Increasing Specificity for RNA-Guided Genome Editing
20240240207 ยท 2024-07-18
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/0071
CHEMISTRY; METALLURGY
C12N15/01
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2710/00033
CHEMISTRY; METALLURGY
C12N2770/00033
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12Y114/11
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
C12N15/1031
CHEMISTRY; METALLURGY
C07K2319/80
CHEMISTRY; METALLURGY
C12Y301/21004
CHEMISTRY; METALLURGY
C07K2319/01
CHEMISTRY; METALLURGY
International classification
C12N15/90
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
C12N15/01
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
Abstract
Methods for increasing specificity of RNA-guided genome editing, e.g., editing using CRISPR/Cas9 systems.
Claims
1-30. (canceled)
31. A tracrRNA comprising one or more deoxyribonucleotides.
32. The tracrRNA of claim 31, wherein the tracrRNA is selected from the group consisting of: GGAACCAUUCAAAACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUC AACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:15) or an active portion thereof; UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACC GAGUCGGUGC (SEQ ID NO:16) or an active portion thereof; or AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGG CACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof, wherein one or more of the nucleotides is a deoxyribonucleic acid.
33. The tracrRNA of claim 31, wherein the tracrRNA molecule is truncated from its 3 end by at least 10 nt.
34. The tracrRNA of claim 31, wherein the tracrRNA molecule is truncated from its 3 end by at least 1 nt.
35. The tracr RNA of claim 31, wherein the tracrRNA molecule is truncated from its 5 end by at least 10 nt.
36. The tracrRNA of claim 31, wherein the tracrRNA molecule is truncated by at least 10 nt on the 5 end and by at least 1 nt on the 3 end.
37. A nucleic acid encoding the tracrRNA of claim 31.
38. A vector comprising the nucleic acid of claim 37.
39. A host cell expressing the tracrRNA of claim 31.
40. A composition comprising nucleic acid(s) encoding the tracrRNA of claim 31 and a crRNA.
41. The composition of claim 40 wherein the crRNA comprises a deoxyribonucleic acid.
42. The composition of claim 40, wherein the crRNA comprises: (i) a target complementarity region at the 5 end; and (ii) a non-complementary region immediately 3 of the target complementary region.
43. The composition of claim 42, wherein the target complementarity region is from 17 to 25 nucleotides long.
44. The composition of claim 43, wherein the non-complementary region comprises: GUUUUAGAGCUAUGCUGUUUUG(X.sub.N); GUUUUAGAGCUA; GUUUUAGAGCUAUGCUGUUUUG; GUUUUAGAGCUAUGCU; GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCG(X.sub.N); GUUUUAGAGCUAUGCUGAAAAGCAUAGCAAGUUAAAAUAAGGCUAGUCCG UUAUC(X.sub.N); GUUUUAGAGCUAUGCUGUUUUGGAAACAAAACAGCAUAGCAAGUUAAAAU AAGGCUAGUCCGUUAUC(X.sub.N); GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAAC UUGAAAAAGUGGCACCGAGUCGGUGC(X.sub.N), GUUUAAGAGCUAGAAAUAGCAAGUUUAAAUAAGGCUAGUCCGUUAUCAAC UUGAAAAAGUGGCACCGAGUCGGUGC; GUUUUAGAGCUAUGCUGGAAACAGCAUAGCAAGUUUAAAUAAGGCUAGUC CGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC; or GUUUAAGAGCUAUGCUGGAAACAGCAUAGCAAGUUUAAAUAAGGCUAGUC CGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC, wherein X.sub.N is any sequence that does not interfere with the binding of the ribonucleic acid to Cas9.
45. The composition of claim 40, further comprising a nucleic acid encoding a S. pyogenes Cas9 protein or variant thereof.
46. The composition of claim 45, wherein the S. pyogenes Cas9 or variant thereof has at least 90% sequence identity to the amino acid of SEQ ID NO: 18, optionally with mutations at one or more of D10, E762, H983, H840, and N863.
47. The composition of claim 45, wherein the S. pyogenes Cas9 or variant thereof is fused to a heterologous functional domain, with an optional intervening linker.
48. A composition comprising: a tracrRNA; a crRNA; and a S. pyogenes Cas9 protein or variant thereof, wherein the tracrRNA and/or the crRNA comprise a deoxyribonucleic acid.
49. The composition of claim 48, wherein the tracrRNA comprises a deoxyribonucleic acid.
50. The composition of claim 48, wherein the crRNA comprises a deoxyribonucleic acid.
51. The composition of claim 48, wherein the crRNA and the tracrRNA each comprise a deoxyribonucleic acid.
Description
DESCRIPTION OF DRAWINGS
[0093]
[0094]
[0095]
[0096]
TABLE-US-00002 EGFPSite1 SEQIDNO:1 GGGCACGGGCAGCTTGCCGGTGG EGFPSite2 SEQIDNO:2 GATGCCGTTCTTCTGCTTGTCGG EGFPSite3 SEQIDNO:3 GGTGGTGCAGATGAACTTCAGGG
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
DETAILED DESCRIPTION
[0112] CRISPR RNA-guided nucleases (RGNs) have rapidly emerged as a facile and efficient platform for genome editing. Although Marraffini and colleagues (Jiang et al., Nat Biotechnol 31, 233-239 (2013)) recently performed a systematic investigation of Cas9 RGN specificity in bacteria, the specificities of RGNs in human cells have not been extensively defined. Understanding the scope of RGN-mediated off-target effects in human and other eukaryotic cells will be critically essential if these nucleases are to be used widely for research and therapeutic applications. The present inventors have used a human cell-based reporter assay to characterize off-target cleavage of Cas9-based RGNs. Single and double mismatches were tolerated to varying degrees depending on their position along the guide RNA (gRNA)-DNA interface. Off-target alterations induced by four out of six RGNs targeted to endogenous loci in human cells were readily detected by examination of partially mismatched sites. The off-target sites identified harbor up to five mismatches and many are mutagenized with frequencies comparable to (or higher than) those observed at the intended on-target site. Thus RGNs are highly active even with imperfectly matched RNA-DNA interfaces in human cells, a finding that might confound their use in research and therapeutic applications.
[0113] The results described herein reveal that predicting the specificity profile of any given RGN is neither simple nor straightforward. The EGFP reporter assay experiments show that single and double mismatches can have variable effects on RGN activity in human cells that do not strictly depend upon their position(s) within the target site. For example, consistent with previously published reports, alterations in the 3 half of the gRNA/DNA interface generally have greater effects than those in the 5 half (Jiang et al., Nat Biotechnol 31, 233-239 (2013); Cong et al., Science 339, 819-823 (2013); Jinek et al., Science 337, 816-821 (2012)); however, single and double mutations in the 3 end sometimes also appear to be well tolerated whereas double mutations in the 5 end can greatly diminish activities. In addition, the magnitude of these effects for mismatches at any given position(s) appears to be site-dependent. Comprehensive profiling of a large series of RGNs with testing of all possible nucleotide substitutions (beyond the Watson-Crick transversions used in our EGFP reporter experiments) may help provide additional insights into the range of potential off-targets. In this regard, the recently described bacterial cell-based method of Marraffini and colleagues (Jiang et al., Nat Biotechnol 31, 233-239 (2013)) or the in vitro, combinatorial library-based cleavage site-selection methodologies previously applied to ZFNs by Liu and colleagues (Pattanayak et al., Nat Methods 8, 765-770 (2011)) might be useful for generating larger sets of RGN specificity profiles.
[0114] Despite these challenges in comprehensively predicting RGN specificities, it was possible to identify bona fide off-targets of RGNs by examining a subset of genomic sites that differed from the on-target site by one to five mismatches. Notably, under conditions of these experiments, the frequencies of RGN-induced mutations at many of these off-target sites were similar to (or higher than) those observed at the intended on-target site, enabling the detection of mutations at these sites using the T7EI assay (which, as performed in our laboratory, has a reliable detection limit of ?2 to 5% mutation frequency). Because these mutation rates were very high, it was possible to avoid using deep sequencing methods previously required to detect much lower frequency ZFN- and TALEN-induced off-target alterations (Pattanayak et al., Nat Methods 8, 765-770 (2011); Perez et al., Nat Biotechnol 26, 808-816 (2008); Gabriel et al., Nat Biotechnol 29, 816-823 (2011); Hockemeyer et al., Nat Biotechnol 29, 731-734 (2011)). Analysis of RGN off-target mutagenesis in human cells also confirmed the difficulties of predicting RGN specificitiesnot all single and double mismatched off-target sites show evidence of mutation whereas some sites with as many as five mismatches can also show alterations. Furthermore, the bona fide off-target sites identified do not exhibit any obvious bias toward transition or transversion differences relative to the intended target sequence.
[0115] Although off-target sites were seen for a number of RGNs, identification of these sites was neither comprehensive nor genome-wide in scale. For the six RGNs studied, only a very small subset of the much larger total number of potential off-target sequences in the human genome (sites that differ by three to six nucleotides from the intended target site) was examined. Although examining such large numbers of loci for off-target mutations by T7EI assay is neither a practical nor a cost-effective strategy, the use of high-throughput sequencing in future studies might enable the interrogation of larger numbers of candidate off-target sites and provide a more sensitive method for detecting bona fide off-target mutations. For example, such an approach might enable the unveiling of additional off-target sites for the two RGNs for which we failed to uncover any off-target mutations. In addition, an improved understanding both of RGN specificities and of any epigenomic factors (e.g., DNA methylation and chromatin status) that may influence RGN activities in cells might also reduce the number of potential sites that need to be examined and thereby make genome-wide assessments of RGN off-targets more practical and affordable.
[0116] As described herein, a number of strategies can be used to minimize the frequencies of genomic off-target mutations. For example, the specific choice of RGN target site can be optimized: given that off-target sites that differ at up to five positions from the intended target site can be efficiently mutated by RGNs, choosing target sites with minimal numbers of off-target sites as judged by mismatch counting seems unlikely to be effective: thousands of potential off-target sites that differ by four or five positions within the 20 bp RNA:DNA complementarity region will typically exist for any given RGN targeted to a sequence in the human genome. It is also possible that the nucleotide content of the gRNA complementarity region might influence the range of potential off-target effects. For example, high GC-content has been shown to stabilize RNA:DNA hybrids (Sugimoto et al., Biochemistry 34, 11211-11216 (1995)) and therefore might also be expected to make gRNA/genomic DNA hybridization more stable and more tolerant to mismatches. Additional experiments with larger numbers of gRNAs will be needed to assess if and how these two parameters (numbers of mismatched sites in the genome and stability of the RNA:DNA hybrid) influence the genome-wide specificities of RGNs. However, it is important to note that even if such predictive parameters can be defined, the effect of implementing such guidelines would be to further restrict the targeting range of RGNs.
[0117] One potential general strategy for reducing RGN-induced off-target effects might be to reduce the concentrations of gRNA and Cas9 nuclease expressed in the cell. This idea was tested using the RGNs for VEGFA target sites 2 and 3 in U2OS.EGFP cells: transfecting less gRNA- and Cas9-expressing plasmid decreased the mutation rate at the on-target site but did not appreciably change the relative rates of off-target mutations. Consistent with this, high-level off-target mutagenesis rates were also observed in two other human cell types (HEK293 and K562 cells) even though the absolute rates of on-target mutagenesis are lower than in U2OS.EGFP cells. Thus, reducing expression levels of gRNA and Cas9 in cells is not likely to provide a solution for reducing off-target effects. Furthermore, these results also suggest that the high rates of off-target mutagenesis observed in human cells are not caused by overexpression of gRNA and/or Cas9.
[0118] The finding that significant off-target mutagenesis can be induced by RGNs in three different human cell types has important implications for broader use of this genome-editing platform. For research applications, the potentially confounding effects of high frequency off-target mutations will need to be considered, particularly for experiments involving either cultured cells or organisms with slow generation times for which the outcrossing of undesired alterations would be challenging. One way to control for such effects might be to utilize multiple RGNs targeted to different DNA sequences to induce the same genomic alteration because off-target effects are not random but instead related to the targeted site. However, for therapeutic applications, these findings clearly indicate that the specificities of RGNs will need to be carefully defined and/or improved if these nucleases are to be used safely in the longer term for treatment of human diseases.
Methods for Improving Specificity
[0119] As shown herein, CRISPR-Cas RNA-guided nucleases based on the S. pyogenes Cas9 protein can have significant off-target mutagenic effects that are comparable to or higher than the intended on-target activity (Example 1). Such off-target effects can be problematic for research and in particular for potential therapeutic applications. Therefore, methods for improving the specificity of CRISPR-Cas RNA guided nucleases (RGNs) are needed.
[0120] As described in Example 1, Cas9 RGNs can induce high-frequency indel mutations at off-target sites in human cells (see also Cradick et al., 2013; Fu et al., 2013: Hsu et al., 2013; Pattanayak et al., 2013). These undesired alterations can occur at genomic sequences that differ by as many as five mismatches from the intended on-target site (see Example 1). In addition, although mismatches at the 5 end of the gRNA complementarity region are generally better tolerated than those at the 3 end, these associations are not absolute and show site-to-site-dependence (see Example 1 and Fu et al., 2013: Hsu et al., 2013; Pattanayak et al., 2013). As a result, computational methods that rely on the number and/or positions of mismatches currently have limited predictive value for identifying bona fide off-target sites. Therefore, methods for reducing the frequencies of off-target mutations remain an important priority if RNA-guided nucleases are to be used for research and therapeutic applications.
Strategy #1: Synthetic Alternatives to Standard gRNAs to Improve Specificity
[0121] Guide RNAs generally speaking come in two different systems: System 1, which uses separate crRNA and tracrRNAs that function together to guide cleavage by Cas9, and System 2, which uses a chimeric crRNA-tracrRNA hybrid that combines the two separate guide RNAs in a single system (referred to as a single guide RNA or sgRNA, see also Jinek et al., Science 2012: 337:816-821). The tracrRNA can be variably truncated and a range of lengths has been shown to function in both the separate system (system 1) and the chimeric gRNA system (system 2). For example, in some embodiments, tracrRNA may be truncated from its 3 end by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts. In some embodiments, the tracrRNA molecule may be truncated from its 5 end by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts. Alternatively, the tracrRNA molecule may be truncated from both the 5 and 3 end, e.g., by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or 20 nts on the 5 end and at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts on the 3 end. See, e.g., Jinek et al., Science 2012: 337:816-821: Mali et al., Science. 2013 Feb 15:339(6121); 823-6; Cong et al., Science. 2013 Feb 15:339(6121); 819-23; and Hwang and Fu et al., Nat Biotechnol. 2013 Mar:31(3);227-9; Jinek et al., Elife 2, e00471 (2013)). For System 2, generally the longer length chimeric gRNAs have shown greater on-target activity but the relative specificities of the various length gRNAs currently remain undefined and therefore it may be desirable in certain instances to use shorter gRNAs. In some embodiments, the gRNAs are complementary to a region that is within about 100-800 bp upstream of the transcription start site, e.g., is within about 500 bp upstream of the transcription start site, includes the transcription start site, or within about 100-800 bp, e.g., within about 500 bp, downstream of the transcription start site. In some embodiments, vectors (e.g., plasmids) encoding more than one gRNA are used, e.g., plasmids encoding, 2, 3, 4, 5, or more gRNAs directed to different sites in the same region of the target gene.
[0122] Described herein are guide RNAs, e.g., single gRNAs or crRNA and tracrRNA, that include one or more modified (e.g., locked) nucleotides or deoxyribonucleotides.
Strategy 1A: Modified Nucleic Acid Molecules
[0123] Modified RNA oligonucleotides such as locked nucleic acids (LNAs) have been demonstrated to increase the specificity of RNA-DNA hybridization by locking the modified oligonucleotides in a more favorable (stable) conformation. For example, 2-O-methyl RNA is a modified base where there is an additional covalent linkage between the 2 oxygen and 4 carbon which when incorporated into oligonucleotides can improve overall thermal stability and selectivity (formula I).
##STR00001##
[0124] Guide RNAs as described herein may be synthetic guide RNA molecules wherein one, some or all of the nucleotides 5 region of the guide RNA complementary to the target sequence are modified, e.g., locked (2-O-4-C methylene bridge), 5-methylcytidine, 2-O-methyl-pseudouridine, or in which the ribose phosphate backbone has been replaced by a polyamide chain (peptide nucleic acid), e.g., a synthetic ribonucleic acid.
[0125] In another embodiment, one, some or all of the nucleotides of the gRNA sequence may be modified, e.g., locked (2-O-4-C methylene bridge), 5-methylcytidine, 2-O-methyl-pseudouridine, or in which the ribose phosphate backbone has been replaced by a polyamide chain (peptide nucleic acid), e.g., a synthetic ribonucleic acid.
[0126] In a cellular context, complexes of Cas9 with these synthetic gRNAs could be used to improve the genome-wide specificity of the CRISPR/Cas9 nuclease system. Exemplary modified or synthetic gRNAs may comprise, or consist of, the following sequences: [0127] (X.sub.17-20) GUUUUAGAGCUAUGCUGUUUUG(X.sub.N) (SEQ ID NO:4); [0128] (X.sub.17-20)GUUUUAGAGCUA (SEQ ID NO:5); [0129] (X.sub.17-20) GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO:6); [0130] (X.sub.17-20)GUUUUAGAGCUAUGCU (SEQ ID NO:7); [0131] (X.sub.17-20)GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCG(X.sub.N) (SEQ ID NO:8); [0132] (X.sub.17-20)GUUUUAGAGCUAUGCUGAAAAGCAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUC(X.sub.N) (SEQ ID NO:9); [0133] (X.sub.17-20)GUUUUAGAGCUAUGCUGUUUUGGAAACAAAACAGCAUAGCAAGU UAAAAUAAGGCUAGUCCGUUAUC(X.sub.N) (SEQ ID NO:10); [0134] (X.sub.17-20)GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUU AUCAACUUGAAAAAGUGGCACCGAGUCGGUGC(X.sub.N) (SEQ ID NO:11), [0135] (X.sub.17-20)GUUUAAGAGCUAGAAAUAGCAAGUUUAAAUAAGGCUAGUCCGUU AUCAACUUGAAAAAGUGGCACCGAGUCGGUGC(SEQ ID NO:12); [0136] (X.sub.17-20)GUUUUAGAGCUAUGCUGGAAACAGCAUAGCAAGUUUAAAUAAGG CUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:13); or [0137] (X.sub.17-20)GUUUAAGAGCUAUGCUGGAAACAGCAUAGCAAGUUUAAAUAAGG CUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:14), wherein X.sub.17-20 is a sequence complementary to 17-20 nts of a target sequence, preferably a target sequence immediately 5 of a protospacer adjacent motif (PAM), e.g., NGG, NAG, or NNGG, and further wherein one or more of the nucleotides are locked, e.g., one or more of the nucleotides within the sequence X.sub.17-20, one or more of the nucleotides within the sequence X.sub.N, or one or more of the nucleotides within any sequence of the gRNA. In some embodiments, X.sub.17-20 is X.sub.17-18, e.g., is 17-18 nucleotides long: in some embodiments, the target complementarity can be longer, e.g., 17-20, 21, 22, 23, 24, 25, or more nucleotides long. X.sub.N is any sequence, wherein N (in the RNA) can be 0-200, e.g., 0-100, 0-50, or 0-20, that does not interfere with the binding of the ribonucleic acid to Cas9. In some embodiments the RNA includes one or more U, e.g., 1 to 8 or more Us (e.g., U, UU, UUU, UUUU, UUUUU, UUUUUU, UUUUUUU, UUUUUUUU) at the 3 end of the molecule, as a result of the optional presence of one or more Ts used as a termination signal to terminate RNA PolIII transcription.
[0138] In addition, in a system that uses separate crRNA and tracrRNA, one or both can be synthetic and include one or more locked nucleotides, as dual gRNAs (e.g., the crRNA and tracrRNA found in naturally occurring systems) can also be modified. In this case, a single tracrRNA would be used in conjunction with multiple different crRNAs expressed using the present system, e.g., the following: [0139] (X.sub.17-20)GUUUUAGAGCUA (SEQ ID NO:5); [0140] (X.sub.17-20)GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO:6); or [0141] (X.sub.17-20)GUUUUAGAGCUAUGCU (SEQ ID NO:7); and a tracrRNA sequence. In this case, the crRNA is used as the guide RNA in the methods and molecules described herein, and the tracrRNA can be expressed from the same or a different DNA molecule. In some embodiments, the methods include contacting the cell with a tracrRNA comprising or consisting of the sequence GGAACCAUUCAAAACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUA UCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:15) or an active portion thereof (an active portion is one that retains the ability to form complexes with Cas9 or dCas9). In some embodiments, the tracrRNA molecule may be truncated from its 3 end by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts. In another embodiment, the tracrRNA molecule may be truncated from its 5 end by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts. Alternatively, the tracrRNA molecule may be truncated from both the 5 and 3 end, e.g., by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or 20 nts on the 5 end and at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts on the 3 end. Exemplary tracrRNA sequences in addition to SEQ ID NO:8 include the following: UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCA CCGAGUCGGUGC (SEQ ID NO: 16) or an active portion thereof; or AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof.
[0142] In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO:6) is used as a crRNA, the following tracrRNA is used: GGAACCAUUCAAAACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUA UCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:15) or an active NO:5) is used as a crRNA, the following tracrRNA is used: UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCA CCGAGUCGGUGC (SEQ ID NO: 16) or an active portion thereof. In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUAUGCU (SEQ ID NO:7) is used as a crRNA, the following tracrRNA is used: AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof.
[0143] In a system that uses separate crRNA and tracrRNA, one or both can be synthetic and include one or more modified (e.g., locked) nucleotides.
[0144] In some embodiments, the single guide RNAs or crRNAs or tracrRNAs includes one or more Adenine (A) or Uracil (U) nucleotides on the 3 end.
[0145] The methods described can include contacting the cell with a locked gRNA as described herein, and contacting the cell with or expressing in the cell a nuclease that can be guided by the locked gRNAs, e.g., a Cas9 nuclease, e.g., as described in Mali et al., a Cas9 nickase as described in Jinek et al., 2012; or a dCas9-heterofunctional domain fusion (dCas9-HFD) as described in U.S. Provisional Patent Applications U.S. Ser. No. 61/799,647, Filed on Mar. 15, 2013, USSN 61/838,148, filed on Jun. 21, 2013, and PCT International Application No. PCT/US14/27335, all of which are incorporated herein by reference in its entirety.
Strategy 1B: DNA-Based Guide Molecules
[0146] Existing Cas9-based RGNs use gRNA-DNA heteroduplex formation to guide targeting to genomic sites of interest. However, RNA-DNA heteroduplexes can form a more promiscuous range of structures than their DNA-DNA counterparts. In effect, DNA-DNA duplexes are more sensitive to mismatches, suggesting that a DNA-guided nuclease may not bind as readily to off-target sequences, making them comparatively more specific than RNA-guided nucleases. To this end, we propose an engineered Cas9-based RGN wherein a short DNA oligonucleotide replaces all or part of the complementarity region of a gRNA (for example, see
[0158] In addition, in a system that uses separate crRNA and tracrRNA, one or both can be synthetic and include one or more deoxyribonucleotides, as dual gRNAs (e.g., the crRNA and tracrRNA found in naturally occurring systems) can also be hybrids. In this case, a single tracrRNA would be used in conjunction with multiple different crRNAs expressed using the present system, e.g., the following: [0159] (X.sub.17-20)GUUUUAGAGCUA (SEQ ID NO:5); [0160] (X.sub.17-20)GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO:6); or [0161] (X.sub.17-20)GUUUUAGAGCUAUGCU (SEQ ID NO:7); and a tracrRNA sequence. In this case, the crRNA is used as the guide RNA in the methods and molecules described herein, and the tracrRNA can be expressed from the same or a different DNA molecule. In some embodiments, the methods include contacting the cell with a tracrRNA comprising or consisting of the sequence GGAACCAUUCAAAACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUA UCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:15) or an active portion thereof (an active portion is one that retains the ability to form complexes with Cas9 or dCas9). In some embodiments, the tracrRNA molecule may be truncated from its 3 end by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts. In another embodiment, the tracrRNA molecule may be truncated from its 5 end by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts. Alternatively, the tracrRNA molecule may be truncated from both the 5 and 3 end, e.g., by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 or 20 nts on the 5 end and at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35 or 40 nts on the 3 end. Exemplary tracrRNA sequences in addition to SEQ ID NO:8 include the following: UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCA CCGAGUCGGUGC (SEQ ID NO: 16) or an active portion thereof; or AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof.
[0162] In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO:6) is used as a crRNA, the following tracrRNA is used: GGAACCAUUCAAAACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUA UCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO: 15) or an active portion thereof. In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUA (SEQ ID NO:5) is used as a crRNA, the following tracrRNA is used: UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCA CCGAGUCGGUGC (SEQ ID NO: 16) or an active portion thereof. In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUAUGCU (SEQ ID NO:7) is used as a crRNA, the following tracrRNA is used: AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof.
[0163] In a system that uses separate crRNA and tracrRNA, one or both can be synthetic and include one or more deoxyribonucleotides.
[0164] In some embodiments, the guide RNA includes one or more Adenine (A) or Uracil (U) nucleotides on the 3 end. In some embodiments the RNA includes one or more U, e.g., 1 to 8 or more Us (e.g., U, UU, UUU, UUUU, UUUUU, UUUUUU, UUUUUUU, UUUUUUUU) at the 3 end of the molecule, as a result of the optional presence of one or more Ts used as a termination signal to terminate RNA PolIII transcription.
Strategy #2: Use of Pairs of Cas9 RNA-Guided Nickases (RGNickases) to Induce Paired Nicks on Opposing Strands of DNA
[0165] Mutations have been described that inactivate one of the two endonuclease activities found in the S. pyogenes Cas9 nuclease (Jinek et al., Science 2012: Nishimasu al., Cell 156, 935-949 (2014)). Introduction of one of these mutations converts an RGN into an RGNickase that cuts only one of the two DNA strands in a predictable fashion (Jinek et al., Science 2012). Thus by using pairs of appropriately placed RGNickases (two gRNAs and one Cas9 nickase), one can introduce targeted paired nicks on opposing strands of DNA (
[0166] In some embodiments, the present system utilizes the Cas9 protein from S. pyogenes, either as encoded in bacteria or codon-optimized for expression in mammalian cells, containing mutations the nuclease portion of the protein partially catalytically inactive. The wild type sequence of the S. pyogenes Cas9 that can be used in the methods and compositions described herein is set forth below.
[0167] Thus described herein are methods that include expressing in a cell, or contacting a cell with, two guide RNAs and one Cas9-nickase (e.g., a Cas9 with a mutation at any of D10, E762, H983, D986, H840, or N863, that renders only one of the nuclease portions of the protein catalytically inactive: substitutions at these positions could be alanine (as they are in Nishimasu al., Cell 156, 935-949 (2014)) or they could be other residues, e.g., glutamine, asparagine, tyrosine, serine, or aspartate, e.gE762Q, H983N/H983Y, D986N, N863D/N863S/N863H D10A/DION, H840A/H840N/H840Y), wherein each of the two guide RNAs include sequences that are complementary to either strand of the target sequence, such that using both guide RNAs results in targeting both strands, and the Cas9-nickase cuts each strand singly on opposing strands of DNA. The RGNickase, like RGNs consisting of wildtype Cas9 is expected to cut the DNA target site approximately 3 bp upstream of the PAM, with the D10A Cas9 cleaving the complementary DNA strand and the H840A Cas9 cleaving the non-complementary strand. The two gRNA target sites may be overlapping or some distance away from each other, e.g., up to about 200 nts apart, e.g., less than 100, 50, 25, 10, 5, 4, or 2 nts apart.
Strategy #3: RNA-Binding Protein-FokI/HFD Fusions
[0168] Another method to improve the specificity of Cas9 is to use dCas9 together with a modified gRNA bearing extra RNA sequence on either the 5 or 3 end of the gRNA (or on the ends of the crRNA and/or tracrRNA if using a dual gRNA system) that is bound by an RNA-binding protein that is in turn fused to a heterologous functional domain (HFD), e.g., the FokI nuclease domain. In this configuration (
[0169] RNA-binding protein/RNA target sequences that could be used would include but are not limited to the lambda N, MS2 or Csy4 proteins. The wild type and high-affinity sequences for MS2 are AAACAUGAGGAUUACCCAUGUCG (SEQ ID NO:19) and AAACAUGAGGAUCACCCAUGUCG (SEQ ID NO:20), respectively (see Keryer-Bibens et al., supra,
[0170] Thus described herein are three-part fusion guide nucleic acids comprising: (1) a first sequence of 17-20 nts that is complementary to the complementary strand of 17-20 consecutive nucleotides of a target sequence with an adjacent PAM sequence: (2) a second sequence comprising all or part of a Cas9 guide RNA, e.g., all or part of GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCA ACUUGAAAAAGUGGCACCGAGTCGGUGCUUUU (SEQ ID NO: 15) or an active portion thereof, UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCA CCGAGUCGGUGC (SEQ ID NO: 16) or an active portion thereof; or AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof: and (3) a third sequence that forms a stem-loop structure recognized by an RNA binding protein, e.g., MS2, Csy4, or lambda N. These sequences can be arranged in any order so long as all of the parts retain their function, e.g., (1)-(2)-(3), or (3)-(1)-(2), or (3)-(2)-(1), or (1)-(3)-(2), or (2)-(1)-(3), or (2)-(3)-(1).
[0171] In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO:6) is used as a crRNA, the following tracrRNA is used: GGAACCAUUCAAAACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUA UCAACUUGAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO:15) or an active portion thereof. In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUA (SEQ ID NO:5) is used as a crRNA, the following tracrRNA is used: UAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCA CCGAGUCGGUGC (SEQ ID NO: 16) or an active portion thereof. In some embodiments wherein (X.sub.17-20)GUUUUAGAGCUAUGCU (SEQ ID NO:7) is used as a crRNA, the following tracrRNA is used: AGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGC (SEQ ID NO:17) or an active portion thereof.
[0172] In some embodiments, there are additional nucleotides, e.g., up to 20 additional nucleotides, that act as a flexible linker between Csy4 and the gRNA: these nucleotides should not add any secondary or tertiary structure to the gRNA. For example the sequence GTTC has been shown to be unstructured and could be construed as linker sequence.
[0173] In some embodiments, the wild-type Csy4 binding sequence is used, which is: GUUCACUGCCGUAUAGGCAGCUAAGAAA (SEQ ID NO:24). In some embodiments, a truncated Csy4 binding sequence is used, which upon processing by Csy4 produces gRNAs of higher activity. This sequence is
TABLE-US-00003 (SEQIDNO:23) GUUCACUGCCGUAUAGGCAG.
[0174] Also provided are fusion proteins comprising an RNA binding protein, e.g., MS2, Csy4, or lambda N, linked to a catalytic domain of a HFD, e.g., a FokI nuclease as described above, optionally with an intervening linker of 2-30, e.g., 5-20 nts, as well as nucleic acids encoding the same.
MS2/Lambda N/Csy4
[0175] Exemplary sequences for the MS2, lambda N, and Csy4 proteins are given below; the MS2 functions as a dimer, therefore the MS2 protein can include a fused single chain dimer sequence.
1. Exemplary Sequences for Fusions of Single MS2 Coat Protein (Wt, N55K or deltaFG) to the N-Terminus or C-Terminus of FokI.
TABLE-US-00004 MS2coatproteinaminoacidsequence: (SEQIDNO:25) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTC SVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIP IFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY MS2N55K: (SEQIDNO:26) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTC SVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIP IFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY MS2deltaFG: (SEQIDNO:27) MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTC SVRQSSAQNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVK AMQGLLKDGNPIPSAIAANSGIY
2. Exemplary Sequences for Fusions of Fused Dimeric MS2 Coat Protein (Wt, N55K or deltaFG) to the N-Terminus or C-Terminus of FokI.
TABLE-US-00005 DimericMS2coatprotein: (SEQIDNO:28) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTC SVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIP IFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGLYGAMASNFTQFV LVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQN RKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCE LIVKAMQGLLKDGNPIPSAIAANSLIN DimericMS2N55K: (SEQIDNO:29) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTC SVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIP IFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGLYGAMASNFTQFV LVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQK RKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCE LIVKAMQGLLKDGNPIPSAIAANSLIN DimericMS2deltaFG: (SEQIDNO:30) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTC SVRQSSAQKRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVK AMQGLLKDGNPIPSAIAANSGLYGAMASNFTQFVLVDNGGTGDVTVA PSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKGA WRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSLI N
3. Exemplary Sequences for Fusions of Lambda N to N-Terminus or C-Terminus of FokI.
[0176]
TABLE-US-00006 LambdaNaminoacidsequence: (SEQIDNO:31) MDAQTRRRERRAEKQAQWKAAN or (SEQIDNO:32) MDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSR VESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCS GRQKIKGKSIPLI
4. Exemplary Sequence for Fusions of Csy4 to N-Terminus or C-Terminus of Dcas9
[0177] Exemplary sequences for Cys4 are given in Haurwitz et al. 329(5997); 1355-8 (2010), e.g., the inactivated form; for example see the Csy4 homologues from Pseudomonas aeruginosa UCBPP-PA14 (Pal4), Yersinia pestis AAM85295 (Yp), Escherichia coli UT189 (Ec89), Dichelobacter nodosus VCS1703A (Dn), Acinetobacter baumannii AB0057 (Ab), Moritella sp. PE36 (MP1, MP01), Shewanella sp. W3-18-1 (SW), Pasteurella multocida subsp. multocida Pm70 (Pm), Pectobacterium wasabiae (Pw), and Dickeya dadantii Ech703 (Dd) that are set forth in FIG. S6 of Haurwitz et al., Science 329(5997); 1355-1358 (2010). In preferred embodiments, the Csy4 is from Pseudomonas aeruginosa.
[0178] Methods of using the fusions include contacting a cell with or expressing in a cell a pair of three-part fusion guide nucleic acids that include sequences complementary to a single region of a target DNA, a RNA-binding protein linked to a catalytic domain of a FokI nuclease, and a Cas9 protein (e.g., the inactive dCas9 protein from S. pyogenes, either as encoded in bacteria or codon-optimized for expression in mammalian cells, containing mutations at D10, E762, H983, D986, H840, or N863, e.g., D10A/D1ON and H840A/H840N/H840Y, to render the nuclease portion of the protein catalytically inactive; substitutions at these positions could be alanine (as they are in Nishimasu al., Cell 156, 935-949 (2014)) or they could be other residues, e.g., glutamine, asparagine, tyrosine, serine, or aspartate, e.g., E762Q, H983N, H983Y, D986N, N863D, N863S, or N863H (
FokI
[0179] FokI is a type IIs restriction endonuclease that includes a DNA recognition domain and a catalytic (endonuclease) domain. The fusion proteins described herein can include all of FokI or just the catalytic endonuclease domain, i.e., amino acids 388-583 or 408-583 of GenBank Acc. No. AAA24927.1, e.g., as described in Li et al., Nucleic Acids Res. 39(1); 359-372 (2011); Cathomen and Joung, Mol. Ther. 16: 1200-1207 (2008), or a mutated form of FokI as described in Miller et al. Nat Biotechnol 25: 778-785 (2007); Szczepek et al., Nat Biotechnol 25: 786-793 (2007); or Bitinaite et al., Proc. Natl. Acad. Sci. USA. 95:10570-10575 (1998).
[0180] An exemplary amino acid sequence of FokI is as follows:
TABLE-US-00007 (SEQIDNO:33) 10203040 MFLSMVSKIRTFGWVQNPGKFENLKRVVQVFDRNSKVHNE 50607080 VKNIKIPTLVKESKIQKELVAIMNQHDLIYTYKELVGTGT 90100110120 SIRSEAPCDAIIQATIADQGNKKGYIDNWSSDGFLRWAHA 130140150160 LGFIEYINKSDSFVITDVGLAYSKSADGSAIEKEILIEAI 170180190200 SSYPPAIRILTLLEDGQHLTKFDLGKNLGFSGESGFTSLP 210220230240 EGILLDTLANAMPKDKGEIRNNWEGSSDKYARMIGGWLDK 250260270280 LGLVKQGKKEFIIPTLGKPDNKEFISHAFKITGEGLKVLR 290300310320 RAKGSTKFTRVPKRVYWEMLATNLTDKEYVRTRRALILEI 330340350360 LIKAGSLKIEQIQDNLKKLGFDEVIETIENDIKGLINTGI 370380390400 FIEIKGRFYQLKDHILQFVIPNRGVTKQLVKSELEEKKSE 410420430440 LRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVY 450460470480 GYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYN 490500510520 LPIGQADEMQRYVEENQTRNKHINPNEWWKVYPSSVTEFK 530540550560 FLFVSGHFKGNYKAQLTRLNHITNCNGAVLSVEELLIGGE 570580 MIKAGTLTLEEVRRKFNNGEINF
[0181] An exemplary nucleic acid sequence encoding FokI is as follows:
TABLE-US-00008 (SEQIDNO:34) ATGTTTTTGAGTATGGTTTCTAAAATAAGAACTTTCGGTTGGGTTCAA AATCCAGGTAAATTTGAGAATTTAAAACGAGTAGTTCAAGTATTTGAT AGAAATTCTAAAGTACATAATGAAGTGAAAAATATAAAGATACCAACC CTAGTCAAAGAAAGTAAGATCCAAAAAGAACTAGTTGCTATTATGAAT CAACATGATTTGATTTATACATATAAAGAGTTAGTAGGAACAGGAACT TCAATACGTTCAGAAGCACCATGCGATGCAATTATTCAAGCAACAATA GCAGATCAAGGAAATAAAAAAGGCTATATCGATAATTGGTCATCTGAC GGTTTTTTGCGTTGGGCACATGCTTTAGGATTTATTGAATATATAAAT AAAAGTGATTCTTTTGTAATAACTGATGTTGGACTTGCTTACTCTAAA TCAGCTGACGGCAGCGCCATTGAAAAAGAGATTTTGATTGAAGCGATA TCATCTTATCCTCCAGCGATTCGTATTTTAACTTTGCTAGAAGATGGA CAACATTTGACAAAGTTTGATCTTGGCAAGAATTTAGGTTTTAGTGGA GAAAGTGGATTTACTTCTCTACCGGAAGGAATTCTTTTAGATACTCTA GCTAATGCTATGCCTAAAGATAAAGGCGAAATTCGTAATAATTGGGAA GGATCTTCAGATAAGTACGCAAGAATGATAGGTGGTTGGCTGGATAAA CTAGGATTAGTAAAGCAAGGAAAAAAAGAATTTATCATTCCTACTTTG GGTAAGCCGGACAATAAAGAGTTTATATCCCACGCTTTTAAAATTACT GGAGAAGGTTTGAAAGTACTGCGTCGAGCAAAAGGCTCTACAAAATTT ACACGTGTACCTAAAAGAGTATATTGGGAAATGCTTGCTACAAACCTA ACCGATAAAGAGTATGTAAGAACAAGAAGAGCTTTGATTTTAGAAATA TTAATCAAAGCTGGATCATTAAAAATAGAACAAATACAAGACAACTTG AAGAAATTAGGATTTGATGAAGTTATAGAAACTATTGAAAATGATATC AAAGGCTTAATTAACACAGGTATATTTATAGAAATCAAAGGGCGATTT TATCAATTGAAAGACCATATTCTTCAATTTGTAATACCTAATCGTGGT GTGACTAAGCAACTAGTCAAAAGTGAACTGGAGGAGAAGAAATCTGAA CTTCGTCATAAATTGAAATATGTGCCTCATGAATATATTGAATTAATT GAAATTGCCAGAAATTCCACTCAGGATAGAATTCTTGAAATGAAGGTA ATGGAATTTTTTATGAAAGTTTATGGATATAGAGGTAAACATTTGGGT GGATCAAGGAAACCGGACGGAGCAATTTATACTGTCGGATCTCCTATT GATTACGGTGTGATCGTGGATACTAAAGCTTATAGCGGAGGTTATAAT CTGCCAATTGGCCAAGCAGATGAAATGCAACGATATGTCGAAGAAAAT CAAACACGAAACAAACATATCAACCCTAATGAATGGTGGAAAGTCTAT CCATCTTCTGTAACGGAATTTAAGTTTTTATTTGTGAGTGGTCACTTT AAAGGAAACTACAAAGCTCAGCTTACACGATTAAATCATATCACTAAT TGTAATGGAGCTGTTCTTAGTGTAGAAGAGCTTTTAATTGGTGGAGAA ATGATTAAAGCCGGCACATTAACCTTAGAGGAAGTGAGACGGAAATTT AATAACGGCGAGATAAACTTTTAA
[0182] In some embodiments, the FokI nuclease used herein is at least about 50% identical SEQ ID NO:33, e.g., to amino acids 388-583 or 408-583 of SEQ ID NO:33. These variant nucleases must retain the ability to cleave DNA. In some embodiments, the nucleotide sequences are about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identical to amino acids 388-583 or 408-583 of SEQ ID NO:4. In some embodiments, any differences from amino acids 388-583 or 408-583 of SEQ ID NO:4 are in non-conserved regions.
[0183] To determine the percent identity of two sequences, the sequences are aligned for optimal comparison purposes (gaps are introduced in one or both of a first and a second amino acid or nucleic acid sequence as required for optimal alignment, and non-homologous sequences can be disregarded for comparison purposes). The length of a reference sequence aligned for comparison purposes is at least 50% (in some embodiments, about 50%, 55%, 60%, 65%, 70%, 75%, 85%, 90%, 95%, or 100% of the length of the reference sequence is aligned). The nucleotides or residues at corresponding positions are then compared. When a position in the first sequence is occupied by the same nucleotide or residue as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
[0184] The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For purposes of the present application, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package, using a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
Heterologous Functional Domains
[0185] The transcriptional activation domains can be fused on the N or C terminus of the Cas9. In addition, although the present description exemplifies transcriptional activation domains, other heterologous functional domains (e.g., transcriptional repressors (e.g., KRAB, ERD, SID, and others, e.g., amino acids 473-530 of the ets 2 repressor factor (ERF) repressor domain (ERD), amino acids 1-97 of the KRAB domain of KOX1, or amino acids 1-36 of the Mad mSIN3 interaction domain (SID); see Beerli et al., PNAS USA 95:14628-14633 (1998)) or silencers such as Heterochromatin Protein 1 (HP1, also known as swi6), e.g., HPla or HPIB: proteins or peptides that could recruit long non-coding RNAs (lncRNAs) fused to a fixed RNA binding sequence such as those bound by the MS2 coat protein, endoribonuclease Csy4, or the lambda N protein: enzymes that modify the methylation state of DNA (e.g., DNA methyltransferase (DNMT) or TET proteins); or enzymes that modify histone subunits (e.g., histone acetyltransferases (HAT), histone deacetylases (HDAC), histone methyltransferases (e.g., for methylation of lysine or arginine residues) or histone demethylases (e.g., for demethylation of lysine or arginine residues)) as are known in the art can also be used. A number of sequences for such domains are known in the art, e.g., a domain that catalyzes hydroxylation of methylated cytosines in DNA. Exemplary proteins include the Ten-Eleven-Translocation (TET)1-3 family, enzymes that converts 5-methylcytosine (5-mC) to 5-hydroxymethylcytosine (5-hmC) in DNA.
[0186] Sequences for human TET1-3 are known in the art and are shown in the following table:
TABLE-US-00009 GenBank Accession Nos. Gene Amino Acid Nucleic Acid TET1 NP_085128.2 NM_030625.2 TET2* NP_001120680.1 (var 1) NM_001127208.2 NP_060098.3 (var 2) NM_017628.4 TET3 NP_659430.1 NM_144993.1 *Variant (1) represents the longer transcript and encodes the longer isoform (a). Variant (2) differs in the 5 UTR and in the 3 UTR and coding sequence compared to variant 1. The resulting isoform (b) is shorter and has a distinct C-terminus compared to isoform a.
[0187] In some embodiments, all or part of the full-length sequence of the catalytic domain can be included, e.g., a catalytic module comprising the cysteine-rich extension and the 20GFeDO domain encoded by 7 highly conserved exons, e.g., the Tet1 catalytic domain comprising amino acids 1580-2052, Tet2 comprising amino acids 1290-1905 and Tet3 comprising amino acids 966-1678. See, e.g.,
[0188] Other catalytic modules can be from the proteins identified in Iyer et al., 2009.
[0189] In some embodiments, the heterologous functional domain is a biological tether, and comprises all or part of (e.g., DNA binding domain from) the MS2 coat protein, endoribonuclease Csy4, or the lambda N protein. These proteins can be used to recruit RNA molecules containing a specific stem-loop structure to a locale specified by the dCas9 gRNA targeting sequences. For example, a dCas9 fused to MS2 coat protein, endoribonuclease Csy4, or lambda N can be used to recruit a long non-coding RNA (lncRNA) such as XIST or HOTAIR: see, e.g., Keryer-Bibens et al., Biol. Cell 100:125-138 (2008), that is linked to the Csy4, MS2 or lambda N binding sequence. Alternatively, the Csy4, MS2 or lambda N protein binding sequence can be linked to another protein, e.g., as described in Keryer-Bibens et al., supra, and the protein can be targeted to the dCas9 binding site using the methods and compositions described herein. In some embodiments, the Csy4 is catalytically inactive.
[0190] In some embodiments, the fusion proteins include a linker between the dCas9 and the heterologous functional domains. Linkers that can be used in these fusion proteins (or between fusion proteins in a concatenated structure) can include any sequence that does not interfere with the function of the fusion proteins. In preferred embodiments, the linkers are short, e.g., 2-20 amino acids, and are typically flexible (i.e., comprising amino acids with a high degree of freedom such as glycine, alanine, and serine). In some embodiments, the linker comprises one or more units consisting of GGGS (SEQ ID NO:14) or GGGGS (SEQ ID NO:15), e.g., two, three, four, or more repeats of the GGGS (SEQ ID NO:14) or GGGGS (SEQ ID NO:15) unit. Other linker sequences can also be used.
Cas9
[0191] Cas9 molecules of a variety of species can be used in the methods and compositions described herein. While the S. pyogenes and S. thermophilus Cas9 molecules are the subject of much of the disclosure herein, Cas9 molecules of, derived from, or based on the Cas9 proteins of other species listed herein can be used as well. In other words, while the much of the description herein uses S. pyogenes and S. thermophilus Cas9 molecules, Cas9 molecules from the other species can replace them. Such species include those set forth in the following table, which was created based on supplementary
TABLE-US-00010 Alternative Cas9 proteins GenBank Acc No. Bacterium 303229466 Veillonella atypica ACS-134-V-Col7a 34762592 Fusobacterium nucleatum subsp. vincentii 374307738 Filifactor alocis ATCC 35896 320528778 Solobacterium moorei F0204 291520705 Coprococcus catus GD-7 42525843 Treponema denticola ATCC 35405 304438954 Peptoniphilus duerdenii ATCC BAA-1640 224543312 Catenibacterium mitsuokai DSM 15897 24379809 Streptococcus mutans UA159 15675041 Streptococcus pyogenes SF370 16801805 Listeria innocua Clip11262 116628213 Streptococcus thermophilus LMD-9 323463801 Staphylococcus pseudintermedius ED99 352684361 Acidaminococcus intestini RyC-MR95 302336020 Olsenella uli DSM 7084 366983953 Oenococcus kitaharae DSM 17330 310286728 Bifidobacterium bifidum S17 258509199 Lactobacillus rhamnosus GG 300361537 Lactobacillus gasseri JV-V03 169823755 Finegoldia magna ATCC 29328 47458868 Mycoplasma mobile 163K 284931710 Mycoplasma gallisepticum str. F 363542550 Mycoplasma ovipneumoniae SC01 384393286 Mycoplasma canis PG 14 71894592 Mycoplasma synoviae 53 238924075 Eubacterium rectale ATCC 33656 116627542 Streptococcus thermophilus LMD-9 315149830 Enterococcus faecalis TX0012 315659848 Staphylococcus lugdunensis M23590 160915782 Eubacterium dolichum DSM 3991 336393381 Lactobacillus coryniformis subsp. torquens 310780384 Ilyobacter polytropus DSM 2926 325677756 Ruminococcus albus 8 187736489 Akkermansia muciniphila ATCC BAA-835 117929158 Acidothermus cellulolyticus 11B 189440764 Bifidobacterium longum DJO10A 283456135 Bifidobacterium dentium Bd1 38232678 Corynebacterium diphtheriae NCTC 13129 187250660 Elusimicrobium minutum Pei191 319957206 Nitratifractor salsuginis DSM 16511 325972003 Sphaerochaeta globus str. Buddy 261414553 Fibrobacter succinogenes subsp. succinogenes 60683389 Bacteroides fragilis NCTC 9343 256819408 Capnocytophaga ochracea DSM 7271 90425961 Rhodopseudomonas palustris BisB18 373501184 Prevotella micans F0438 294674019 Prevotella ruminicola 23 365959402 Flavobacterium columnare ATCC 49512 312879015 Aminomonas paucivorans DSM 12260 83591793 Rhodospirillum rubrum ATCC 11170 294086111 Candidatus Puniceispirillum marinum IMCC1322 121608211 Verminephrobacter eiseniae EF01-2 344171927 Ralstonia syzygii R24 159042956 Dinoroseobacter shibae DFL 12 288957741 Azospirillum sp-B510 92109262 Nitrobacter hamburgensis X14 148255343 Bradyrhizobium sp-BTAi1 34557790 Wolinella succinogenes DSM 1740 218563121 Campylobacter jejuni subsp. jejuni 291276265 Helicobacter mustelae 12198 229113166 Bacillus cereus Rock1-15 222109285 Acidovorax ebreus TPSY 189485225 uncultured Termite group 1 182624245 Clostridium perfringens D str. 220930482 Clostridium cellulolyticum H10 154250555 Parvibaculum lavamentivorans DS-1 257413184 Roseburia intestinalis L1-82 218767588 Neisseria meningitidis Z2491 15602992 Pasteurella multocida subsp. multocida 319941583 Sutterella wadsworthensis 3 1 254447899 gamma proteobacterium HTCC5015 54296138 Legionella pneumophila str. Paris 331001027 Parasutterella excrementihominis YIT 11859 34557932 Wolinella succinogenes DSM 1740 118497352 Francisella novicida U112
The constructs and methods described herein can include the use of any of those Cas9 proteins, and their corresponding guide RNAs or other guide RNAs that are compatible. The Cas9 from Streptococcus thermophilus LMD-9 CRISPR1 system has also been shown to function in human cells in Cong et al (Science 339, 819 (2013)). Cas9 orthologs from N. meningitides are described in Hou et al., Proc Natl Acad Sci USA. 2013 Sep. 24; 110(39);15644-9 and Esvelt et al., Nat Methods. 2013 Nov;10(11);1116-21. Additionally, Jinek et al. showed in vitro that Cas9 orthologs from S. thermophilus and L. innocua, (but not from N. meningitidis or C. jejuni, which likely use a different guide RNA), can be guided by a dual S. pyogenes gRNA to cleave target plasmid DNA, albeit with slightly decreased efficiency.
[0192] In some embodiments, the present system utilizes the Cas9 protein from S. pyogenes, either as encoded in bacteria or codon-optimized for expression in mammalian cells. In some embodiments, a catalytically inactive Cas9 (dCas9) containing mutations at (i) D10, E762, H983, or D986 and (i) H840 or N863, e.g., D10A/D10N and H840A/H840N/H840Y, to render the nuclease portion of the protein completely catalytically inactive; substitutions at these positions could be alanine (as they are in Nishimasu al., Cell 156, 935-949 (2014)) or they could be other residues, e.g., glutamine, asparagine, tyrosine, serine, or aspartate, e.g., E762Q, H983N, H983Y, D986N, N863D, N863S, or N863H (
TABLE-US-00011 (SEQIDNO:18) 10203040 MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDR 50607080 HSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRIC 90100110120 YLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFG 130140150160 NIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAH 170180190200 MIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENP 210220230240 INASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGN 250260270280 LIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLA 290300310320 QIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSAS 330340350360 MIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYA 370380390400 GYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR 410420430440 KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKI 450460470480 EKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEE 490500510520 VVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTV 530540550560 YNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVT 570580590600 VKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI 610620630640 IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYA 650660670680 HLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTIL 690700710720 DFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSL 730740750760 HEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIV 770780790800 IEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP 810820830840 VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDH 850860870880 IVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMK 890900910920 NYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQ 930940950960 LVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKS 9709809901000 KLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK 1010102010301040 YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYS 1050106010701080 NIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF 1090110011101120 ATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLI 1130114011501160 ARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSV 1170118011901200 KELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK 1210122012301240 YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLAS 1250126012701280 HYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRV 1290130013101320 ILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGA 1330134013501360 PAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRI DLSQLGGD
[0193] In some embodiments, the Cas9 nuclease used herein is at least about 50% identical to the sequence of S. pyogenes Cas9, i.e., at least 50% identical to SEQ ID NO:18. In some embodiments, the nucleotide sequences are about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identical to SEQ ID NO:18. In some embodiments, any differences from SEQ ID NO: 18 are in non-conserved regions, as identified by sequence alignment of sequences set forth in Chylinski et al., RNA Biology 10:5, 1-12; 2013 (e.g., in supplementary
[0194] To determine the percent identity of two sequences, the sequences are aligned for optimal comparison purposes (gaps are introduced in one or both of a first and a second amino acid or nucleic acid sequence as required for optimal alignment, and non-homologous sequences can be disregarded for comparison purposes). The length of a reference sequence aligned for comparison purposes is at least 50% (in some embodiments, about 50%, 55%, 60%, 65%, 70%, 75%, 85%, 90%, 95%, or 100% of the length of the reference sequence is aligned). The nucleotides or residues at corresponding positions are then compared. When a position in the first sequence is occupied by the same nucleotide or residue as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
[0195] The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For purposes of the present application, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package, using a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
Expression Systems
[0196] In order to use the fusion proteins and guide RNAs described, it may be desirable to express the engineered proteins from a nucleic acid that encodes them. This can be performed in a variety of ways. For example, the nucleic acid encoding the fusion protein or guide RNA can be cloned into an intermediate vector for transformation into prokaryotic or eukaryotic cells for replication and/or expression. Intermediate vectors are typically prokaryote vectors, e.g., plasmids, or shuttle vectors, or insect vectors, for storage or manipulation of the nucleic acid encoding the fusion protein or guide RNA for production of the fusion protein or guide RNA. The nucleic acid encoding the fusion protein or guide RNA can also be cloned into an expression vector, for administration to a plant cell, animal cell, preferably a mammalian cell or a human cell, fungal cell, bacterial cell, or protozoan cell.
[0197] To obtain expression, a sequence encoding a fusion protein or guide RNA is typically subcloned into an expression vector that contains a promoter to direct transcription. Suitable bacterial and eukaryotic promoters are well known in the art and described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual (3d ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 2010). Bacterial expression systems for expressing the engineered protein are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al., 1983, Gene 22:229-235). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
[0198] The promoter used to direct expression of a fusion protein nucleic acid depends on the particular application. For example, a strong constitutive promoter is typically used for expression and purification of fusion proteins. In contrast, when the fusion protein is to be administered in vivo for gene regulation, either a constitutive or an inducible promoter can be used, depending on the particular use of the fusion protein. In addition, a preferred promoter for administration of the fusion protein can be a weak promoter, such as HSV TK or a promoter having similar activity. The promoter can also include elements that are responsive to transactivation, e.g., hypoxia response elements, Gal4 response elements, lac repressor response element, and small molecule control systems such as tetracycline-regulated systems and the RU-486 system (see, e.g., Gossen & Bujard, 1992, Proc. Natl. Acad. Sci. USA, 89:5547: Oligino et al., 1998, Gene Ther., 5:491-496: Wang et al., 1997, Gene Ther., 4:432-441: Neering et al., 1996, Blood, 88: 1147-55; and Rendahl et al., 1998, Nat. Biotechnol., 16:757-761).
[0199] In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the expression of the nucleic acid in host cells, either prokaryotic or eukaryotic. A typical expression cassette thus contains a promoter operably linked, e.g., to the nucleic acid sequence encoding the fusion protein, and any signals required, e.g., for efficient polyadenylation of the transcript, transcriptional termination, ribosome binding sites, or translation termination. Additional elements of the cassette may include, e.g., enhancers, and heterologous spliced intronic signals.
[0200] The particular expression vector used to transport the genetic information into the cell is selected with regard to the intended use of the fusion protein, e.g., expression in plants, animals, bacteria, fungus, protozoa, etc. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and commercially available tag-fusion expression systems such as GST and LacZ. A preferred tag-fusion protein is the maltose binding protein (MBP). Such tag-fusion proteins can be used for purification of the engineered TALE repeat protein. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, for monitoring expression, and for monitoring cellular and subcellular localization, e.g., c-myc or FLAG
[0201] Expression vectors containing regulatory elements from eukaryotic viruses are often used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV40 early promoter, SV40 late promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
[0202] The vectors for expressing the guide RNAs can include RNA Pol III promoters to drive expression of the guide RNAs, e.g., the H1, U6 or 7SK promoters. These human promoters allow for expression of gRNAs in mammalian cells following plasmid transfection. Alternatively, a T7 promoter may be used, e.g., for in vitro transcription, and the RNA can be transcribed in vitro and purified. Vectors suitable for the expression of short RNAs, e.g., siRNAs, shRNAs, or other small RNAs, can be used.
[0203] Some expression systems have markers for selection of stably transfected cell lines such as thymidine kinase, hygromycin B phosphotransferase, and dihydrofolate reductase. High yield expression systems are also suitable, such as using a baculovirus vector in insect cells, with the fusion protein encoding sequence under the direction of the polyhedrin promoter or other strong baculovirus promoters.
[0204] The elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of recombinant sequences.
[0205] Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of protein, which are then purified using standard techniques (see, e.g., Colley et al., 1989, J. Biol. Chem., 264:17619-22: Guide to Protein Purification, in Methods in Enzymology, vol. 182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, 1977, J. Bacteriol. 132:349-351: Clark-Curtiss & Curtiss, Methods in Enzymology 101:347-362 (Wu et al., eds, 1983).
[0206] Any of the known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, nucleofection, liposomes, microinjection, naked DNA, plasmid vectors, viral vectors, both episomal and integrative, and any of the other well-known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et al., supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing the protein of choice.
[0207] In some embodiments, the fusion protein includes a nuclear localization domain which provides for the protein to be translocated to the nucleus. Several nuclear localization sequences (NLS) are known, and any suitable NLS can be used. For example, many NLSs have a plurality of basic amino acids, referred to as a bipartite basic repeats (reviewed in Garcia-Bustos et al, 1991, Biochim. Biophys. Acta, 1071:83-101). An NLS containing bipartite basic repeats can be placed in any portion of chimeric protein and results in the chimeric protein being localized inside the nucleus. In preferred embodiments a nuclear localization domain is incorporated into the final fusion protein, as the ultimate functions of the fusion proteins described herein will typically require the proteins to be localized in the nucleus. However, it may not be necessary to add a separate nuclear localization domain in cases where the DBD domain itself, or another functional domain within the final chimeric protein, has intrinsic nuclear translocation function.
[0208] The present invention includes the vectors and cells comprising the vectors.
EXAMPLES
[0209] The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
Example 1. Assessing Specificity of RNA-Guided Endonucleases
[0210] CRISPR RNA-guided nucleases (RGNs) have rapidly emerged as a platform for genome editing. This example describes the use of a human cell-based reporter assay to characterize off-target cleavage of CasAS9-based RGNs.
Materials and Methods
[0211] The following materials and methods were used in Example 1.
Construction of Guide RNAs
[0212] DNA oligonucleotides harboring variable 20 nt sequences for Cas9 targeting were annealed to generate short double-strand DNA fragments with 4 bp overhangs compatible with ligation into BsmBI-digested plasmid pMLM3636. Cloning of these annealed oligonucleotides generates plasmids encoding a chimeric+103 single-chain guide RNA with 20 variable 5 nucleotides under expression of a U6 promoter (Hwang et al., Nat Biotechnol 31, 227-229 (2013); Mali et al., Science 339, 823-826 (2013).). pMLM3636 and the expression plasmid pJDS246 (encoding a codon optimized version of Cas9) used in this study are both available through the non-profit plasmid distribution service Addgene (addgene.org/crispr-cas).
EGFP Activity Assays
[0213] U2OS.EGFP cells harboring a single integrated copy of an EGFP-PEST fusion gene were cultured as previously described (Reyon et al., Nat Biotech 30, 460-465 (2012)). For transfections, 200,000 cells were Nucleofected with the indicated amounts of gRNA expression plasmid and pJDS246 together with 30 ng of a Td-tomato-encoding plasmid using the SE Cell Line 4D-Nucleofector? X Kit (Lonza) according to the manufacturer's protocol. Cells were analyzed 2 days post-transfection using a BD LSRII flow cytometer. Transfections for optimizing gRNA/Cas9 plasmid concentration were performed in triplicate and all other transfections were performed in duplicate.
PCR Amplification and Sequence Verification of Endogenous Human Genomic Sites
[0214] PCR reactions were performed using Phusion Hot Start II high-fidelity DNA polymerase (NEB) with PCR primers and conditions listed in Table B. Most loci amplified successfully using touchdown PCR (98? C., 10 s: 72-62? C., ?1? C./cycle, 15 s: 72? C., 30 s]10 cycles, [98? C., 10 s: 62? ? C., 15 s: 72? C., 30 s]25 cycles). PCR for the remaining targets were performed with 35 cycles at a constant annealing temperature of 68? C. or 72? ? C. and 3% DMSO or IM betaine, if necessary. PCR products were analyzed on a QIAXCEL capillary electrophoresis system to verify both size and purity. Validated products were treated with ExoSap-IT (Affymetrix) and sequenced by the Sanger method (MGH DNA Sequencing Core) to verify each target site.
Determination of RGN-Induced On- and Off-Target Mutation Frequencies in Human Cells
[0215] For U20S.EGFP and K562 cells, 2?10.sup.5 cells were transfected with 250 ng of gRNA expression plasmid or an empty U6 promoter plasmid (for negative controls), 750 ng of Cas9 expression plasmid, and 30 ng of td-Tomato expression plasmid using the 4D Nucleofector System according to the manufacturer's instructions (Lonza). For HEK293 cells, 1.65?10.sup.5 cells were transfected with 125 ng of gRNA expression plasmid or an empty U6 promoter plasmid (for the negative control), 375 ng of Cas9 expression plasmid, and 30 ng of a td-Tomato expression plasmid using Lipofectamine LTX reagent according to the manufacturer's instructions (Life Technologies). Genomic DNA was harvested from transfected U2OS.EGFP, HEK293, or K562 cells using the QIAamp DNA Blood Mini Kit (QIAGEN), according to the manufacturer's instructions. To generate enough genomic DNA to amplify the off-target candidate sites, DNA from three Nucleofections (for U2OS.EGFP cells), two Nucleofections (for K562 cells), or two Lipofectamine LTX transfections was pooled together before performing T7EI. This was done twice for each condition tested, thereby generating duplicate pools of genomic DNA representing a total of four or six individual transfections. PCR was then performed using these genomic DNAs as templates as described above and purified using Ampure XP beads (Agencourt) according to the manufacturer's instructions. T7EI assays were performed as previously described (Reyon et al., 2012, supra).
DNA Sequencing of NHEJ-Mediated Indel Mutations
[0216] Purified PCR products used for the T7EI assay were cloned into Zero Blunt TOPO vector (Life Technologies) and plasmid DNAs were isolated using an alkaline lysis miniprep method by the MGH DNA Automation Core. Plasmids were sequenced using an M13 forward primer (5-GTAAAACGACGGCCAG-3 (SEQ ID NO:35)) by the Sanger method (MGH DNA Sequencing Core).
Example 1a. Single Nucleotide Mismatches
[0217] To begin to define the specificity determinants of RGNs in human cells, a large-scale test was performed to assess the effects of systematically mismatching various positions within multiple gRNA/target DNA interfaces. To do this, a quantitative human cell-based enhanced green fluorescent protein (EGFP) disruption assay previously described (see Methods above and Reyon et al., 2012, supra) that enables rapid quantitation of targeted nuclease activities (
TABLE-US-00012 EGFPSite1 SEQIDNO:1 GGGCACGGGCAGCTTGCCGGTGG EGFPSite2 SEQIDNO:2 GATGCCGTTCTTCTGCTTGTCGG EGFPSite3 SEQIDNO:3 GGTGGTGCAGATGAACTTCAGGG
Each of these gRNAs can efficiently direct Cas9-mediated disruption of EGFP expression (see Example 1e and 2a, and
[0218] In initial experiments, the effects of single nucleotide mismatches at 19 of 20 nucleotides in the complementary targeting region of three EGFP-targeted gRNAs were tested. To do this, variant gRNAs were generated for each of the three target sites harboring Watson-Crick transversion mismatches at positions 1 through 19 (numbered 1 to 20 in the 3 to 5 direction: see
[0219] For EGFP target site #2, single mismatches in positions 1-10 of the gRNA have dramatic effects on associated Cas9 activity (
Example 1b. Multiple Mismatches
[0220] To test the effects of more than one mismatch at the gRNA/DNA interface, a series of variant gRNAs bearing double Watson-Crick transversion mismatches in adjacent and separated positions were created and the abilities of these gRNAs to direct Cas9 nuclease activity were tested in human cells using the EGFP disruption assay. All three target sites generally showed greater sensitivity to double alterations in which one or both mismatches occur within the 3 half of the gRNA targeting region. However, the magnitude of these effects exhibited site-specific variation, with target site #2 showing the greatest sensitivity to these double mismatches and target site #1 generally showing the least. To test the number of adjacent mismatches that can be tolerated, variant gRNAs were constructed bearing increasing numbers of mismatched positions ranging from positions 19 to 15 in the 5 end of the gRNA targeting region (where single and double mismatches appeared to be better tolerated).
[0221] Testing of these increasingly mismatched gRNAs revealed that for all three target sites, the introduction of three or more adjacent mismatches results in significant loss of RGN activity. A sudden drop off in activity occurred for three different EGFP-targeted gRNAs as one makes progressive mismatches starting from position 19 in the 5 end and adding more mismatches moving toward the 3 end. Specifically, gRNAs containing mismatches at positions 19 and 19+18 show essentially full activity whereas those with mismatches at positions 19+18+17, 19+18+17+16, and 19+18+17+16+15 show essentially no difference relative to a negative control (
[0222] Additional proof of that shortening gRNA complementarity might lead to RGNs with greater specificities was obtained in the following experiment: for four different EGFP-targeted gRNAs (
[0223] Taken together, these results in human cells confirm that the activities of RGNs can be more sensitive to mismatches in the 3 half of the gRNA targeting sequence. However, the data also clearly reveal that the specificity of RGNs is complex and target site-dependent, with single and double mismatches often well tolerated even when one or more mismatches occur in the 3 half of the gRNA targeting region. Furthermore, these data also suggest that not all mismatches in the 5 half of the gRNA/DNA interface are necessarily well tolerated.
[0224] In addition, these results strongly suggest that gRNAs bearing shorter regions of complementarity (specifically ?17 nts) will be more specific in their activities. We note that 17 nts of specificity combined with the 2 nts of specificity conferred by the PAM sequence results in specification of a 19 bp sequence, one of sufficient length to be unique in large complex genomes such as those found in human cells.
Example 1c. Off-Target Mutations
[0225] To determine whether off-target mutations for RGNs targeted to endogenous human genes could be identified, six gRNAs that target three different sites in the VEGFA gene, one in the EMX1 gene, one in the RNF2 gene, and one in the FANCF gene were used. These six gRNAs efficiently directed Cas9-mediated indels at their respective endogenous loci in human U2OS.EGFP cells as detected by T7 Endonuclease I (T7EI) assay. For each of these six RGNs, we then examined dozens of potential off-target sites (ranging in number from 46 to as many as 64) for evidence of nuclease-induced NHEJ-mediated indel mutations in U2OS.EGFP cells. The loci assessed included all genomic sites that differ by one or two nucleotides as well as subsets of genomic sites that differ by three to six nucleotides and with a bias toward those that had one or more of these mismatches in the 5 half of the gRNA targeting sequence. Using the T7EI assay, four off-target sites (out of 53 candidate sites examined) for VEGFA site 1, twelve (out of 46 examined) for VEGFA site 2, seven (out of 64 examined) for VEGFA site 3 and one (out of 46 examined) for the EMX1 site were readily identified. No off-target mutations were detected among the 43 and 50 potential sites examined for the RNF2 or FANCF genes, respectively. The rates of mutation at verified off-target sites were very high, ranging from 5.6% to 125% (mean of 40%) of the rate observed at the intended target site. These bona fide off-targets included sequences with mismatches in the 3 end of the target site and with as many as a total of five mismatches, with most off-target sites occurring within protein coding genes. DNA sequencing of a subset of off-target sites provided additional molecular confirmation that indel mutations occur at the expected RGN cleavage site.
Example 1d. Off-Target Mutations in Other Cell Types
[0226] Having established that RGNs can induce off-target mutations with high frequencies in U2OS.EGFP cells, we next sought to determine whether these nucleases would also have these effects in other types of human cells. We had chosen U2OS.EGFP cells for our initial experiments because we previously used these cells to evaluate the activities of TALENs15 but human HEK293 and K562 cells have been more widely used to test the activities of targeted nucleases. Therefore, we also assessed the activities of the four RGNs targeted to VEGFA sites 1, 2, and 3 and the EMX1 site in HEK293 and K562 cells. We found that each of these four RGNs efficiently induced NHEJ-mediated indel mutations at their intended on-target site in these two additional human cell lines (as assessed by T7EI assay), albeit with somewhat lower mutation frequencies than those observed in U2OS.EGFP cells. Assessment of the 24 off-target sites for these four RGNs originally identified in U2OS.EGFP cells revealed that many were again mutated in HEK293 and K562 cells with frequencies similar to those at their corresponding on-target site. DNA sequencing of a subset of these off-target sites from HEK293 cells provided additional molecular evidence that alterations are occurring at the expected genomic loci. We do not know for certain why in HEK293 cells four and in K562 cells eleven of the off-target sites identified in U2OS.EGFP cells did not show detectable mutations. However, we note that many of these off-target sites also showed relatively lower mutation frequencies in U2OS.EGFP cells. Therefore, we speculate that mutation rates of these sites in HEK293 and K562 cells may be falling below the reliable detection limit of our T7EI assay (?2-5%) because RGNs generally appear to have lower activities in HEK293 and K562 cells compared with U2OS.EGFP cells in our experiments. Taken together, our results in HEK293 and K562 cells provide evidence that the high-frequency off-target mutations we observe with RGNs will be a general phenomenon seen in multiple human cell types.
Example 1e. Titration of gRNA- and Cas9-Expressing Plasmid Amounts Used for the EGFP Disruption Assay
[0227] Single guide RNAs (gRNAs) were generated for three different sequences (EGFP SITES 1-3, shown above) located upstream of EGFP nucleotide 502, a position at which the introduction of frameshift mutations via non-homologous end-joining can robustly disrupt expression of EGFP (Maeder, M. L. et al., Mol Cell 31, 294-301 (2008); Reyon, D. et al., Nat Biotech 30, 460-465 (2012)).
[0228] For each of the three target sites, a range of gRNA-expressing plasmid amounts (12.5 to 250 ng) was initially transfected together with 750 ng of a plasmid expressing a codon-optimized version of the Cas9 nuclease into our U20S.EGFP reporter cells bearing a single copy, constitutively expressed EGFP-PEST reporter gene. All three RGNs efficiently disrupted EGFP expression at the highest concentration of gRNA plasmid (250 ng) (
[0229] The amount of Cas9-encoding plasmid (range from 50 ng to 750 ng) transfected into our U2OS.EGFP reporter cells was titrated EGFP disruption assayed. As shown in
[0230] The reasons why some gRNA/Cas9 combinations work better than others in disrupting EGFP expression is not understood, nor is why some of these combinations are more or less sensitive to the amount of plasmids used for transfection. Although it is possible that the range of off-target sites present in the genome for these three gRNAs might influence each of their activities, no differences were seen in the numbers of genomic sites that differ by one to six bps for each of these particular target sites that would account for the differential behavior of the three gRNAs.
Example 2: Using guideRNAs Containing Csy4 Binding Sites with Cas9
[0231] In this example, dCas9 is expressed together with a modified gRNA bearing extra RNA sequence on either or both of the 5 and/or 3 end of the gRNA that is bound by Csy4, an RNA-binding protein, as well as a fusion protein with Csy4 fused to the FokI nuclease domain. As shown in
[0232] Thus, Csy4 RNA binding sites were attached to the 3 and 5 ends of a gRNA sequence and expressed with Cas9 in cells. The Csy4 RNA binding site sequence GUUCACUGCCGUAUAGGCAGCUAAGAAA (SEQ ID NO:36) was fused to the 5 and 3 end of the standard gRNA sequence.
[0233] Multiplex gRNA encoding plasmids were constructed by ligating: 1) annealed oligos encoding the first target site, 2) phosphorylated annealed oligos encoding crRNA, tracrRNA, and Csy4-binding site, and 3) annealed oligos encoding the second targetsite, into a U6-Csy4site-gRNA plasmid backbone digested with BsmBI Type IIs restriction enzyme.
TABLE-US-00013 (SEQIDNO:37) GUUCACUGCCGUAUAGGCAGNNNNNNNNNNNNNNNNNNNNGUUUUAGAG CUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAA GUGGCACCGAGUCGGUGCGUUCACUGCCGUAUAGGCAGNNNNNNNNNNN NNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUC CGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCGUUCACUGCCGUA UAGGCAG
This sequence is a multiplex gRNA sequence flanked by Csy4 sites (underlined). When processed by Csy4FokI, Csy4FokI remains bound. Functionally, encoding these in multiplex on one transcript should have the same result as encoding them separately. Although all pairs of Csy4-flanked gRNAs were expressed in a multiplex context in the experiments described herein, the gRNAs can be encoded in multiplex gRNAs separated by Csy4 sites encoded on one transcript as well as individual gRNAs that have an additional Csy4 sequence. In this sequence, the first N20 sequence represents the sequence complementary to one strand of the target genomic sequence, and the second N20 sequence represents the sequence complementary to the other strand of the target genomic sequence.
[0234] A plasmid encoding the Csy4 recognition site containing gRNA was co-transfected with plasmid encoding Cas9 and Csy4 proteins separated by a 2A peptide linkage. The results showed that gRNAs with Csy4 sites fused to the 5 and 3 ends remained capable of directing Cas9-mediated cleavage in human cells using the U2OS-EGFP disruption assay previously described. Thus, Csy4 RNA binding sites can be attached to 3 end of a gRNA sequence and complexes of these Csy4 site-containing gRNAs with Cas9 remain functional in the cell (
[0235] Additional experiments were performed to demonstrate that co-expression of two gRNAs targeted to adjacent sites on a DNA sequence and harboring a Csy4 binding site on their 3 ends, dCas9 protein, and a Csy4-FokI fusion in human cells can lead to cleavage and subsequent mutagenesis of the DNA between the two gRNA binding sites.
[0236] The sequences of the Csy4-FokI fusion proteins were as follows:
TABLE-US-00014 Csy4-FokIN-terminalfusion(nucleotidesequence) (SEQIDNO:38) ATGGACCACTACCTCGACATTCGCTTGCGACCGGACCCGGAATTTCCCC CGGCGCAACTCATGAGCGTGCTCTTCGGCAAGCTCCACCAGGCCCTGGT GGCACAGGGCGGGGACAGGATCGGCGTGAGCTTCCCCGACCTCGACGAA AGCCGCTCCCGGCTGGGCGAGCGCCTGCGCATTCATGCCTCGGCGGACG ACCTTCGTGCCCTGCTCGCCCGGCCCTGGCTGGAAGGGTTGCGGGACCA TCTGCAATTCGGAGAACCGGCAGTCGTGCCTCACCCCACACCGTACCGT CAGGTCAGTCGGGTTCAGGCGAAAAGCAATCCGGAACGCCTGCGGCGGC GGCTCATGCGCCGGCACGATCTGAGTGAGGAGGAGGCTCGGAAACGCAT TCCCGATACGGTCGCGAGAGCCTTGGACCTGCCCTTCGTCACGCTACGC AGCCAGAGCACCGGACAGCACTTCCGTCTCTTCATCCGCCACGGGCCGT TGCAGGTGACGGCAGAGGAAGGAGGATTCACCTGTTACGGGTTGAGCAA AGGAGGTTTCGTTCCCTGGTTCGGTGGCGGTGGATCCCAACTAGTCAAA AGTGAACTGGAGGAGAAGAAATCTGAACTTCGTCATAAATTGAAATATG TGCCTCATGAATATATTGAATTAATTGAAATTGCCAGAAATTCCACTCA GGATAGAATTCTTGAAATGAAGGTAATGGAATTTTTTATGAAAGTTTAT GGATATAGAGGTAAACATTTGGGTGGATCAAGGAAACCGGACGGAGCAA TTTATACTGTCGGATCTCCTATTGATTACGGTGTGATCGTGGATACTAA AGCTTATAGCGGAGGTTATAATCTGCCAATTGGCCAAGCAGATGAAATG CAACGATATGTCGAAGAAAATCAAACACGAAACAAACATATCAACCCTA ATGAATGGTGGAAAGTCTATCCATCTTCTGTAACGGAATTTAAGTTTTT ATTTGTGAGTGGTCACTTTAAAGGAAACTACAAAGCTCAGCTTACACGA TTAAATCATATCACTAATTGTAATGGAGCTGTTCTTAGTGTAGAAGAGC TTTTAATTGGTGGAGAAATGATTAAAGCCGGCACATTAACCTTAGAGGA AGTCAGACGGAAATTTAATAACGGCGAGATAAACTTTTGA Csy4-FokIN-terminalfusion(aminoacidsequence, GGGGSlinkerunderlined) (SEQIDNO:39) MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDE SRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYR QVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLR SQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWFGGGGSQLVK SELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVY GYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEM QRYVEENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLTR LNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF* Csy4-FokIC-terminalfusion(nucleotidesequence) (SEQIDNO:40) ATGCAACTAGTCAAAAGTGAACTGGAGGAGAAGAAATCTGAACTTCGTC ATAAATTGAAATATGTGCCTCATGAATATATTGAATTAATTGAAATTGC CAGAAATTCCACTCAGGATAGAATTCTTGAAATGAAGGTAATGGAATTT TTTATGAAAGTTTATGGATATAGAGGTAAACATTTGGGTGGATCAAGGA AACCGGACGGAGCAATTTATACTGTCGGATCTCCTATTGATTACGGTGT GATCGTGGATACTAAAGCTTATAGCGGAGGTTATAATCTGCCAATTGGC CAAGCAGATGAAATGCAACGATATGTCGAAGAAAATCAAACACGAAACA AACATATCAACCCTAATGAATGGTGGAAAGTCTATCCATCTTCTGTAAC GGAATTTAAGTTTTTATTTGTGAGTGGTCACTTTAAAGGAAACTACAAA GCTCAGCTTACACGATTAAATCATATCACTAATTGTAATGGAGCTGTTC TTAGTGTAGAAGAGCTTTTAATTGGTGGAGAAATGATTAAAGCCGGCAC ATTAACCTTAGAGGAAGTCAGACGGAAATTTAATAACGGCGAGATAAAC TTTGGTGGCGGTGGATCCGACCACTACCTCGACATTCGCTTGCGACCGG ACCCGGAATTTCCCCCGGCGCAACTCATGAGCGTGCTCTTCGGCAAGCT CCACCAGGCCCTGGTGGCACAGGGCGGGGACAGGATCGGCGTGAGCTTC CCCGACCTCGACGAAAGCCGCTCCCGGCTGGGCGAGCGCCTGCGCATTC ATGCCTCGGCGGACGACCTTCGTGCCCTGCTCGCCCGGCCCTGGCTGGA AGGGTTGCGGGACCATCTGCAATTCGGAGAACCGGCAGTCGTGCCTCAC CCCACACCGTACCGTCAGGTCAGTCGGGTTCAGGCGAAAAGCAATCCGG AACGCCTGCGGCGGCGGCTCATGCGCCGGCACGATCTGAGTGAGGAGGA GGCTCGGAAACGCATTCCCGATACGGTCGCGAGAGCCTTGGACCTGCCC TTCGTCACGCTACGCAGCCAGAGCACCGGACAGCACTTCCGTCTCTTCA TCCGCCACGGGCCGTTGCAGGTGACGGCAGAGGAAGGAGGATTCACCTG TTACGGGTTGAGCAAAGGAGGTTTCGTTCCCTGGTTCTGA Csy4-FokIC-terminalfusion(aminoacidsequence, GGGGSlinkerunderlined) (SEQIDNO:41) MQLVKSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEF FMKVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIG QADEMQRYVEENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYK AQLTRLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEIN FGGGGSDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSF PDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPH PTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLP FVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF*
[0237] Because the orientation and geometry of the gRNA/dCas9/Csy4-FokI complexes required to induce a targeted DSB is not known, we performed a series of experiments designed to ascertain these parameters. For these experiments, we utilized a human cell-based EGFP disruption assay in which introduction of a targeted DSB into the coding sequence of a single integrated EGFP gene leads to the introduction of indel mutations and disruption of functional EGFP expression. Thus, the percentage of EGFP-negative cells, which can be quantified by flow cytometry, serves as a surrogate measure of targeted nuclease activity. To optimize parameters, we identified a large series of paired gRNA target sites that varied in the spacer length between the two sites (edge-to-edge distance between the N20NGG target sites). In addition, the orientation of the gRNA target sites were such that they either had their PAM sequences oriented outward from the spacer sequence in between or inward towards the spacer sequence in between. We expressed pairs of gRNAs targeted to these sites in our human EGFP reporter cell line together with dCas9 protein and either (a) a fusion of FokI nuclease domain fused to the amino-terminal end of Csy4 (FokI-Csy4 fusion protein) or (b) a fusion of FokI nuclease domain fused to the carboxy-terminal end of Csy4 (Csy4-FokI fusion protein) and then assessed by flow cytometry the efficiencies with which these combinations could induce EGFP-negative cells.
[0238] These experiments demonstrate that the FokI-Csy4 fusion proteins were most robustly active in concert with dCas9 and pairs of gRNA for sites in which the PAM sequences were oriented outward with spacer distances of 15-16 bp (
[0239] Interestingly, there are also more moderate potential peaks of activity at spacer distances of 22 and 25 bps on the outward oriented sites. No activity was observed for the Csy4-FokI fusions on any of the outward oriented sites nor was any activity observed with either FokI-Csy4 or Csy4-FokI proteins for any pairs of sites in which the PAM sequences were oriented inward (data not shown). T7 endonuclease I assays demonstrated that the indel mutations induced by the gRNA/dCas9/FokI-Csy4 complexes were targeted to the expected location within the EGFP coding sequence (
REFERENCES
[0240] Cheng, A. W., Wang, H., Yang, H., Shi, L., Katz, Y., Theunissen, T. W., Rangarajan, S., Shivalila, C. S., Dadon, D. B., and Jaenisch, R. Multiplexed activation of endogenous genes by CRISPR-on, an RNA-guided transcriptional activator system. Cell Res 23, 1163-1171. (2013). [0241] Cho, S. W., Kim, S., Kim, J. M. & Kim, J. S. Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease. Nat Biotechnol 31, 230-232 (2013). [0242] Cong, L. et al. Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013). [0243] Cradick, T. J., Fine, E. J., Antico, C. J., and Bao, G. CRISPR/Cas9 systems targeting beta-globin and CCR5 genes have substantial off-target activity. Nucleic Acids Res. (2013). [0244] Dicarlo, J. E. et al. Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Res (2013). [0245] Ding, Q., Regan, S. N., Xia, Y., Oostrom, L. A., Cowan, C. A., and Musunuru, K. Enhanced efficiency of human pluripotent stem cell genome editing through replacing TALENs with CRISPRs. Cell Stem Cell 12, 393-394. (2013). [0246] Fisher, S., Barry, A., Abreu, J., Minie, B., Nolan, J., Delorey, T. M., Young, G., Fennell, T. J., Allen, A., Ambrogio, L., et al. A scalable, fully automated process for construction of sequence-ready human exome targeted capture libraries. Genome Biol 12, R1. (2011). [0247] Friedland, A. E., Tzur, Y. B., Esvelt, K. M., Colaiacovo, M. P., Church, G. M., and [0248] Calarco, J. A. Heritable genome editing in C. elegans via a CRISPR-Cas9 system. Nat Methods 10, 741-743. (2013). [0249] Fu, Y., Foden, J. A., Khayter, C., Maeder, M. L., Reyon, D., Joung, J. K., and Sander, J. D. High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nat Biotechnol 31, 822-826. (2013). [0250] Gabriel, R. et al. An unbiased genome-wide analysis of zinc-finger nuclease specificity. Nat Biotechnol 29, 816-823 (2011). [0251] Gilbert, L. A., Larson, M. H., Morsut, L., Liu, Z., Brar, G. A., Torres, S. E., Stern-Ginossar, N., Brandman, O., Whitehead, E. H., Doudna, J. A., et al. (2013). CRISPR-Mediated Modular RNA-Guided Regulation of Transcription in Eukaryotes. Cell 154, 442-451. [0252] Gratz, S. J. et al. Genome engineering of Drosophila with the CRISPR RNA-guided Cas9 nuclease. Genetics (2013). [0253] Hockemeyer, D. et al. Genetic engineering of human pluripotent cells using TALE nucleases. Nat Biotechnol 29, 731-734 (2011). [0254] Horvath, P. & Barrangou, R. CRISPR/Cas, the immune system of bacteria and archaea. Science 327, 167-170 (2010). [0255] Hsu, P. D., Scott, D. A., Weinstein, J. A., Ran, F. A., Konermann, S., Agarwala, V., Li, Y., Fine, E. J., Wu, X., Shalem, O., et al. DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol 31, 827-832. (2013). [0256] Hwang, W. Y. et al. Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol 31, 227-229 (2013). [0257] Hwang, W. Y., Fu, Y., Reyon, D., Maeder, M. L., Kaini, P., Sander, J. D., Joung, J. K., Peterson, R. T., and Yeh, J. R. Heritable and Precise Zebrafish Genome Editing Using a CRISPR-Cas System. PLOS One 8, e68708. (2013a). [0258] Jiang, W., Bikard, D., Cox, D., Zhang, F. & Marraffini, L. A. RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol 31, 233-239 (2013). [0259] Jinek, M. et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821 (2012). [0260] Jinek, M. et al. RNA-programmed genome editing in human cells. Elife 2, e00471 (2013). [0261] Li, D., Qiu, Z., Shao, Y., Chen, Y., Guan, Y., Liu, M., Li, Y., Gao, N., Wang, L., Lu, [0262] X., et al. Heritable gene targeting in the mouse and rat using a CRISPR-Cas system. Nat Biotechnol 31, 681-683. (2013a). [0263] Li, W., Teng, F., Li, T., and Zhou, Q. Simultaneous generation and germline transmission of multiple gene mutations in rat using CRISPR-Cas systems. Nat Biotechnol 31, 684-686. (2013b). [0264] Maeder, M. L., Linder, S. J., Cascio, V. M., Fu, Y., Ho, Q. H., and Joung, J. K. CRISPR RNA-guided activation of endogenous human genes. Nat Methods 10, 977-979. (2013). [0265] Mali, P., Aach, J., Stranges, P. B., Esvelt, K. M., Moosburner, M., Kosuri, S., Yang, L., and Church, G. M. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol 31, 833-838. (2013a). [0266] Mali, P., Esvelt, K. M., and Church, G. M. Cas9 as a versatile tool for engineering biology. Nat Methods 10, 957-963. (2013b). [0267] Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826 (2013c). [0268] Pattanayak, V., Lin, S., Guilinger, J. P., Ma, E., Doudna, J. A., and Liu, D. R. High-throughput profiling of off-target DNA cleavage reveals RNA-programmed Cas9 nuclease specificity. Nat Biotechnol 31, 839-843. (2013). [0269] Pattanayak, V., Ramirez, C. L., Joung, J. K. & Liu, D. R. Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection. Nat Methods 8, 765-770 (2011). [0270] Perez, E. E. et al. Establishment of HIV-1 resistance in CD4+ T cells by genome editing using zinc-finger nucleases. Nat Biotechnol 26, 808-816 (2008). [0271] Perez-Pinera, P., Kocak, D. D., Vockley, C. M., Adler, A. F., Kabadi, A. M., Polstein, L. R., Thakore, P. I., Glass, K. A., Ousterout, D. G., Leong, K. W., et al. RNA-guided gene activation by CRISPR-Cas9-based transcription factors. Nat Methods 10, 973-976. (2013). [0272] Qi, L. S., Larson, M. H., Gilbert, L. A., Doudna, J. A., Weissman, J. S., Arkin, A. P., and Lim, W. A. Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell 152, 1173-1183. (2013). [0273] Ran, F. A., Hsu, P. D., Lin, C. Y., Gootenberg, J. S., Konermann, S., Trevino, A. E., Scott, D. A., Inoue, A., Matoba, S., Zhang, Y., et al. Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity. Cell 154, 1380-1389. (2013). Reyon, D. et al. FLASH assembly of TALENs for high-throughput genome editing. Nat Biotech 30, 460-465 (2012). [0274] Sander, J. D., Maeder, M. L., Reyon, D., Voytas, D. F., Joung, J. K., and Dobbs, D. ZiFIT (Zinc Finger Targeter); an updated zinc finger engineering tool. Nucleic Acids Res 38, W462-468. (2010). [0275] Sander, J. D., Ramirez, C. L., Linder, S. J., Pattanayak, V., Shoresh, N., Ku, M., Foden, J. A., Reyon, D., Bernstein, B. E., Liu, D. R., et al. In silico abstraction of zinc finger nuclease cleavage profiles reveals an expanded landscape of off-target sites. Nucleic Acids Res. (2013). [0276] Sander, J. D., Zaback, P., Joung, J. K., Voytas, D. F., and Dobbs, D. Zinc Finger Targeter (ZiFiT); an engineered zinc finger/target site design tool. Nucleic Acids Res 35, W599-605. (2007). [0277] Shen, B. et al. Generation of gene-modified mice via Cas9/RNA-mediated gene targeting. Cell Res (2013). [0278] Sugimoto, N. et al. Thermodynamic parameters to predict stability of RNA/DNA hybrid duplexes. Biochemistry 34, 11211-11216 (1995). [0279] Terns, M. P. & Terns, R. M. CRISPR-based adaptive immune systems. Curr Opin Microbiol 14, 321-327 (2011). [0280] Wang, H. et al. One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR/Cas-Mediated Genome Engineering. Cell 153, 910-918 (2013). [0281] Wiedenheft, B., Sternberg, S. H. & Doudna, J. A. RNA-guided genetic silencing systems in bacteria and archaea. Nature 482, 331-338 (2012). [0282] Yang, L., Guell, M., Byrne, S., Yang, J. L., De Los Angeles, A., Mali, P., Aach, J., Kim-Kiselak, C., Briggs, A. W., Rios, X., et al. (2013). Optimization of scarless human stem cell genome editing. Nucleic Acids Res 41, 9049-9061.
OTHER EMBODIMENTS
[0283] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.