bioresource Technology 100(18):4203-4213. 38. Vogel J P (2010) Genome sequencing and analysis of the model grass Brachypodium distachyon. Nature 463(7282):763-768. 39. Cantarel B L, et al. (2009) The Carbohydrate-Active EnZymes database (CAZy): an expert resource for glycogenomics. Nucleic Acids Res. 37 (Database issue):D233-238. 40. Strasser R, et al. (2000) Molecular cloning and functional expression of beta1, 2-xylosyltransferase cDNA from Arabidopsis thaliana. FEBS Letters 472(1):105-108. 41. Darvill J E, McNeil M, Darvill A G, & Albersheim P (1980) Structure of plant cell walls. XI. Glucuronoarabinoxylan, a second hemicellulose in the primary cell walls of suspension-cultured sycamore cells. Plant Physiology 66:1135-1139. 42. Naran R, Chen G, & Carpita N C (2008) Novel rhamnogalacturonan I and arabinoxylan polysaccharides of flax seed mucilage. Plant Physiology 148:132-141. 43. Piston F, et al. (2010) Down-regulation of four putative arabinoxylan feruloyl transferase genes from family PF02458 reduces ester-linked ferulate content in rice cell walls. Planta 231:677-691. 44. Buanafina M M (2009) Feruloylation in grasses: Current and future perspectives. Molecular Plant 2(5861-872). 45. Rautengarten C, et al. (2011) The interconversion of UDP-arabinopyranose and UDP-arabinofuranose is indispensable for plant development in Arabidopsis. Plant Cell 23(4):1373-1390. 46. Rautengarten C, et al. (2011) The Arabidopsis Deficient in Cutin Ferulate (DCF) Encodes a Transferase Required for Feruloylation of -Hydroxyfatty Acids in Cutin Polyester. Plant Physiology at the http site world wide web entry plantphysiol.org/content/early/2011/12/08/pp. 111.187187.long. 47. Harholt J, et al. (2006) ARABINAN DEFICIENT1 is a putative arabinosyltransferase involved in biosynthesis of pectic arabinan in Arabidopsis. Plant Physiology 140:49-58. 48. Yin L, et al. (2011) The Cooperative Activities of CSLD2, CSLD3, and CSLD5 Are Required for Normal Arabidopsis Development. Molecular Plant 4(6):1024-1037.

REFERENCES CITED BY NUMBER IN SPECIFICATION SUPPLEMENTAL MATERIAL AND METHODS SECTION

(146) 1. Yin L, et al. (2011) The Cooperative Activities of CSLD2, CSLD3, and CSLD5 Are Required for Normal Arabidopsis Development. Molecular Plant 4(6):1024-1037. 2. Brown D M, et al. (2007) Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis. Plant Journal 52:1154-1168. 3. Harholt J, et al. (2006) ARABINAN DEFICIENT1 is a putative arabinosyltransferase involved in biosynthesis of pectic arabinan in Arabidopsis. Plant Physiology 140:49-58. 4. Harholt J, et al. (2010) Generation of transgenic wheat (Triticum aestivum L.) accumulating heterologous endo-xylanase or ferulic acid esterase in the endosperm. Plant Biotechnology Journal 8(3):351-362. 5. Nelson B K, Cai X, & Nebenfhr A (2007) A multicolored set of in vivo organelle markers for co-localization studies in Arabidopsis and other plants. Plant Journal 51:1126-1136. 6. Ciucanu I, Kerek, F. (1984) A Simple and repaid method for the permethylation of carbohydrates. Carbohydrate Research 131:209-217. 7. York W S, Darvill A G, McNeil M, & Albersheim P (1985) 3-deoxy-d-manno-2-octulosonic acid (KDO) is a component of rhamnogalacturonan II, a pectic polysaccharide in the primary cell walls of plants. Carbohydrate Research 135:109-126. 8. Edgar R C (2010) Search and clustering orders of magnitude faster than BLAST. Bioinformatics 26(19):2460-2461. 9. Edgar R C (2004) MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Research 32 (5):1792-1797. 10. Guindon S & Gascuel O (2003) A Simple, Fast, and Accurate Algorithm to Estimate Large Phylogenies by Maximum Likelihood. Systematic Biology 52(5):696-704. 11. Letunic I & Bork P (2007) Interactive Tree Of Life (iTOL): an online tool for phylogenetic tree display and annotation. Bioinformatics 23(1):127-128.

(147) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.

(148) All publications, accession numbers, patents, and patent applications cited in this specification are herein incorporated by reference as if each was specifically and individually indicated to be incorporated by reference.

(149) TABLE-US-00001 EXAMPLESOFSEQUENCES SEQIDNO:1 RiceXAX1cDNAsequenceCDSlength:1701nucleotides ATGACGTCGACGGCGTACTCCCGGCCGTCGAAGCTGCCGGGCGGCGGCAACGGCAGCGAC CGCAGGCTGCCGCCGCGGCTGATGAGGGGCCTCACCACCAAGATCGAGCCCAAGAAGCTC GGCGTCGGCCTCCTCGCCGGCTGCTGCCTCGCGCTCCTCACCTACGTCTCCCTTGCCAAG CTCTTCGCAATCTACTCCCCTGTGTTCGCCAGCACAGCCAACACATCCGCTCTGATGCAG AACTCGCCGCCATCCTCGCCGGAGACGGGACCCATTCCGCCCCAAGAAACTGCAGCTGGC GCCGGAAACAATGACAGCACTGTGGACCCCGTCGATCTCCCTGAGGACAAGTCGCTGGTG GAGGCGCAGCCTCAAGAACCCGGCTTCCCCTCGGCGGAATCTCAGGAGCCTGGCTTGCCG GCGGCGCTCTCGAGGAAGGAGGATGATGCGGAGAGGGCGGCGGCGGCGGCGGCCTCGGAG ATAAAGCAATCCGAGAAGAAGAACGGCGTGGCGGCGGGTGGTGATACCAAGATAAAGTGC GACGAGAACGGCGTGGACGAGGGCTTCCCGTACGCGCGGCCGTCGGTTTGCGAGCTGTAC GGCGACGTCCGCGTCAGCCCCAAGCAGAAGACCATTTACGTCGTGAACCCGTCGGGCGCC GGCGGCTTCGACGAGAACGGCGAGAAGCGGCTCCGGCCCTACGCCCGCAAGGACGATTTC CTCCTCCCGGGCGTGGTGGAGGTGACTATCAAGTCCGTGCCCTCCGAGGCGGCGGCCCCC AAGTGCACGAAGCAGCACGCCGTCCCCGCCGTGGTGTTCTCCGTGGCCGGGTACACGGAC AACTTCTTCCACGACATGACCGATGCCATGATCCCGCTATTCCTGACGACGGCGCACCTC AAGGGCGAGGTCCAGATCCTCATCACCAACTACAAGCCGTGGTGGGTGCAGAAGTACACG CCGCTGCTCCGCAAGCTGTCCAACTACGACGTCATCAACTTCGACGAGGACGCCGGCGTG CACTGCTTCCCGCAGGGGTACCTCGGTCTGTACCGCGACCGCGACCTCATCATCTCCCCG CACCCGACCCGCAACCCGCGCAACTACACCATGGTGGACTACAACCGCTTCCTCCGCGAC GCTCTGGAGCTCCGGCGCGACCGCCCGTCGGTGCTGGGCGAGGAGCCCGGGATGCGGCCG CGGATGCTGATCATCTCCCGCGCCGGCACGCGCAAGCTGCTGAACCTCGAGGAGGTGGCC GCGGCCGCGACGGAGCTTGGTTTCAACGTGACGGTGGCGGAGGCCGGTGCTGACGTGCCC GCGTTCGCGGCGCTGGTGAACTCGGCGGACGTGCTGCTGGCCGTGCACGGCGCCGGGCTG ACGAACCAGATCTTCCTCCCGGCGGAGGCCGTGGTGGTGCAGATCGTGCCGTGGGGGAAC ATGGACTGGATGGCGACCAACTTTTACGGGCAGCCGGCGAGGGACATGCAGCTCCGGTAC GTGGAGTACTACGTCGGCGAGGAGGAGACGAGCCTGAAGCACAACTACTCGCGAGATCAC ATGGTGTTCAAGGACCCCAAGGCGCTCCACGCACAGGGATGGCAGACACTCGCCGCGACT ATCATGAAGCAGGACGTCGAGGTCAACCTCACCAGGTTCCGGCCAATCCTGCTGCAGGCG CTCGACAGGCTGCAGCAGTAA SEQIDNO:2 0s02g22380.1RiceXAX1proteinsequence:566aminoacids MTSTAYSRPSKLPGGGNGSDRRLPPRLMRGLTTKIEPKKLGVGLLAGCCLALLTYVSLAK LFAIYSPVFASTANTSALMQNSPPSSPETGPIPPQETAAGAGNNDSTVDPVDLPEDKSLV EAQPQEPGFPSAESQEPGLPAALSRKEDDAERAAAAAASEIKQSEKKNGVAAGGDTKIKC DENGVDEGFPYARPSVCELYGDVRVSPKQKTIYVVNPSGAGGFDENGEKRLRPYARKDDF LLPGVVEVTIKSVPSEAAAPKCTKQHAVPAVVFSVAGYTDNFFHDMTDAMIPLFLTTAHL KGEVQILITNYKPWWVQKYTPLLRKLSNYDVINFDEDAGVHCFPQGYLGLYRDRDLIISP HPTRNPRNYTMVDYNRFLRDALELRRDRPSVLGEEPGMRPRMLIISRAGTRKLLNLEEVA AAATELGFNVTVAEAGADVPAFAALVNSADVLLAVHGAGLTNQIFLPAEAVVVQIVPWGN MDWMATNFYGQPARDMQLRYVEYYVGEEETSLKHNYSRDHMVFKDPKALHAQGWQTLAAT IMKQDVEVNLTRFRPILLQALDRLQQ* SEQIDNO:3 0s02g22380RiceXAX1genomicDNAsequence CCCATCCTCACCGATCTCTCTAAACCCAAATACGCAACAAATACTCAATCGTCACATCTT AAAAAACAAAGAAAAAGGAAGAGAGAGAGAGAGGGAAAACAAAAAAGAAAAGAAAAATCA ATTCCCAACCTTGCTGCTACAAATGCCTCAGGCTTAGCAACTCGACCTCCTCCCCCCTTC TCCCCTTCCTCCCTTCTTTGACTTCCCCTTTCCTCCTCCGTGCGCACGCTCTCCTGATTC ATACAGCATTTCGTCGGGGATGACGTCGACGGCGTACTCCCGGCCGTCGAAGCTGCCGGG CGGCGGCAACGGCAGCGACCGCAGGCTGCCGCCGCGGCTGATGAGGGGCCTCACCACCAA GATCGAGCCCAAGAAGCTCGGCGTCGGCCTCCTCGCCGGCTGCTGCCTCGCGCTCCTCAC CTACGTCTCCCTTGCCAAGCTCTTCGCAATCTACTCCCCTGTGTTCGGTGCGTGCTCCCC TAATCCCGATCCGCCCTAGGAGCTTACTTTTGGTTAAATCCCCTCCCGCGTTGTCTCTCG AATCCAATCCATTTTGATTTAGTCTAATGGGAGCTGTTTTGAATCCGTTTTCAGCCAGCA CAGCCAACACATCCGCTCTGATGCAGAACTCGCCGCCATCCTCGCCGGAGACGGGACCCA TTCCGCCCCAAGAAACTGCAGCTGGCGCCGGAAACAATGACAGCACTGTGGACCCCGTCG ATCTCCCTGAGGACAAGTCGCTGGTGGAGGCGCAGCCTCAAGAACCCGGCTTCCCCTCGG CGGAATCTCAGGAGCCTGGCTTGCCGGCGGCGCTCTCGAGGAAGGAGGATGATGCGGAGA GGGCGGCGGCGGCGGCGGCCTCGGAGATAAAGCAATGTAAGGAAATCTTGCCTCTTTCTT CCGCTCCCTTTTATTTGCGCACCTTTACTGGAAGGCAGAGCAAGCTACAGTAGAGCAAGT CCCCAGTTGTTGTTGAGCGCAAGCAAGCAATCAATCTCGTTTGGATTTGGTAGAGACGCA CGAGATCTGGGCGGTGTTTTATTGGGGATTTGATGGTAATTCAGTCTCGTTGGTTTGGTT AATTCAGCCGAGAAGAAGAACGGCGTGGCGGCGGGTGGTGATACCAAGATAAAGTGCGAC GAGAACGGCGTGGACGAGGGCTTCCCGTACGCGCGGCCGTCGGTTTGCGAGCTGTACGGC GACGTCCGCGTCAGCCCCAAGCAGAAGACCATTTACGTCGTGAACCCGTCGGGCGCCGGC GGCTTCGACGAGAACGGCGAGAAGCGGCTCCGGCCCTACGCCCGCAAGGACGATTTCCTC CTCCCGGGCGTGGTGGAGGTGACTATCAAGTCCGTGCCCTCCGAGGCGGCGGCCCCCAAG TGCACGAAGCAGCACGCCGTCCCCGCCGTGGTGTTCTCCGTGGCCGGGTACACGGACAAC TTCTTCCACGACATGACCGATGCCATGATCCCGCTATTCCTGACGACGGCGCACCTCAAG GGCGAGGTCCAGATCCTCATCACCAACTACAAGCCGTGGTGGGTGCAGAAGTACACGCCG CTGCTCCGCAAGCTGTCCAACTACGACGTCATCAACTTCGACGAGGACGCCGGCGTGCAC TGCTTCCCGCAGGGGTACCTCGGTCTGTACCGCGACCGCGACCTCATCATCTCCCCGCAC CCGACCCGCAACCCGCGCAACTACACCATGGTGGACTACAACCGCTTCCTCCGCGACGCT CTGGAGCTCCGGCGCGACCGCCCGTCGGTGCTGGGCGAGGAGCCCGGGATGCGGCCGCGG ATGCTGATCATCTCCCGCGCCGGCACGCGCAAGCTGCTGAACCTCGAGGAGGTGGCCGCG GCCGCGACGGAGCTTGGTTTCAACGTGACGGTGGCGGAGGCCGGTGCTGACGTGCCCGCG TTCGCGGCGCTGGTGAACTCGGCGGACGTGCTGCTGGCCGTGCACGGCGCCGGGCTGACG AACCAGATCTTCCTCCCGGCGGAGGCCGTGGTGGTGCAGATCGTGCCGTGGGGGAACATG GACTGGATGGCGACCAACTTTTACGGGCAGCCGGCGAGGGACATGCAGCTCCGGTACGTG GAGTACTACGTCGGCGAGGAGGAGACGAGCCTGAAGCACAACTACTCGCGAGATCACATG GTGTTCAAGGACCCCAAGGCGCTCCACGCACAGGGATGGCAGACACTCGCCGCGACTATC ATGAAGCAGGACGTCGAGGTCAACCTCACCAGGTTCCGGCCAATCCTGCTGCAGGCGCTC GACAGGCTGCAGCAGTAACTCGTCTATCCCAATAATCGCAGGCAGCTCATGGCACACATC AATGTATATGCCGGGACGAGACGACACGACGAGGAACAAGAACGGATACTAGTATATTGT ACTGCTGCTTGAAAGAGATGATGATGATCTTAACCGGAGGAGAACCATCAGTTGTTGGCG AGGCGGTGGAAGCTTTTCGCATATTGGTAATTGGTTGGGTTGTCCATTTTGGGTTTGTAA CAATTTGCATAGGCATTACACACCAAAGATGTTCGATTTTTTTGTTCTTCTTACACTTCT TCACTTCGCCAGCCCATTCAACACTATACATTCTTTTCTACTAATACGGAGCCAAACTAA ACTATGGTGTTTAATTATTAAAACATCAAATTGGTCACCCAAACAAAACAAAGTGGCGAT GAAAGAAAGATCCAAATCTGAGAGTTGTTTCAGACATGTGCAATCTCCTCTAATAAATTG AACAAATGGTTGTTAAACGAATCTGCATCCCGAGCGTTGAAGGGGCTTAGCTGGTGCGGA CGTGCCAGCATGGAAGTGTTCGTGGAGAAGGAAAATGGATTCGATGCTCTGTCCAACACT GGTGAACTGCTGTATATGCACCCGCCTGCTGCCTGCTTTCAGCTTAAGGAAAAGATCACT AATAATTGAAAAGCACAGGCTAACTAACCGGGCTCTGCAAGAAAGCTGTGACAGGTAAGT CGTAACTAGTTTTGGGCAATCGAATACCTTCTCTCTTTTCTTCTCTTTTCTTGAGAGGCA GACAGGGAGATATAGAGAAAGACCTTCTCCTTTTATCTTTATTTTTTCTTTTTTCCTAGA ACCTTCTTGCTGTCTTTTGGTAGGGAAAGAGACTAGAAAATGGAACGATGATGAATGCAT GAATTTCCCATAAGAAATTGGCAAGCTAGCCTCACCTTTTCAGTATCGTATGCATCACGC GAAAAGATTAATCACAAGAGGGTGACCCGGCAACGAGAAGAGGAGATCAGCCAAGACAAT CTTGTAGCCGTTAGTATGAAACACACGATTAATCACAAGCCACGCCATGCTCTTCATGC SEQIDNO:4Glade4Bradi4g27360.1_(B.distachyon)Brachypodium distachyonGlade4(XAX1)aminoacidsequence MASTAYTRPSKPPGLAGERRPAARLSRELGRIEPKKLGIGLVAGCCLALLTYISFARLFAIYSPVFESTS LVMKNAPPASTAVPSTESGTVQQKIELEDEKDVVEDPKEPSFPEEERKVEEKEEETAVTKPSGGGDAAET KIICDENGVDEGFPYARPSVCELTGDIRISPREKTMFFVTPSAAGAAALDANGEKKIRPYARKDTFLLPG VVEVTIKSVPSAEAAPACTRQHDVPAVVFSVAGYTDNFFHDNTDVMIPLFLTTAHLRGEVQLLITNFKPW WVKKFTPLLKKLSNYEVINFDKDEEVRCFRQGNLGLYRDRDLILSPHPTRNPRNYTMVDYNRFLRGAFGL PRDAPAVLGEKTSARPKMLMIERKGTRKLLNLAAVVAMCEELGFAVTVAEAGADVRGFAETVNAADVLLA VHGAGLTNQIFLPTGAVMVQIVPWGKMDWMATNFYGQPARDMQLRYVEYYVSEEETTLKDRFPRDHYVFK DPMAIHAQGWPALADIVMKQDVMVNVTRFKPFLLSALDKLQE SEQIDNO:5Sb10g018270.1_(S.bicolor)SorghumGlade4(XAX1)amino acidsequence MASTAYSRPSKPPGPAAGERKGPRLAKELGRIEPKKLGIGLVAGCCLALLTYLSFARLFAIYSPVLDSSS LLLKNTPPATTTVPATEALPVQQKTQVEDQKDAPDPELDPNMPNLPEVTQKDQQEAATATKPAGAVTEAK ITCDENGVDEGFPYARPPVCELAGDIRISPKEKAMYLVNPSGAGPFDSNGEKKIRPFARNDGFLLPGVVE VTIKSVSSAAAAPQCTRRHDVPVVVFSVAGYTDNFFHDNTDVLIPLFLTTAHLKGEVQFLITNFKPWWVN KFTPLLKKLSNYDVINFDEDKEVHCFRAGHLGMYRDRDLIISPHPTRNPHNYSMVDYNRFLRRAFSLPRD APAVLGAETSAKPKMLIIERKGTRKLLNLREVAAMCEALGFAVTVAEAGADVRGFAERVNAADVLLAVHG AGLTNQIFLPTGAVLVQIVPWGKMDWMATNFYGQPARDMRLRYVEYYVSEEETTLKDKYPRDHYVFKDPM RIHAQGWPAIAEIIMKQDVMVNMTRFKPFLLKALDELQE SEQIDNO:6Bradi3g11340.1_(B.distachyon)Brachypodiumdistachyon Glade4(XAX1)aminoacidsequence MAGSQEPGLPEAVSRKDDAEKTAAAAEPKPKPSEENPEKSNVAAAVEGTAKANMTCDENGVDEGFPYARP AVCELSGDIRVSPKQKTMYLVNPSGAATGFDEKGEKRLRPYARNDDFLLPGVVEVTVKSVPSTAAAPQCT KQHRVPAVVFSVAGYTDNFFHDNTDALIPLYVTTAHLKGEVQLLITNYKPWWVQKYTPVLRKLSSYDVIN FDEDAGVHCFHEGYLGLYRDRDLIISPHPTRNPRNYTMVDYNRFLRGVFELRRERPAVLGEEPGMRPRML IISRSGTRKLLNLDEVAAEASELGFNVTVAEAGADVPAFAALVNSADVLLAVHGAGLTNQIFLPTDAVVL QIVPWGNMDWQATNFYGQPAREMQLRYVEYYVGEEETSLKDKYPRDHMVFKDPKALHKQGWQTLANTIMK QDVQVNITRFRPFLLQAIDKLQP SEQIDNO:7Bradilg06560.1_(B.distachyon)Brachypodiumdistachyon Glade4(XAX1)aminoacidsequence MNSTAYSRPSKLPGGAGGERRPPRLMRGFAAKIEPKKLGAGLLAGCCLALLTYVSLAKLFAIYSPVFAST ANTSGLLQNSPPSSSSVPETTDAIPAEATFVGRKNDDPAADPVDFPEEGPSMDGSQEPGLPEVVSRKEDD AEKAIAATSQPKPSEEDSAAAGAGEGTPPAKMTCDENGVDEGFPYARPAVCELSGDIRVSPKDKTMYLVN PSGAAAGFDENGEKRLRPYARKDEFLLPAVVEVTVKSVPSASGAPRCTKRHRVPAVVFSVAGYTDNFFHD NTDALIPLFLTTAHLKGEVQLLITNYKPWWVQKYTPVLRKLSNYDVINFDDEDGGAVHCFPDGYLGLYRD RDLIISPHPTRNPRNYTMVDYNKFLRGALELPREKPAVLGEEPGMRPRMLIISRSGTRRLLNLDEVSAAA SELGFNVTVAEAGGEADVPAFAAMVNSADVLLAVHGAGLTNQIFLPTNAVVLQIVPWGNMDWMATNFYGQ PAREMQLRYVEYYVGEEETSLKDKYPRDHVVFRDPKALHTQGWETLADTIMKQDVQVDLSRFRPFLLQAI DKLQE SEQIDNO:8Sb04g000840.1_(S.bicolor)SorghumGlade4(XAX1)amino acidsequence MTSTAYSRSSKLPGGGPERRLPPRLMRSLTSKIEPKKLGVGLVAGCCLALLTYVSLAKLFAIYSPVFAST ANTSALMQNAPPTSSKPSVPETETIPPQETFGGAGADPREAVTGSEEPGLPEAAVTRKDMAGSDEPGLPT RKDDGDNAAAAEPTKPAAAAAAEDKKEGDDGNGGQGGGKMTCDENGVDEGFPYARPTVCELSGDVRVSPK QKTVYLVNPSGAGGFDESGEKRLRPYARKDDFLMPGVTEVTVKSVPSAAVAPKCTKHHTVPAVLFSIAGY TDNFFHDMVDAMVPLFLTTSHLKGEVQLLITNYKPWWVQKYTPLLRKMSLHDVINFDAEDADDVHCFPAG AFVGLYRDRDLILSPHPTRNPRNLTMVDFSRFMRGALALPRDRPAVLGEAPGMRPRMLIISRAGTRRLLN LDEVAKVADELGFNVTIAEAGADVPAFAAQVNAADVLVGVHGAGLANVVFLPTEAVVVQIVPWGKMDWMA TNFYARPAAGMALRYLEYYVGEEETSLKDKYPRDHVVFRDPMSLHTQGWQALAQTIMKQDVAVNLTKFRP VLLQALDKLQQ