KRAS-NEOANTIGEN THERAPIES

20240238397 ยท 2024-07-18

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein are compositions that include antigen-encoding nucleic acid sequences having multiple iterations of KRAS neoepitope-encoding sequences and/or lacking immunodominant epitopes. Also disclosed are nucleotides, cells, and methods associated with the compositions including their use as vaccines, such as in subjects with cancer that includes (1) a solid tumor expressing the KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA).

    Claims

    1. A method for treating a subject with a disease, wherein the disease is cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen-encoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigen-encoding cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5 to 3, by the formula:
    (E.sub.x-(E.sup.N.sub.n).sub.y).sub.z wherein, E represents a nucleotide sequence a distinct epitope-encoding nucleic acid sequences, n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0, E.sup.N represents a nucleotide sequence comprising the separate distinct epitope-encoding nucleic acid sequence for each corresponding n, for each iteration of z: x=0 or 1, y=0 or 1 for each n, and at least one of x or y=1, and z=2 or greater, wherein the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E.sup.N, or a combination thereof, and at least one of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encodes the KRAS-associated MHC class I neoepitope.

    2. A method for treating a subject with a disease, wherein the disease is cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) an epitope-encoding nucleic acid sequence encoding the KRAS-associated MHC class I neoepitope, and wherein each of the epitope-encoding nucleic acid sequences comprises; (A) optionally, a 5 linker sequence, and (B) optionally, a 3 linker sequence; (ii) optionally, a second promoter nucleotide sequence operably linked to the antigen-encoding nucleic acid sequence; and (iii) optionally, at least one MHC class II epitope-encoding nucleic acid sequence; (iv) optionally, at least one nucleic acid sequence encoding a GPGPG amino acid linker sequence (SEQ ID NO:56); and (v) optionally, at least one second poly(A) sequence, wherein the second poly(A) sequence is a native poly(A) sequence or an exogenous poly(A) sequence to the vector backbone, wherein if the second promoter nucleotide sequence is absent, the antigen-encoding nucleic acid sequence is operably linked to the at least one promoter nucleotide sequence, and wherein the at least one antigen-encoding nucleic acid sequence comprises at least two iterations of the epitope-encoding nucleic acid sequence encoding the KRAS-associated MHC class I neoepitope.

    3. The method of any one of the above claims, wherein the epitope-encoding nucleic acid sequence is derived from a tumor of the subject with cancer or from a cell or sample of the infected subject.

    4. The method any one of the above claims, wherein the epitope-encoding nucleic acid sequence are not derived from a tumor of the subject with cancer or from a cell or sample of the infected subject.

    5. A method for stimulating an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen-encoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigen-encoding cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5 to 3, by the formula:
    (E.sub.x-(E.sup.N.sub.n).sub.y).sub.z wherein, E represents a nucleotide sequence comprising a distinct epitope-encoding nucleic acid sequences, n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0, E.sup.N represents a nucleotide sequence comprising the separate distinct epitope-encoding nucleic acid sequence for each corresponding n, for each iteration of z: x=0 or 1, y=0 or 1 for each n, and at least one of x or y=1, and z=2 or greater, wherein the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E.sup.N, or a combination thereof, and at least one of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encodes the KRAS-associated MHC class I neoepitope.

    6. A method for stimulating an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises: an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) an epitope-encoding nucleic acid sequence encoding the KRAS-associated MHC class I neoepitope, and wherein each of the epitope-encoding nucleic acid sequences comprises; (A) optionally, a 5 linker sequence, and (B) optionally, a 3 linker sequence; (ii) optionally, a second promoter nucleotide sequence operably linked to the antigen-encoding nucleic acid sequence; and (iii) optionally, at least one MHC class II epitope-encoding nucleic acid sequence; (iv) optionally, at least one nucleic acid sequence encoding a GPGPG amino acid linker sequence (SEQ ID NO:56); and (v) optionally, at least one second poly(A) sequence, wherein the second poly(A) sequence is a native poly(A) sequence or an exogenous poly(A) sequence to the vector backbone, wherein if the second promoter nucleotide sequence is absent, the antigen-encoding nucleic acid sequence is operably linked to the at least one promoter nucleotide sequence, and wherein the at least one antigen-encoding nucleic acid sequence comprises at least two iterations of at least one of the epitope-encoding nucleic acid sequences encoding the KRAS-associated MHC class I neoepitope.

    7. The method of any one of the above claims, wherein the subject expresses at least one HLA allele predicted or known to present the at least one epitope sequence, optionally wherein the at least one epitope sequence predicted or known to be presented comprises the KRAS-associated MHC class I neoepitope.

    8. The method of any one of the above claims, wherein the subject expresses at least one HLA allele predicted or known to present the at least one epitope sequence, and wherein the at least one epitope sequence comprises an epitope known or suspected to be presented by MHC class I on a surface of a cell, optionally wherein the at least one epitope sequence predicted or known to be presented comprises the KRAS-associated MHC class I neoepitope.

    9. The method of claim 8, wherein the surface of the cell is a tumor cell surface.

    10. A method for inducing an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen-encoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigen-encoding cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5 to 3, by the formula:
    (E.sub.x-(E.sup.N.sub.n).sub.y).sub.z wherein, E represents a nucleotide sequence comprising a distinct epitope-encoding nucleic acid sequences, n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0, E.sup.N represents a nucleotide sequence comprising the separate distinct epitope-encoding nucleic acid sequence for each corresponding n, for each iteration of z: x=0 or 1, y=0 or 1 for each n, and at least one of x or y=1, and z=2 or greater, wherein the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E.sup.N, or a combination thereof, and at least one of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encodes a KRAS-associated MHC class I neoepitope.

    11. A method for inducing an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises: an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) an epitope-encoding nucleic acid sequence encoding the KRAS-associated MHC class I neoepitope, and wherein each of the epitope-encoding nucleic acid sequences comprises; (A) optionally, a 5 linker sequence, and (B) optionally, a 3 linker sequence; (ii) optionally, a second promoter nucleotide sequence operably linked to the antigen-encoding nucleic acid sequence; and (iii) optionally, at least one MHC class II epitope-encoding nucleic acid sequence; (iv) optionally, at least one nucleic acid sequence encoding a GPGPG amino acid linker sequence (SEQ ID NO:56); and (v) optionally, at least one second poly(A) sequence, wherein the second poly(A) sequence is a native poly(A) sequence or an exogenous poly(A) sequence to the vector backbone, wherein if the second promoter nucleotide sequence is absent, the antigen-encoding nucleic acid sequence is operably linked to the at least one promoter nucleotide sequence, wherein the at least one antigen-encoding nucleic acid sequence comprises at least two iterations of the epitope-encoding nucleic acid sequence encoding the KRAS-associated MHC class I neoepitope, and wherein the subject expresses at least one HLA allele predicted or known to present the at least one KRAS-associated MHC class I neoepitope.

    12. The method of any one of the above claims, wherein the antigen-based vaccine is administered as a priming dose.

    13. The method of any one of the above claims, wherein the antigen-based vaccine is administered as one or more boosting doses.

    14. The method of claim 13, wherein the boosting dose is different than the priming dose.

    15. The method of claim 14, wherein: a) the priming dose comprises a chimpanzee adenovirus vector and the boosting dose comprises an alphavirus vector; or b) the priming dose comprises an alphavirus vector and the boosting dose comprises a chimpanzee adenovirus vector.

    16. The method of claim 13, wherein the boosting dose is the same as the priming dose.

    17. The method of any one of claims 13-16, wherein the injection site of the one or more boosting doses is as close as possible to the injection site of the priming dose.

    18. The method of any one of the above method claims, further comprising determining or having determined the HLA-haplotype of the subject.

    19. The method of any one of the above method claims, wherein the antigen-based vaccine is administered intramuscularly (IM), intradermally (ID), subcutaneously (SC), or intravenously (IV).

    20. The method of any one of the above method claims, wherein the antigen-based vaccine is administered intramuscularly (IM).

    21. The method of claim 20, wherein the IM administration is administered at separate injection sites.

    22. The method of claim 21, wherein the separate injection sites are in opposing deltoid muscles.

    23. The method of claim 22, wherein the separate injection sites are in gluteus or rectus femoris sites on each side.

    24. The method of any of the above claims, wherein the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.

    25. The method of any of the above claims, wherein the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises any one of the amino acid sequence shown in SEQ ID NOs: 75-82.

    26. The method of any of the above claims, wherein the antigen-encoding cassette comprises each of the amino acid sequence shown in SEQ ID NOs: 75-82.

    27. The method or composition of any of the above claims, wherein the antigen-encoding cassette comprises two or more iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82, optionally comprising 4 iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82.

    28. The method of any of the above claims, wherein the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises the amino acid sequence shown in SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, or SEQ ID NO: 60.

    29. The method of any of the above claims, wherein the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a distinct KRAS-associated MHC class I neoepitope or a distinct KRAS mutation.

    30. The method of any of the above claims, wherein each of the epitope-encoding nucleic acid sequences independently encodes a distinct KRAS-associated MHC class I neoepitope or a distinct KRAS mutation.

    31. The method of any of the above claims, wherein the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.

    32. The method of any of the above claims, wherein the epitope-encoding nucleic acid sequences independently encodes each of a KRAS G12C mutation, a KRAS G12V mutation, and a KRAS G12D mutation, and optionally a KRAS Q61H mutation.

    33. The method of any of the above claims, wherein the antigen-encoding nucleic acid sequence encodes a peptide comprising the amino acid sequence shown in SEQ ID NO: 64 or SEQ ID NO: 65.

    34. The method of any of the above claims, wherein the cassette does not encode an immunodominant MHC class I epitope that: (1) stimulates a 5-fold or greater immune response when administered in a vaccine composition to a subject relative to another MHC class I epitope encoded in the cassette and capable of stimulating an immune response in the subject, and/or (2) reduces an immune response to another MHC class I epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other MHC class I epitope is administered in the absence of the immunodominant MHC class I epitope, optionally wherein the immune response is reduced to below a limit of detection and/or wherein the immune response is not a therapeutically effective response.

    35. Any one of the above method claims, wherein the cancer comprises a solid tumor expressing a KRAS-associated and/or a NRAS-associated MHC class I neoepitope.

    36. The method of claim 35, wherein the KRAS-associated and/or the NRAS-associated MHC class I neoepitope comprises a mutation selected from the group consisting of: KRAS_G12C, NRAS_G12C, KRAS_G12D, NRAS_G12D, KRAS_G12V, NRAS_G12V, KRAS_Q61H, and NRAS_Q61H.

    37. Any one of the above method claims, wherein the cancer comprises colorectal cancer (CRC).

    38. Any one of the above method claims, wherein the cancer comprises non-small cell lung cancer (NSCLC).

    39. Any one of the above method claims, wherein the cancer comprises pancreatic ductal adenocarcinoma (PDA).

    40. Any one of the above method claims, wherein the antigen-based vaccine or the one or more boosting doses is administered every 4 weeks (Q4W).

    41. Any one of the above method claims, wherein the antigen-based vaccine or the one or more boosting doses is administered every 8 weeks (Q8W).

    42. Any one of the above method claims, wherein the antigen-based vaccine or the one or more boosting doses is administered monthly.

    43. Any one of the above method claims, wherein the antigen-based vaccine or the one or more boosting doses is administered every two months.

    44. Any one of the above method claims, wherein the method comprises administering to the subject a composition for delivery of a self-replicating alphavirus-based expression system and administering to the subject a composition for delivery of a chimpanzee adenovirus (ChAdV)-based expression system, and wherein the composition for delivery of the ChAdV-based expression system is administered as a priming dose and the composition for delivery of the self-replicating alphavirus-based expression system is administered as one or more boosting doses.

    45. The method of any one of the above claims, wherein two or more boosting doses are administered.

    46. The method of any one of the above claims, wherein 1, 2, 3, 4, 5, 6, 7, or 8 boosting doses are administered.

    47. The method of any one of the above claims, wherein the ChAdV-based expression system is further administered as a boosting dose.

    48. The method of claim 47, wherein the ChAdV-based boosting dose is only administered as a single boosting dose.

    49. The method of claim 47 or 48, wherein the ChAdV-based expression system is administered as the boosting dose on or about day 140 after the priming dose of the ChAdV-based expression system.

    50. The method of claim 47 or 48, wherein the ChAdV-based expression system is administered as the boosting dose on or about week 20 after the priming dose of the ChAdV-based expression system.

    51. The method of claim 47 or 48, wherein the ChAdV-based expression system is administered as the boosting dose on or about month 5 after the priming dose of the ChAdV-based expression system.

    52. The method of claim 47 or 48, wherein the ChAdV-based expression system is administered as the boosting dose on or after day 140 after the priming dose of the ChAdV-based expression system.

    53. The method of claim 47 or 48, wherein the ChAdV-based expression system is administered as the boosting dose on or after week 20 after the priming dose of the ChAdV-based expression system.

    54. The method of claim 47 or 48, wherein the ChAdV-based expression system is administered as the boosting dose on or after month 5 after the priming dose of the ChAdV-based expression system.

    55. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two boosting doses.

    56. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 28 days apart.

    57. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 4 weeks (Q4W) apart.

    58. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least one month apart.

    59. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 56 days apart.

    60. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 8 weeks (Q8W) apart.

    61. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 2 months apart.

    62. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two boosting doses on or about days 28 and 84 after the priming dose of the ChAdV-based expression system.

    63. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two boosting doses on or about weeks 4 and 12 after the priming dose of the ChAdV-based expression system.

    64. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least two boosting doses on or about months 1 and 3 after the priming dose of the ChAdV-based expression system.

    65. The method of any one of the above claims, wherein the self-replicating alphavirus-based expression system is administered as at least four boosting doses.

    66. The method of claim 65, wherein the self-replicating alphavirus-based expression system is administered on or about days 28, 84, 196, and 252 relative to the priming dose of the ChAdV-based expression system.

    67. The method of claim 65, wherein the self-replicating alphavirus-based expression system is administered on or about weeks 4, 12, 28, and 40 relative to the priming dose of the ChAdV-based expression system.

    68. The method of claim 65, wherein the self-replicating alphavirus-based expression system is administered on or about months 1, 3, 7, and 10 relative to the priming dose of the ChAdV-based expression system.

    69. The method of any one of the above claims, the method further comprising administration of one or more immune modulators, optionally wherein the immune modulator is administered before, concurrently with, or after administration of the composition or pharmaceutical composition.

    70. The method of claim 55, wherein the one or more immune modulators are selected from the group consisting of: an anti-CTLA4 antibody or an antigen-binding fragment thereof, an anti-PD-1 antibody or an antigen-binding fragment thereof, an anti-PD-L1 antibody or an antigen-binding fragment thereof, an anti-4-1BB antibody or an antigen-binding fragment thereof, or an anti-OX-40 antibody or an antigen-binding fragment thereof.

    71. The method of claim 56 or 57, wherein the immune modulator is administered intravenously (IV), intramuscularly (IM), intradermally (ID), or subcutaneously (SC).

    72. The method of claim 58, wherein the subcutaneous administration is near the site of the composition or pharmaceutical composition administration or in close proximity to one or more vector or composition draining lymph nodes.

    73. The method of any one claims 56-59, wherein the method comprises administration of an anti-CTLA-4 antibody or an antigen-binding fragment thereof only with the priming dose and the first boosting dose.

    74. The method of claim 60, wherein the anti-CTLA-4 antibody comprises ipilimumab.

    75. The method of claim 61, wherein the ipilimumab is administered at a dose of 30 mg subcutaneously.

    76. The method of any one of claims 56-62, wherein the method comprises administration of an anti-PD-L1 antibody or an antigen-binding fragment thereof every 4 weeks (Q4W), optionally comprising.

    77. The method of claim 63, wherein the anti-PD-L1 antibody comprises atezolizumab or nivolumab.

    78. The method of claim 64, wherein the atezolizumab is administered at a dose of 1680 mg intravenously or the nivolumab is administered at a dose of 480 mg intravenously.

    79. The method of any one of claims 56-65, wherein the method comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 administrations of one or more of the immune modulators.

    80. The method of any one of claims 56-65, wherein the method comprises at least 13 administrations of the anti-PD-L1 antibody.

    81. The method of any one of claims 56-67, wherein the one or more immune modulators are selected from the group consisting of: atezolizumab, nivolumamb, cemiplimab, and ipilimumab.

    82. Any one of the above method or composition claims, wherein the KRAS-associated MHC class I neoepitope comprising a KRAS G12C mutation is selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), and GACGVGKSAL (SEQ ID NO: 93); the KRAS-associated MHC class I neoepitope comprising a KRAS G12D mutation is selected from the group consisting of: VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV (SEQ ID NO: 94), and GADGVGKSAL (SEQ ID NO: 95); the KRAS-associated MHC class I neoepitope comprising a KRAS G12V mutation is selected from the group consisting of: VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), and GAVGVGKSAL (SEQ ID NO: 96).

    83. Any one of the above method or composition claims, wherein the KRAS-associated MHC class I neoepitope comprising a KRAS G12C mutation is selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), and GACGVGKSAL (SEQ ID NO: 93).

    84. Any one of the above method or composition claims, wherein the KRAS-associated MHC class I neoepitope comprising a KRAS G12D mutation is selected from the group consisting of: VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV (SEQ ID NO: 94), and GADGVGKSAL (SEQ ID NO: 95).

    85. Any one of the above method or composition claims, wherein the KRAS-associated MHC class I neoepitope comprising a KRAS G12V mutation is selected from the group consisting of: VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), and GAVGVGKSAL (SEQ ID NO: 96).

    86. Any one of the above method or composition claims, wherein the stimulating the immune response comprises stimulating a molecular response.

    87. The method or composition of claim 73, wherein the molecular response comprises a reduction in ctDNA.

    88. The method or composition of claim 74, wherein the reduction in ctDNA is at least a 20%, at least a 30%, at least a 40%, or at least a 50% reduction in ctDNA.

    89. The method or composition of claim 74, wherein the reduction in ctDNA is at least a 30% reduction in ctDNA.

    Description

    BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS

    [0151] These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings, where:

    [0152] FIG. 1A presents an illustration of cassettes featuring either a single copy of KRAS neoepitopes G12C, G12V, G12D, and Q61H (KRAS 1? (20?1); cassette=SEQ ID NO: 63), 2 repeats of the KRAS G12C, G12V, G12D, and Q61H neoepitopes and 2 repeats of additional KRAS neoepitopes (KRAS 2? (8?2); cassette=SEQ ID NO: 64), or 4 repeats of the KRAS neoepitopes (KRAS 4? (4?4); cassette=SEQ ID NO: 65). Numerical identifiers are in reference to the epitope slot relative to each cassette respectively and not across cassette designs (e.g., the slot 3 epitope in the 20?1 cassette is not the same as the epitope in slot 3 of the 8?2 cassette).

    [0153] FIG. 1B demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12C. Mice engineered to express human HLA-A11:01 were immunized with 8?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGACGVGK (SEQ ID NO: 75). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0154] FIG. 1C demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12V. Mice engineered to express human HLA-A11:01 were immunized with 8?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median. Dashed line represent samples that were too numerous to count (TNTC).

    [0155] FIG. 1D demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12D. Mice engineered to express human HLA-A11:01 were immunized with 8?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGADGVGK (SEQ ID NO: 78). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0156] FIG. 2A presents an illustration of ChAdV68 delivery vectors designed to assess immunodominance of a TP53 epitope, specifically vectors containing only KRAS neoepitopes G12C, G12V, G12D, and Q61H (KRAS 4?1; cassette=SEQ ID NO: 66), KRAS neoepitopes in combination with a TP53 R213L neoepitope (KRAS 4?1+R213L; cassette=SEQ ID NO: 67), and KRAS neoepitopes in combination with a TP53 S127Y neoepitope (KRAS 4?1+S127Y; cassette=SEQ ID NO: 68).

    [0157] FIG. 2B demonstrates removal of an immunodominant epitope increases vaccine induced antigen-specific T-cell response to KRAS neoepitopes. Shown are ELISpot results for the neoepitope KRAS G12C. Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGACGVGK (SEQ ID NO: 75). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0158] FIG. 2C demonstrates removal of an immunodominant epitope increases vaccine induced antigen-specific T-cell response to KRAS neoepitopes. Shown are ELISpot results for the neoepitope KRAS G12D. Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGADGVGK (SEQ ID NO: 78). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0159] FIG. 2D demonstrates removal of an immunodominant epitope increases vaccine induced antigen-specific T-cell response to KRAS neoepitopes. Shown are ELISpot results for the neoepitope KRAS G12V. Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0160] FIG. 2E demonstrates the immune response of an immunodominant epitope and related control epitope. Shown are ELISpot results for the TP53 neoepitope pools for R213L and S127Y neoepitopes. Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation. Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median. Dashed line represent samples that were too numerous to count (TNTC).

    [0161] FIG. 3 demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81) or VVVGADGVGK (SEQ ID NO: 78), respectively. Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0162] FIG. 4 demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11:01 were immunized with 7?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81) or VVVGADGVGK (SEQ ID NO: 78), respectively. Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median.

    [0163] FIG. 5 demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response for KRAS Q61H. Shown are ELISpot results for the repeated neoepitope KRAS Q61H for the indicated cassette formats. Mice engineered to express human HLA-A01:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 12 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with ILDTAGHEEY (SEQ ID NO: 82). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median. Dashed line represent samples that were too numerous to count (TNTC).

    [0164] FIG. 6 demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response for both ChAdV68 and SAM vector formats. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated or 10 ?g the SAM vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with respective peptide pools that contained all possible 38 minimal epitopes that span the 25 mer. Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median. Columns from left to right are ChAdV68 20?1, SAM 20?1, ChAdV68 4?4, and SAM 4?4.

    [0165] FIG. 7 demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response for both ChAdV68 and SAM vector formats. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors indicated or 10 ?g the SAM vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVGAVGVGK (SEQ ID NO: 79) or VVVGADGVGK (SEQ ID NO: 78). Data presented as spot forming colonies (SFC) per 1?10.sup.6 splenocytes for each animal. Bar represents the median. Columns from left to right are ChAdV68 20?1, SAM 20?1, ChAdV68 4?4, and SAM 4?4.

    [0166] FIG. 8 illustrates a Phase 1/2 study designed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of cancer vaccines encoding the iterated KRAS neoepitope cassettes described herein (SLATE v2) administered in combination with immune checkpoint blockade in patients with advanced cancer.

    [0167] FIG. 9 shows ELISpot CD8 T cell response for SLATE patient S21 administered the SLATE version 1 (v1) cassette and patient S31 administered the optimized SLATE version 2 (v2) cassette including iterated KRAS neoepitopes. Shown are overnight stimulations with peptide pool containing 38 minimal epitopes. Timepoint was collected post-second SAM administration.

    [0168] FIG. 10 shows clinical responses for patient S31 administered the SLATE v2 cassette including iterated KRAS neoepitopes. Top panel: radiological CT scan of tumor lesion. Bottom left panel: quantification of radiological CT scans. Bottom right panel: response assessment through monitoring neoantigen ctDNA.

    [0169] FIG. 11 illustrates a Phase 1/2 study designed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of cancer vaccines encoding the iterated KRAS neoepitope cassettes described herein (SLATE v2) administered in combination with immune checkpoint blockade in patients with advanced cancer.

    [0170] FIG. 12 shows a summary of T cells responses assessed by IFN? ELISpot for the various G12 mutations, alleles, and cassettes indicated.

    [0171] FIG. 13 shows molecular responses as assessed by monitoring neoantigen ctDNA (left top panel) and standard serum tumor markers CEA and CA 19-9 (left bottom panel), as well as radiological CT scans of tumor lesions (right panels.

    [0172] FIG. 14 shows overall survival probabilities for subjects with and without molecular responses (reduction in ctDNA?30%).

    [0173] FIG. 15 shows a summary of clinical results for patients with NSCLC.

    [0174] FIG. 16 shows a summary of clinical results for patients with late-stage CRC.

    [0175] FIG. 17 illustrates a two-month treatment schedule for the Phase 2 trial.

    DETAILED DESCRIPTION

    I. Definitions

    [0176] In general, terms used in the claims and the specification are intended to be construed as having the plain meaning understood by a person of ordinary skill in the art. Certain terms are defined below to provide additional clarity. In case of conflict between the plain meaning and the provided definitions, the provided definitions are to be used.

    [0177] As used herein the term antigen is a substance that stimulates an immune response. An antigen can be a neoantigen. An antigen can be a shared antigen that is an antigen found among a specific population, e.g., a specific population of cancer patients.

    [0178] As used herein the term neoantigen is an antigen that has at least one alteration that makes it distinct from the corresponding wild-type antigen, e.g., via mutation in a tumor cell or post-translational modification specific to a tumor cell. A neoantigen can include a polypeptide sequence or a nucleotide sequence. A mutation can include a frameshift or non-frameshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF. A mutations can also include a splice variant. Post-translational modifications specific to a tumor cell can include aberrant phosphorylation. Post-translational modifications specific to a tumor cell can also include a proteasome-generated spliced antigen. See Liepe et al., A large fraction of HLA class I ligands are proteasome-generated spliced peptides; Science. 2016 Oct. 21; 354(6310):354-358. The subject can be identified for administration through the use of various diagnostic methods, e.g., patient selection methods described further below.

    [0179] As used herein the term tumor antigen is an antigen present in a subject's tumor cell or tissue but not in the subject's corresponding normal cell or tissue, or derived from a polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.

    [0180] As used herein the term antigen-based vaccine is a vaccine composition based on one or more antigens, e.g., a plurality of antigens. The vaccines can be nucleotide-based (e.g., virally based, RNA based, or DNA based), protein-based (e.g., peptide based), or a combination thereof.

    [0181] As used herein the term candidate antigen is a mutation or other aberration giving rise to a sequence that may represent an antigen.

    [0182] As used herein the term coding region is the portion(s) of a gene that encode protein.

    [0183] As used herein the term coding mutation is a mutation occurring in a coding region.

    [0184] As used herein the term ORF means open reading frame.

    [0185] As used herein the term NEO-ORF is a tumor-specific ORF arising from a mutation or other aberration such as splicing.

    [0186] As used herein the term missense mutation is a mutation causing a substitution from one amino acid to another.

    [0187] As used herein the term nonsense mutation is a mutation causing a substitution from an amino acid to a stop codon or causing removal of a canonical start codon.

    [0188] As used herein the term frameshift mutation is a mutation causing a change in the frame of the protein.

    [0189] As used herein the term indel is an insertion or deletion of one or more nucleic acids.

    [0190] As used herein, the term percent identity, in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the percent identity can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.

    [0191] For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Alternatively, sequence similarity or dissimilarity can be established by the combined presence or absence of particular nucleotides, or, for translated sequences, amino acids at selected sequence positions (e.g., sequence motifs).

    [0192] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).

    [0193] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.

    [0194] As used herein the term non-stop or read-through is a mutation causing the removal of the natural stop codon.

    [0195] As used herein the term epitope is the specific portion of an antigen typically bound by an antibody or T cell receptor.

    [0196] As used herein the term immunogenic is the ability to stimulate an immune response, e.g., via T cells, B cells, or both.

    [0197] As used herein the term HLA binding affinity MHC binding affinity means affinity of binding between a specific antigen and a specific MHC allele.

    [0198] As used herein the term bait is a nucleic acid probe used to enrich a specific sequence of DNA or RNA from a sample.

    [0199] As used herein the term variant is a difference between a subject's nucleic acids and the reference human genome used as a control.

    [0200] As used herein the term variant call is an algorithmic determination of the presence of a variant, typically from sequencing.

    [0201] As used herein the term polymorphism is a germline variant, i.e., a variant found in all DNA-bearing cells of an individual.

    [0202] As used herein the term somatic variant is a variant arising in non-germline cells of an individual.

    [0203] As used herein the term allele is a version of a gene or a version of a genetic sequence or a version of a protein.

    [0204] As used herein the term HLA type is the complement of HLA gene alleles.

    [0205] As used herein the term nonsense-mediated decay or NMD is a degradation of an mRNA by a cell due to a premature stop codon.

    [0206] As used herein the term truncal mutation is a mutation originating early in the development of a tumor and present in a substantial portion of the tumor's cells.

    [0207] As used herein the term subclonal mutation is a mutation originating later in the development of a tumor and present in only a subset of the tumor's cells.

    [0208] As used herein the term exome is a subset of the genome that codes for proteins. An exome can be the collective exons of a genome.

    [0209] As used herein the term logistic regression is a regression model for binary data from statistics where the logit of the probability that the dependent variable is equal to one is modeled as a linear function of the dependent variables.

    [0210] As used herein the term neural network is a machine learning model for classification or regression consisting of multiple layers of linear transformations followed by element-wise nonlinearities typically trained via stochastic gradient descent and back-propagation.

    [0211] As used herein the term proteome is the set of all proteins expressed and/or translated by a cell, group of cells, or individual.

    [0212] As used herein the term peptidome is the set of all peptides presented by MHC-I or MHC-II on the cell surface. The peptidome may refer to a property of a cell or a collection of cells (e.g., the tumor peptidome, meaning the union of the peptidomes of all cells that comprise the tumor).

    [0213] As used herein the term ELISPOT means Enzyme-linked immunosorbent spot assaywhich is a common method for monitoring immune responses in humans and animals.

    [0214] As used herein the term dextramers is a dextran-based peptide-MHC multimers used for antigen-specific T-cell staining in flow cytometry.

    [0215] As used herein the term tolerance or immune tolerance is a state of immune non-responsiveness to one or more antigens, e.g. self-antigens.

    [0216] As used herein the term central tolerance is a tolerance affected in the thymus, either by deleting self-reactive T-cell clones or by promoting self-reactive T-cell clones to differentiate into immunosuppressive regulatory T-cells (Tregs).

    [0217] As used herein the term peripheral tolerance is a tolerance affected in the periphery by downregulating or anergizing self-reactive T-cells that survive central tolerance or promoting these T cells to differentiate into Tregs.

    [0218] The term sample can include a single cell or multiple cells or fragments of cells or an aliquot of body fluid, taken from a subject, by means including venipuncture, excretion, ejaculation, massage, biopsy, needle aspirate, lavage sample, scraping, surgical incision, or intervention or other means known in the art.

    [0219] The term subject encompasses a cell, tissue, or organism, human or non-human, whether in vivo, ex vivo, or in vitro, male or female. The term subject is inclusive of mammals including humans.

    [0220] The term mammal encompasses both humans and non-humans and includes but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.

    [0221] The term clinical factor refers to a measure of a condition of a subject, e.g., disease activity or severity. Clinical factor encompasses all markers of a subject's health status, including non-sample markers, and/or other characteristics of a subject, such as, without limitation, age and gender. A clinical factor can be a score, a value, or a set of values that can be obtained from evaluation of a sample (or population of samples) from a subject or a subject under a determined condition. A clinical factor can also be predicted by markers and/or other parameters such as gene expression surrogates. Clinical factors can include tumor type, tumor sub-type, and smoking history.

    [0222] The term antigen-encoding nucleic acid sequences derived from a tumor refers to nucleic acid sequences obtained from the tumor, e.g. via RT-PCR; or sequence data obtained by sequencing the tumor and then synthesizing the nucleic acid sequences using the sequencing data, e.g., via various synthetic or PCR-based methods known in the art. Derived sequences can include nucleic acid sequence variants, such as sequence-optimized nucleic acid sequence variants (e.g., codon-optimized and/or otherwise optimized for expression), that encode the same polypeptide sequence as the corresponding native nucleic acid sequence obtained from a tumor.

    [0223] The term alphavirus refers to members of the family Togaviridae, and are positive-sense single-stranded RNA viruses. Alphaviruses are typically classified as either Old World, such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses, or New World, such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis and its derivative strain TC-83. Alphaviruses are typically self-replicating RNA viruses.

    [0224] The term alphavirus backbone refers to minimal sequence(s) of an alphavirus that allow for self-replication of the viral genome. Minimal sequences can include conserved sequences for nonstructural protein-mediated amplification, a nonstructural protein 1 (nsP1) gene, a nsP2 gene, a nsP3 gene, a nsP4 gene, and a polyA sequence, as well as sequences for expression of subgenomic viral RNA including a subgenomic (e.g., a 26S) promoter element.

    [0225] The term sequences for nonstructural protein-mediated amplification includes alphavirus conserved sequence elements (CSE) well known to those in the art. CSEs include, but are not limited to, an alphavirus 5 UTR, a 51-nt CSE, a 24-nt CSE, a subgenomic promoter sequence (e.g., a 26S subgenomic promoter sequence), a 19-nt CSE, and an alphavirus 3 UTR.

    [0226] The term RNA polymerase includes polymerases that catalyze the production of RNA polynucleotides from a DNA template. RNA polymerases include, but are not limited to, bacteriophage derived polymerases including T3, T7, and SP6.

    [0227] The term lipid includes hydrophobic and/or amphiphilic molecules. Lipids can be cationic, anionic, or neutral. Lipids can be synthetic or naturally derived, and in some instances biodegradable. Lipids can include cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethyleneglycol (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, fats, and fat-soluble vitamins. Lipids can also include dilinoleylmethyl-4-dimethylaminobutyrate (MC3) and MC3-like molecules.

    [0228] The term lipid nanoparticle or LNP includes vesicle like structures formed using a lipid containing membrane surrounding an aqueous interior, also referred to as liposomes. Lipid nanoparticles includes lipid-based compositions with a solid lipid core stabilized by a surfactant. The core lipids can be fatty acids, acylglycerols, waxes, and mixtures of these surfactants. Biological membrane lipids such as phospholipids, sphingomyelins, bile salts (sodium taurocholate), and sterols (cholesterol) can be utilized as stabilizers. Lipid nanoparticles can be formed using defined ratios of different lipid molecules, including, but not limited to, defined ratios of one or more cationic, anionic, or neutral lipids. Lipid nanoparticles can encapsulate molecules within an outer-membrane shell and subsequently can be contacted with target cells to deliver the encapsulated molecules to the host cell cytosol. Lipid nanoparticles can be modified or functionalized with non-lipid molecules, including on their surface. Lipid nanoparticles can be single-layered (unilamellar) or multi-layered (multilamellar). Lipid nanoparticles can be complexed with nucleic acid. Unilamellar lipid nanoparticles can be complexed with nucleic acid, wherein the nucleic acid is in the aqueous interior. Multilamellar lipid nanoparticles can be complexed with nucleic acid, wherein the nucleic acid is in the aqueous interior, or to form or sandwiched between

    [0229] Abbreviations: MHC: major histocompatibility complex; HLA: human leukocyte antigen, or the human MHC gene locus; NGS: next-generation sequencing; PPV: positive predictive value; TSNA: tumor-specific neoantigen; FFPE: formalin-fixed, paraffin-embedded; NMD: nonsense-mediated decay; NSCLC: non-small-cell lung cancer; DC: dendritic cell.

    [0230] It should be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.

    [0231] Unless specifically stated or otherwise apparent from context, as used herein the term about is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.

    [0232] Any terms not directly defined herein shall be understood to have the meanings commonly associated with them as understood within the art of the invention. Certain terms are discussed herein to provide additional guidance to the practitioner in describing the compositions, devices, methods and the like of aspects of the invention, and how to make or use them. It will be appreciated that the same thing may be said in more than one way. Consequently, alternative language and synonyms may be used for any one or more of the terms discussed herein. No significance is to be placed upon whether or not a term is elaborated or discussed herein. Some synonyms or substitutable methods, materials and the like are provided. Recital of one or a few synonyms or equivalents does not exclude use of other synonyms or equivalents, unless it is explicitly stated. Use of examples, including examples of terms, is for illustrative purposes only and does not limit the scope and meaning of the aspects of the invention herein.

    [0233] All references, issued patents and patent applications cited within the body of the specification are hereby incorporated by reference in their entirety, for all purposes.

    II. Antigen Identification

    [0234] Research methods for NGS analysis of tumor and normal exome and transcriptomes have been described and applied in the antigen identification space. .sup.6, 14, 15 Certain optimizations for greater sensitivity and specificity for antigen identification in the clinical setting can be considered. These optimizations can be grouped into two areas, those related to laboratory processes and those related to the NGS data analysis. The research methods described can also be applied to identification of antigens in other settings, such as identification of identifying antigens from an infectious disease organism, an infection in a subject, or an infected cell of a subject. Examples of optimizations are known to those skilled in the art, for example the methods described in more detail in U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1, U.S. application Ser. No. 16/606,577, and international patent application publications WO2020181240A1, WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.

    [0235] Methods for identifying shared antigens (e.g., neoantigens) include identifying antigens from a tumor of a subject that are likely to be presented on the cell surface of the tumor or immune cells, including professional antigen presenting cells such as dendritic cells, and/or are likely to be immunogenic. As an example, one such method may comprise the steps of: obtaining at least one of exome, transcriptome or whole genome tumor nucleotide sequencing and/or expression data from the tumor cell of the subject, wherein the tumor nucleotide sequencing and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens (e.g., in the case of neoantigens wherein the peptide sequence of each neoantigen comprises at least one alteration that makes it distinct from the corresponding wild-type peptide sequence or in cases of shared antigens without a mutation where peptides are derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue); inputting the peptide sequence of each antigen into one or more presentation models to generate a set of numerical likelihoods that each of the antigens is presented by one or more MHC alleles on the tumor cell surface of the tumor cell of the subject or cells present in the tumor, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and selecting a subset of the set of antigens based on the set of numerical likelihoods to generate a set of selected antigens.

    III. Identification of Tumor Specific Mutations in Neoantigens

    [0236] Also disclosed herein are methods for the identification of certain mutations (e.g., the variants or alleles that are present in cancer cells). In particular, these mutations can be present in the genome, transcriptome, proteome, or exome of cancer cells of a subject having cancer but not in normal tissue from the subject. Specific methods for identifying neoantigens, including shared neoantigens, that are specific to tumors are known to those skilled in the art, for example the methods described in more detail in U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes. Examples of shared neoantigens that are specific to tumors are described in more detail in international patent application publication WO2019226941A1, herein incorporated by reference in its entirety, for all purposes. Shared neoantigens include, but are not limited to, KRAS-associated mutations (e.g., KRAS G12C, KRAS G12V, KRAS G12D, and/or KRAS Q61H mutations). For example, KRAS-associated MHC class I neoepitope can include those mutations with reference to wild-type (WT) human KRAS, such as with reference to the following exemplary amino acid sequence:

    TABLE-US-00001 (SEQIDNO:84) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSY RKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLV REIRQYRLKKISKEEKTPGCVKIKKCIIM.

    [0237] Genetic mutations in tumors can be considered useful for the immunological targeting of tumors if they lead to changes in the amino acid sequence of a protein exclusively in the tumor. Useful mutations include: (1) non-synonymous mutations leading to different amino acids in the protein; (2) read-through mutations in which a stop codon is modified or deleted, leading to translation of a longer protein with a novel tumor-specific sequence at the C-terminus; (3) splice site mutations that lead to the inclusion of an intron in the mature mRNA and thus a unique tumor-specific protein sequence; (4) chromosomal rearrangements that give rise to a chimeric protein with tumor-specific sequences at the junction of 2 proteins (i.e., gene fusion); (5) frameshift mutations or deletions that lead to a new open reading frame with a novel tumor-specific protein sequence. Mutations can also include one or more of non-frameshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF.

    [0238] Peptides with mutations or mutated polypeptides arising from for example, splice-site, frameshift, readthrough, or gene fusion mutations in tumor cells can be identified by sequencing DNA, RNA or protein in tumor versus normal cells.

    [0239] Also mutations can include previously identified tumor specific mutations. Known tumor mutations can be found at the Catalogue of Somatic Mutations in Cancer (COSMIC) database.

    [0240] A variety of methods are available for detecting the presence of a particular mutation or allele in an individual's DNA or RNA. Advancements in this field have provided accurate, easy, and inexpensive large-scale SNP genotyping. For example, several techniques have been described including dynamic allele-specific hybridization (DASH), microplate array diagonal gel electrophoresis (MADGE), pyrosequencing, oligonucleotide-specific ligation, the TaqMan system as well as various DNA chip technologies such as the Affymetrix SNP chips. These methods utilize amplification of a target genetic region, typically by PCR. Still other methods, based on the generation of small signal molecules by invasive cleavage followed by mass spectrometry or immobilized padlock probes and rolling-circle amplification. Several of the methods known in the art for detecting specific mutations are summarized below.

    [0241] PCR based detection means can include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously. Alternatively, it is possible to amplify different markers with primers that are differentially labeled and thus can each be differentially detected. Of course, hybridization based detection means allow the differential detection of multiple PCR products in a sample. Other techniques are known in the art to allow multiplex analyses of a plurality of markers.

    [0242] Several methods have been developed to facilitate analysis of single nucleotide polymorphisms in genomic DNA or cellular RNA. For example, a single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No. 4,656,127). According to the method, a primer complementary to the allelic sequence immediately 3 to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer. Such incorporation renders the primer resistant to exonuclease, and thereby permits its detection. Since the identity of the exonuclease-resistant derivative of the sample is known, a finding that the primer has become resistant to exonucleases reveals that the nucleotide(s) present in the polymorphic site of the target molecule is complementary to that of the nucleotide derivative used in the reaction. This method has the advantage that it does not require the determination of large amounts of extraneous sequence data.

    [0243] A solution-based method can be used for determining the identity of a nucleotide of a polymorphic site. Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087). As in the Mundy method of U.S. Pat. No. 4,656,127, a primer is employed that is complementary to allelic sequences immediately 3 to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.

    [0244] An alternative method, known as Genetic Bit Analysis or GBA is described by Goelet, P. et al. (PCT Appln. No. 92/15712). The method of Goelet, P. et al. uses mixtures of labeled terminators and a primer that is complementary to the sequence 3 to a polymorphic site. The labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated. In contrast to the method of Cohen et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087) the method of Goelet, P. et al. can be a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.

    [0245] Several primer-guided nucleotide incorporation procedures for assaying polymorphic sites in DNA have been described (Komher, J. S. et al., Nucl. Acids. Res. 17:7779-7784 (1989); Sokolov, B. P., Nucl. Acids Res. 18:3671 (1990); Syvanen, A.-C., et al., Genomics 8:684-692 (1990); Kuppuswamy, M. N. et al., Proc. Natl. Acad. Sci. (U.S.A.) 88:1143-1147 (1991); Prezant, T. R. et al., Hum. Mutat. 1:159-164 (1992); Ugozzoli, L. et al., GATA 9:107-112 (1992); Nyren, P. et al., Anal. Biochem. 208:171-175 (1993)). These methods differ from GBA in that they utilize incorporation of labeled deoxynucleotides to discriminate between bases at a polymorphic site. In such a format, since the signal is proportional to the number of deoxynucleotides incorporated, polymorphisms that occur in runs of the same nucleotide can result in signals that are proportional to the length of the run (Syvanen, A.-C., et al., Amer. J. Hum. Genet. 52:46-59 (1993)).

    [0246] A number of initiatives obtain sequence information directly from millions of individual molecules of DNA or RNA in parallel. Real-time single molecule sequencing-by-synthesis technologies rely on the detection of fluorescent nucleotides as they are incorporated into a nascent strand of DNA that is complementary to the template being sequenced. In one method, oligonucleotides 30-50 bases in length are covalently anchored at the 5 end to glass cover slips. These anchored strands perform two functions. First, they act as capture sites for the target template strands if the templates are configured with capture tails complementary to the surface-bound oligonucleotides. They also act as primers for the template directed primer extension that forms the basis of the sequence reading. The capture primers function as a fixed position site for sequence determination using multiple cycles of synthesis, detection, and chemical cleavage of the dye-linker to remove the dye. Each cycle includes adding the polymerase/labeled nucleotide mixture, rinsing, imaging and cleavage of dye. In an alternative method, polymerase is modified with a fluorescent donor molecule and immobilized on a glass slide, while each nucleotide is color-coded with an acceptor fluorescent moiety attached to a gamma-phosphate. The system detects the interaction between a fluorescently-tagged polymerase and a fluorescently modified nucleotide as the nucleotide becomes incorporated into the de novo chain. Other sequencing-by-synthesis technologies also exist.

    [0247] Any suitable sequencing-by-synthesis platform can be used to identify mutations. As described above, four major sequencing-by-synthesis platforms are currently available: the Genome Sequencers from Roche/454 Life Sciences, the 1G Analyzer from Illumina/Solexa, the SOLiD system from Applied BioSystems, and the Heliscope system from Helicos Biosciences. Sequencing-by-synthesis platforms have also been described by Pacific BioSciences and VisiGen Biotechnologies. In some embodiments, a plurality of nucleic acid molecules being sequenced is bound to a support (e.g., solid support). To immobilize the nucleic acid on a support, a capture sequence/universal priming site can be added at the 3 and/or 5 end of the template. The nucleic acids can be bound to the support by hybridizing the capture sequence to a complementary sequence covalently attached to the support. The capture sequence (also referred to as a universal capture sequence) is a nucleic acid sequence complementary to a sequence attached to a support that may dually serve as a universal primer.

    [0248] As an alternative to a capture sequence, a member of a coupling pair (such as, e.g., antibody/antigen, receptor/ligand, or the avidin-biotin pair as described in, e.g., US Patent Application No. 2006/0252077) can be linked to each fragment to be captured on a surface coated with a respective second member of that coupling pair.

    [0249] Subsequent to the capture, the sequence can be analyzed, for example, by single molecule detection/sequencing, e.g., as described in the Examples and in U.S. Pat. No. 7,283,337, including template-dependent sequencing-by-synthesis. In sequencing-by-synthesis, the surface-bound molecule is exposed to a plurality of labeled nucleotide triphosphates in the presence of polymerase. The sequence of the template is determined by the order of labeled nucleotides incorporated into the 3 end of the growing chain. This can be done in real time or can be done in a step-and-repeat mode. For real-time analysis, different optical labels to each nucleotide can be incorporated and multiple lasers can be utilized for stimulation of incorporated nucleotides.

    [0250] Sequencing can also include other massively parallel sequencing or next generation sequencing (NGS) techniques and platforms. Additional examples of massively parallel sequencing techniques and platforms are the Illumina HiSeq or MiSeq, Thermo PGM or Proton, the Pac Bio RS II or Sequel, Qiagen's Gene Reader, and the Oxford Nanopore MinION. Additional similar current massively parallel sequencing technologies can be used, as well as future generations of these technologies.

    [0251] Any cell type or tissue can be utilized to obtain nucleic acid samples for use in methods described herein. For example, a DNA or RNA sample can be obtained from a tumor or a bodily fluid, e.g., blood, obtained by known techniques (e.g. venipuncture) or saliva. Alternatively, nucleic acid tests can be performed on dry samples (e.g. hair or skin). In addition, a sample can be obtained for sequencing from a tumor and another sample can be obtained from normal tissue for sequencing where the normal tissue is of the same tissue type as the tumor. A sample can be obtained for sequencing from a tumor and another sample can be obtained from normal tissue for sequencing where the normal tissue is of a distinct tissue type relative to the tumor.

    [0252] Tumors can include one or more of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, and T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer.

    [0253] Alternatively, protein mass spectrometry can be used to identify or validate the presence of mutated peptides bound to MHC proteins on tumor cells. Peptides can be acid-eluted from tumor cells or from HLA molecules that are immunoprecipitated from tumor, and then identified using mass spectrometry.

    IV. Antigens

    [0254] Antigens can include nucleotides or polypeptides. For example, an antigen can be an RNA sequence that encodes for a polypeptide sequence. Antigens useful in vaccines can therefore include nucleotide sequences or polypeptide sequences.

    [0255] Disclosed herein are isolated peptides that comprise tumor specific mutations identified by the methods disclosed herein, peptides that comprise known tumor specific mutations, and mutant polypeptides or fragments thereof identified by methods disclosed herein. Neoantigen peptides can be described in the context of their coding sequence where a neoantigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.

    [0256] Specifically, disclosed herein cassettes including iterations of KRAS-associated MHC class I neoepitopes. KRAS-associated MHC class I neoepitopes include, but are not limited to, neoepitopes having KRAS G12 mutations and/or KRAS Q61 mutations. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12 mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS Q61 mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having KRAS G12C, KRAS G12V, KRAS G12D, and/or KRAS Q61H mutations. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12C mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12V mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12D mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS Q61H mutation. Cassettes can include iterations of each of KRAS-associated MHC class I neoepitopes having a KRAS G12C, KRAS G12V, KRAS G12D, and KRAS Q61H mutation. Cassettes can include iterations of at least two distinct KRAS-associated MHC class I neoepitopes selected from the group consisting of: a KRAS G12C, KRAS G12V, KRAS G12D, and KRAS Q61H mutation. Cassettes can include iterations of at least three distinct KRAS-associated MHC class I neoepitopes selected from the group consisting of: a KRAS G12C, KRAS G12V, KRAS G12D, and KRAS Q61H mutation. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS G12C mutation. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS G12D mutation. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS G12V mutation. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS Q61H mutation.

    [0257] KRAS-associated MHC class I neoepitopes having a KRAS G12C mutation include VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), or GACGVGKSAL (SEQ ID NO: 93). KRAS-associated MHC class I neoepitopes having a KRAS G12D mutation include VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV (SEQ ID NO: 94), or GADGVGKSAL (SEQ ID NO: 95). KRAS-associated MHC class I neoepitopes having a KRAS G12V mutation include VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), or GAVGVGKSAL (SEQ ID NO: 96).

    [0258] Cassettes can include iterations of each of KRAS-associated MHC class I neoepitopes having the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82). Cassettes can include iterations of at least two distinct KRAS-associated MHC class I neoepitopes having the amino acid sequences selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82). Cassettes can include iterations of at least three distinct KRAS-associated MHC class I neoepitopes having the amino acid sequences selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82). Cassettes can include iterations of at least one of KRAS-associated MHC class I neoepitopes having the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).

    [0259] KRAS-associated MHC class I neoepitopes can include native N- and/or C-terminal flanking sequences of the therapeutic vaccine epitope in the context of the native KRAS protein. Illustrative non-limiting examples of KRAS-associated MHC class I neoepitopes are the 25 mers MTEYKLVVVGACGVGKSALTIQLIQ (SEQ ID NO: 57) for KRAS G12C, MTEYKLVVVGADGVGKSALTIQLIQ (SEQ ID NO: 58) for KRAS G12D, MTEYKLVVVGAVGVGKSALTIQLIQ (SEQ ID NO: 59) for KRAS G12V, and ETCLLDILDTAGHEEYSAMRDQYMR (SEQ ID NO: 60) for KRAS Q61H. KRAS-associated MHC class I neoepitopes that include native flanking sequences can be linked (concatenated) to other neoepitopes encoded in a cassette, including other neoepitopes (e.g., other KRAS-associated MHC class I neoepitopes) that include their respective native flanking sequences. An illustrative non-limiting cassette of concatenated KRAS-associated MHC class I neoepitopes that are linked through their native flanking sequences and that includes 4 iterations for each of the KRAS neoepitopes having the mutations KRAS G12C, KRAS G12D, KRAS G12V, and KRAS Q61H is represented by the amino acid sequence shown in SEQ ID NO: 65.

    [0260] Epitope-encoding nucleic acid sequences that encode KRAS-associated MHC class I neoepitopes, such as those that include native N- and/or C-terminal flanking sequences, can encode multiple known and/or predicted KRAS-associated MHC class I neoepitopes. As an illustrative example, the KRAS G12V 25 mer MTEYKLVVVGAVGVGKSALTIQLIQ (SEQ ID NO: 59) encodes each of the known and/or predicted KRAS-associated MHC class I neoepitopes VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), and AVGVGKSAL (SEQ ID NO: 80).

    [0261] Epitope-encoding nucleic acid sequences, including those that encode KRAS-associated MHC class I neoepitopes, can be in any order in a cassette. Epitope-encoding nucleic acid sequences, including those that encode KRAS-associated MHC class I neoepitopes, can be in an order that minimizes junctional epitopes, as described further herein. As an illustrative non-limiting example, concatenated KRAS-associated MHC class I neoepitopes linked together to minimize junctional epitopes is represented by the amino acid sequence shown in SEQ ID NO: 65 and has the order: G12C G12D Q61H G12D G12V G12C Q61H G12D G12V G12C Q61H G12D G12V Q61H G12V G12C.

    [0262] Also disclosed herein are peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue, for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue. Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database. COSMIC curates comprehensive information on somatic mutations in human cancer. The peptide contains the tumor specific mutation. Tumor antigens (e.g., shared tumor antigens and tumor neoantigens) can include, but are not limited to, those described in U.S. application Ser. No. 17/058,128, herein incorporated by reference for all purposes. Antigen peptides can be described in the context of their coding sequence where an antigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.

    [0263] Antigens can be selected that are predicted to be presented on the cell surface of a cell, such as a tumor cell or an immune cell, including professional antigen presenting cells such as dendritic cells. Antigens can be selected that are predicted to be immunogenic.

    [0264] One or more polypeptides encoded by an antigen nucleotide sequence can comprise at least one of: a binding affinity with MHC with an IC50 value of less than 1000 nM, for MHC Class I peptides a length of 8-15, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, presence of sequence motifs within or near the peptide promoting proteasome cleavage, and presence or sequence motifs promoting TAP transport. For MHC Class II peptides a length 6-30, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids, presence of sequence motifs within or near the peptide promoting cleavage by extracellular or lysosomal proteases (e.g., cathepsins) or HLA-DM catalyzed HLA binding.

    [0265] One or more antigens can be presented on the surface of a tumor.

    [0266] One or more antigens can be immunogenic in a subject having a tumor, e.g., capable of stimulating a T cell response and/or a B cell response in the subject. One or more antigens can be capable of stimulating a B cell response, such as the production of antibodies that recognize the one or more antigens (e.g., antibodies that recognize a tumor). Antibodies can recognize linear polypeptide sequences or recognize secondary and tertiary structures. Accordingly, B cell antigens can include linear polypeptide sequences or polypeptides having secondary and tertiary structures, including, but not limited to, full-length proteins, protein subunits, protein domains, or any polypeptide sequence known or predicted to have secondary and tertiary structures. Antigens capable of stimulating a B cell response to a tumor can be an antigen found on the surface of tumor cell. Antigens capable of eliciting a B cell response to a tumor can be an intracellular neoantigen expressed in a tumor.

    [0267] One or more antigens can include a combination of antigens capable of stimulating a T cell response (e.g., peptides including predicted T cell epitope sequences) and distinct antigens capable of stimulating a B cell response (e.g., full-length proteins, protein subunits, protein domains).

    [0268] One or more antigens that stimulate an autoimmune response in a subject can be excluded from consideration in the context of vaccine generation for a subject.

    [0269] The size of at least one antigenic peptide molecule (e.g., an epitope sequence) can comprise, but is not limited to, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 60, about 70, about 80, about 90, about 100, about 110, about 120 or greater amino molecule residues, and any range derivable therein. In specific embodiments the antigenic peptide molecules are equal to or less than 50 amino acids.

    [0270] Antigenic peptides and polypeptides can be: for MHC Class 115 residues or less in length and usually consist of between about 8 and about 11 residues, particularly 9 or 10 residues; for MHC Class II, 6-30 residues, inclusive.

    [0271] If desirable, a longer peptide can be designed in several ways. In one case, when presentation likelihoods of peptides on HLA alleles are predicted or known, a longer peptide could consist of either: (1) individual presented peptides with an extensions of 2-5 amino acids toward the N- and C-terminus of each corresponding gene product; (2) a concatenation of some or all of the presented peptides with extended sequences for each. In another case, when sequencing reveals a long (>10 residues) neoepitope sequence present in the tumor (e.g. due to a frameshift, read-through or intron inclusion that leads to a novel peptide sequence), a longer peptide would consist of: (3) the entire stretch of novel tumor-specific amino acidsthus bypassing the need for computational or in vitro test-based selection of the strongest HLA-presented shorter peptide. In both cases, use of a longer peptide allows endogenous processing by patient cells and may lead to more effective antigen presentation and stimulation of T cell responses. Longer peptides can also include a full-length protein, a protein subunit, a protein domain, and combinations thereof of a peptide, such as those expressed in a tumor. Longer peptides (e.g., full-length protein, protein subunit, or protein domain) and combinations thereof can be included to stimulate a B cell response.

    [0272] Antigenic peptides and polypeptides can be presented on an HLA protein. In some aspects antigenic peptides and polypeptides are presented on an HLA protein with greater affinity than a wild-type peptide. In some aspects, an antigenic peptide or polypeptide can have an IC50 of at least less than 5000 nM, at least less than 1000 nM, at least less than 500 nM, at least less than 250 nM, at least less than 200 nM, at least less than 150 nM, at least less than 100 nM, at least less than 50 nM or less.

    [0273] In some aspects, antigenic peptides and polypeptides do not stimulate an autoimmune response and/or invoke immunological tolerance when administered to a subject.

    [0274] Also provided are compositions comprising at least two or more antigenic peptides. In some embodiments the composition contains at least two distinct peptides. At least two distinct peptides can be derived from the same polypeptide. By distinct polypeptides is meant that the peptide vary by length, amino acid sequence, or both. A peptide can include a tumor-specific mutation. Tumor-specific peptides can be derived from any polypeptide known to or have been found to contain a tumor specific mutation or peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue, for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue. The peptides can be derived from any polypeptide known to or suspected to be associated with an infectious disease organism, or peptides derived from any polypeptide known to or have been found to have altered expression in an infected cell in comparison to a normal cell or tissue (e.g., an infectious disease polynucleotide or polypeptide, including infectious disease polynucleotides or polypeptides with expression restricted to a host cell). Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database or the AACR Genomics Evidence Neoplasia Information Exchange (GENIE) database. COSMIC curates comprehensive information on somatic mutations in human cancer. AACR GENIE aggregates and links clinical-grade cancer genomic data with clinical outcomes from tens of thousands of cancer patients. In some aspects the tumor specific mutation is a driver mutation for a particular cancer type. A peptide can include a KRAS mutation (e.g., KRAS G12C, KRAS G12V, KRAS G12D, and/or KRAS Q61H mutations).

    [0275] Antigenic peptides and polypeptides having a desired activity or property can be modified to provide certain desired attributes, e.g., improved pharmacological characteristics, while increasing or at least retaining substantially all of the biological activity of the unmodified peptide to bind the desired MHC molecule and activate the appropriate T cell. For instance, antigenic peptide and polypeptides can be subject to various changes, such as substitutions, either conservative or non-conservative, where such changes might provide for certain advantages in their use, such as improved MHC binding, stability or presentation. By conservative substitutions is meant replacing an amino acid residue with another which is biologically and/or chemically similar, e.g., one hydrophobic residue for another, or one polar residue for another. The substitutions include combinations such as Gly, Ala; Val, Ile, Leu, Met; Asp, Glu; Asn, Gln; Ser, Thr; Lys, Arg; and Phe, Tyr. The effect of single amino acid substitutions may also be probed using D-amino acids. Such modifications can be made using well known peptide synthesis procedures, as described in e.g., Merrifield, Science 232:341-347 (1986), Barany & Merrifield, The Peptides, Gross & Meienhofer, eds. (N.Y., Academic Press), pp. 1-284 (1979); and Stewart & Young, Solid Phase Peptide Synthesis, (Rockford, Ill., Pierce), 2d Ed. (1984).

    [0276] Modifications of peptides and polypeptides with various amino acid mimetics or unnatural amino acids can be particularly useful in increasing the stability of the peptide and polypeptide in vivo. Stability can be assayed in a number of ways. For instance, peptidases and various biological media, such as human plasma and serum, have been used to test stability. See, e.g., Verhoef et al., Eur. J. Drug Metab Pharmacokin. 11:291-302 (1986). Half-life of the peptides can be conveniently determined using a 25% human serum (v/v) assay. The protocol is generally as follows. Pooled human serum (Type AB, non-heat inactivated) is delipidated by centrifugation before use. The serum is then diluted to 25% with RPMI tissue culture media and used to test peptide stability. At predetermined time intervals a small amount of reaction solution is removed and added to either 6% aqueous trichloracetic acid or ethanol. The cloudy reaction sample is cooled (4 degrees C.) for 15 minutes and then spun to pellet the precipitated serum proteins. The presence of the peptides is then determined by reversed-phase HPLC using stability-specific chromatography conditions.

    [0277] The peptides and polypeptides can be modified to provide desired attributes other than improved serum half-life. For instance, the ability of the peptides to stimulate CTL activity can be enhanced by linkage to a sequence which contains at least one epitope that is capable of stimulating a T helper cell response. Immunogenic peptides/T helper conjugates can be linked by a spacer molecule. The spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions. The spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids. It will be understood that the optionally present spacer need not be comprised of the same residues and thus can be a hetero- or homo-oligomer. When present, the spacer will usually be at least one or two residues, more usually three to six residues. Alternatively, the peptide can be linked to the T helper peptide without a spacer.

    [0278] An antigenic peptide can be linked to the T helper peptide either directly or via a spacer either at the amino or carboxy terminus of the peptide. The amino terminus of either the antigenic peptide or the T helper peptide can be acylated. Exemplary T helper peptides include tetanus toxoid 830-843, influenza 307-319, malaria circumsporozoite 382-398 and 378-389.

    [0279] Proteins or peptides can be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, or the chemical synthesis of proteins or peptides. The nucleotide and protein, polypeptide and peptide sequences corresponding to various genes have been previously disclosed, and can be found at computerized databases known to those of ordinary skill in the art. One such database is the National Center for Biotechnology Information's Genbank and GenPept databases located at the National Institutes of Health website. The coding regions for known genes can be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art. Alternatively, various commercial preparations of proteins, polypeptides and peptides are known to those of skill in the art.

    [0280] In a further aspect an antigen includes a nucleic acid (e.g. polynucleotide) that encodes an antigenic peptide or portion thereof. The polynucleotide can be, e.g., DNA, cDNA, PNA, CNA, RNA (e.g., mRNA), either single- and/or double-stranded, or native or stabilized forms of polynucleotides, such as, e.g., polynucleotides with a phosphorothioate backbone, or combinations thereof and it may or may not contain introns. A polynucleotide sequence encoding an antigen can be sequence-optimized to improve expression, such as through improving transcription, translation, post-transcriptional processing, and/or RNA stability. For example, polynucleotide sequence encoding an antigen can be codon-optimized. Codon-optimization herein refers to replacing infrequently used codons, with respect to codon bias of a given organism, with frequently used synonymous codons. Polynucleotide sequences can be optimized to improve post-transcriptional processing, for example optimized to reduce unintended splicing, such as through removal of splicing motifs (e.g., canonical and/or cryptic/non-canonical splice donor, branch, and/or acceptor sequences) and/or introduction of exogenous splicing motifs (e.g., splice donor, branch, and/or acceptor sequences) to bias favored splicing events. Exogenous intron sequences include, but are not limited to, those derived from SV40 (e.g., an SV40 mini-intron) and derived from immunoglobulins (e.g., human ?-globin gene). Exogenous intron sequences can be incorporated between a promoter/enhancer sequence and the antigen(s) sequence. Exogenous intron sequences for use in expression vectors are described in more detail in Callendret et al. (Virology. 2007 Jul. 5; 363(2): 288-302), herein incorporated by reference for all purposes. Polynucleotide sequences can be optimized to improve transcript stability, for example through removal of RNA instability motifs (e.g., AU-rich elements and 3 UTR motifs) and/or repetitive nucleotide sequences. Polynucleotide sequences can be optimized to improve accurate transcription, for example through removal of cryptic transcriptional initiators and/or terminators. Polynucleotide sequences can be optimized to improve translation and translational accuracy, for example through removal of cryptic AUG start codons, premature polyA sequences, and/or secondary structure motifs. Polynucleotide sequences can be optimized to improve nuclear export of transcripts, such as through addition of a Constitutive Transport Element (CTE), RNA Transport Element (RTE), or Woodchuck Posttranscriptional Regulatory Element (WPRE). Nuclear export signals for use in expression vectors are described in more detail in Callendret et al. (Virology. 2007 Jul. 5; 363(2): 288-302), herein incorporated by reference for all purposes. Polynucleotide sequences can be optimized with respect to GC content, for example to reflect the average GC content of a given organism. Sequence optimization can balance one or more sequence properties, such as transcription, translation, post-transcriptional processing, and/or RNA stability. Sequence optimization can generate an optimal sequence balancing each of transcription, translation, post-transcriptional processing, and RNA stability. Sequence optimization algorithms are known to those of skill in the art, such as GeneArt (Thermo Fisher), Codon Optimization Tool (IDT), Cool Tool (University of Singapore), SGI-DNA (La Jolla California). One or more regions of an antigen-encoding protein can be sequence-optimized separately.

    [0281] A still further aspect provides an expression vector capable of expressing a polypeptide or portion thereof. Expression vectors for different cell types are well known in the art and can be selected without undue experimentation. Generally, DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression. If necessary, DNA can be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host, although such controls are generally available in the expression vector. The vector is then introduced into the host through standard techniques. Guidance can be found e.g. in Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.

    V. Vaccine Compositions

    [0282] Also disclosed herein is an immunogenic composition, e.g., a vaccine composition, capable of raising a specific immune response, e.g., a tumor-specific immune response. Vaccine compositions typically comprise one or a plurality of antigens, e.g., selected using a method described herein. Vaccine compositions can also be referred to as vaccines.

    [0283] A vaccine can contain between 1 and 30 peptides, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 different peptides, 6, 7, 8, 9, 10 11, 12, 13, or 14 different peptides, or 12, 13 or 14 different peptides. Peptides can include post-translational modifications. A vaccine can contain between 1 and 100 or more nucleotide sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more different nucleotide sequences, 6, 7, 8, 9, 10 11, 12, 13, or 14 different nucleotide sequences, or 12, 13 or 14 different nucleotide sequences. A vaccine can contain between 1 and 30 antigen sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more different antigen sequences, 6, 7, 8, 9, 10 11, 12, 13, or 14 different antigen sequences, or 12, 13 or 14 different antigen sequences.

    [0284] A vaccine can contain between 1 and 30 antigen-encoding nucleic acid sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more different antigen-encoding nucleic acid sequences, 6, 7, 8, 9, 10 11, 12, 13, or 14 different antigen-encoding nucleic acid sequences, or 12, 13 or 14 different antigen-encoding nucleic acid sequences. Antigen-encoding nucleic acid sequences can refer to the antigen encoding portion of an antigen cassette. Features of an antigen cassette are described in greater detail herein. An antigen-encoding nucleic acid sequence can contain one or more epitope-encoding nucleic acid sequences (e.g., an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes).

    [0285] A vaccine can contain between 1 and 30 distinct epitope-encoding nucleic acid sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more distinct epitope-encoding nucleic acid sequences, 6, 7, 8, 9, 10 11, 12, 13, or 14 distinct epitope-encoding nucleic acid sequences, or 12, 13 or 14 distinct epitope-encoding nucleic acid sequences. Epitope-encoding nucleic acid sequences can refer to sequences for individual epitope sequences, such as each of the T cell epitopes in an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes.

    [0286] A vaccine can contain at least two iterations of an epitope-encoding nucleic acid sequence. A used herein, an iteration (or interchangeably a repeat) refers to two or more identical nucleic acid epitope-encoding nucleic acid sequences (inclusive of the optional 5 linker sequence and/or the optional 3 linker sequences described herein) within an antigen-encoding nucleic acid sequence. In one example, the antigen-encoding nucleic acid sequence portion of a cassette encodes at least two iterations of an epitope-encoding nucleic acid sequence. In further non-limiting examples, the antigen-encoding nucleic acid sequence portion of a cassette encodes more than one distinct epitope, and at least one of the distinct epitopes is encoded by at least two iterations of the nucleic acid sequence encoding the distinct epitope (i.e., at least two distinct epitope-encoding nucleic acid sequences). In illustrative non-limiting examples, an antigen-encoding nucleic acid sequence encodes epitopes A, B, and C encoded by epitope-encoding nucleic acid sequences epitope-encoding sequence A (E.sub.A), epitope-encoding sequence B (E.sub.B), and epitope-encoding sequence C (E.sub.C), and exemplary antigen-encoding nucleic acid sequences having iterations of at least one of the distinct epitopes are illustrated by, but is not limited to, the formulas below:

    Iteration of One Distinct Epitope (Iteration of Epitope A): E.sub.A-E.sub.B-E.sub.C-E.sub.A; or E.sub.A-E.sub.A-E.sub.B-E.sub.C
    Iteration of Multiple Distinct Epitopes (Iterations of Epitopes a, B, and C): E.sub.A-E.sub.B-E.sub.C-E.sub.AE.sub.B-E.sub.C; or E.sub.A-E.sub.A-E.sub.B-E.sub.B-E.sub.C-E.sub.C
    Multiple Iterations of Multiple Distinct Epitopes (Iterations of Epitopes a, B, and C): E.sub.A-E.sub.B-E.sub.C-E.sub.AE.sub.B-E.sub.C-E.sub.A-E.sub.C; or E.sub.A-E.sub.A-E.sub.A-E.sub.BE.sub.B-E.sub.B-E.sub.C-E.sub.C-E.sub.C

    [0287] The above examples are not limiting and the antigen-encoding nucleic acid sequences having iterations of at least one of the distinct epitopes can encode each of the distinct epitopes in any order or frequency. For example, the order and frequency can be a random arrangement of the distinct epitopes, e.g., in an example with epitopes A, B, and C, by the formula E.sub.A-E.sub.B-E.sub.C-E.sub.C-E.sub.A-E.sub.B-E.sub.A-E.sub.C-E.sub.A-E.sub.C-E.sub.C-E.sub.B.

    [0288] Also provided for herein is an antigen-encoding cassette, the antigen-encoding cassette having at least one antigen-encoding nucleic acid sequence described, from 5 to 3, by the formula:


    (E.sub.x?(E.sup.N.sub.n).sub.y).sub.z [0289] where E represents a nucleotide sequence including a distinct epitope-encoding nucleic acid sequences, [0290] n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0, [0291] E.sup.N represents a nucleotide sequence comprising the separate distinct epitope-encoding nucleic acid sequence for each corresponding n, [0292] for each iteration of z: x=0 or 1, y=0 or 1 for each n, and at least one of x or y=1, and z=2 or greater, wherein the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E.sup.N, or a combination thereof. In some aspects, at least one of the distinct epitope-encoding nucleic acid sequences with the at least two iterations encodes a KRAS-associated MHC class I neoepitope.

    [0293] Each E or E.sup.N can independently comprise any epitope-encoding nucleic acid sequence described herein (e.g., a peptide encoding an infectious disease T cell epitope and/or a neoantigen epitope). For example, Each E or E.sup.N can independently comprises a nucleotide sequence described, from 5 to 3, by the formula (L5.sub.b-N.sub.c-L3.sub.d), where N comprises the distinct epitope-encoding nucleic acid sequence associated with each E or E.sup.N, where c=1, L5 comprises a 5 linker sequence, where b=0 or 1, and L3 comprises a 3 linker sequence, where d=0 or 1. Epitopes and linkers that can be used are further described herein.

    [0294] Iterations of an epitope-encoding nucleic acid sequences (inclusive of optional 5 linker sequence and/or the optional 3 linker sequences) can be linearly linked directly to one another (e.g., E.sub.A-E.sub.A- . . . as illustrated above). Iterations of an epitope-encoding nucleic acid sequences can be separated by one or more additional nucleotides sequences. In general, iterations of an epitope-encoding nucleic acid sequences can be separated by any size nucleotide sequence applicable for the compositions described herein. In one example, iterations of an epitope-encoding nucleic acid sequences can be separated by a separate distinct epitope-encoding nucleic acid sequence (e.g., E.sub.A-E.sub.B-E.sub.C-E.sub.A . . . , as illustrated above). In examples where iterations are separated by a single separate distinct epitope-encoding nucleic acid sequence, and each epitope-encoding nucleic acid sequences (inclusive of optional 5 linker sequence and/or the optional 3 linker sequences) encodes a peptide 25 amino acids in length, the iterations can be separated by 75 nucleotides, such as in antigen-encoding nucleic acid represented by E.sub.A-E.sub.B-E.sub.A . . . , E.sub.A is separated by 75 nucleotides. In an illustrative example, an antigen-encoding nucleic acid having the sequence VTNTEMFVTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDTVTNTEMF VTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDT (SEQ ID NO:85) encoding iterations of 25 mer antigens Trp1 (VTNTEMFVTAPDNLGYMYEVQWPGQ [SEQ ID NO:86]) and Trp2 (TQPQIANCSVYDFFVWLHYYSVRDT [SEQ ID NO:87]), the iterations of Trp1 are separated by the 25 mer Trp2 and thus the repeats of the Trp1 epitope-encoding nucleic acid sequences are separated the 75 nucleotide Trp2 epitope-encoding nucleic acid sequence. In examples where iterations are separated by 2, 3, 4, 5, 6, 7, 8, or 9 separate distinct epitope-encoding nucleic acid sequence, and each epitope-encoding nucleic acid sequences (inclusive of optional 5 linker sequence and/or the optional 3 linker sequences) encodes a peptide 25 amino acids in length, the iterations can be separated by 150, 225, 300, 375, 450, 525, 600, or 675 nucleotides, respectively.

    [0295] In one embodiment, different peptides and/or polypeptides or nucleotide sequences encoding them are selected so that the peptides and/or polypeptides capable of associating with different MHC molecules, such as different MHC class I molecules and/or different MHC class II molecules. In some aspects, one vaccine composition comprises coding sequence for peptides and/or polypeptides capable of associating with the most frequently occurring MHC class I molecules and/or different MHC class II molecules. Hence, vaccine compositions can comprise different fragments capable of associating with at least 2 preferred, at least 3 preferred, or at least 4 preferred MHC class I molecules and/or different MHC class II molecules.

    [0296] The vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and/or a specific helper T-cell response. The vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and a specific helper T-cell response.

    [0297] The vaccine composition can be capable of stimulating a specific B-cell response (e.g., an antibody response).

    [0298] The vaccine composition can be capable of stimulating a specific cytotoxic T-cell response, a specific helper T-cell response, and/or a specific B-cell response. The vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and a specific B-cell response. The vaccine composition can be capable of stimulating a specific helper T-cell response and a specific B-cell response. The vaccine composition can be capable of stimulating a specific cytotoxic T-cell response, a specific helper T-cell response, and a specific B-cell response.

    [0299] A vaccine composition can further comprise an adjuvant and/or a carrier. Examples of useful adjuvants and carriers are given herein below. A composition can be associated with a carrier such as e.g. a protein or an antigen-presenting cell such as, e.g., a dendritic cell (DC) capable of presenting the peptide to a T-cell.

    [0300] Adjuvants are any substance whose admixture into a vaccine composition increases or otherwise modifies the immune response to an antigen. Carriers can be scaffold structures, for example a polypeptide or a polysaccharide, to which an antigen, is capable of being associated. Optionally, adjuvants are conjugated covalently or non-covalently.

    [0301] The ability of an adjuvant to increase an immune response to an antigen is typically manifested by a significant or substantial increase in an immune-mediated reaction, or reduction in disease symptoms. For example, an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen, and an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion. An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th response into a primarily cellular, or Th response.

    [0302] Suitable adjuvants include, but are not limited to 1018 ISS, alum, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, JuvImmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-E.sub.C, ONTAK, PepTel vector system, PLG microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Aquila's QS21 stimulon (Aquila Biotech, Worcester, Mass., USA) which is derived from saponin, mycobacterial extracts and synthetic bacterial cell wall mimics, and other proprietary adjuvants such as Ribi's Detox. Quil or Superfos. Adjuvants such as incomplete Freund's or GM-CSF are useful. Several immunological adjuvants (e.g., MF59) specific for dendritic cells and their preparation have been described previously (Dupuis M, et al., Cell Immunol. 1998; 186(1):18-27; Allison A C; Dev Biol Stand. 1998; 92:3-11). Also cytokines can be used. Several cytokines have been directly linked to influencing dendritic cell migration to lymphoid tissues (e.g., TNF-alpha), accelerating the maturation of dendritic cells into efficient antigen-presenting cells for T-lymphocytes (e.g., GM-CSF, IL-1 and IL-4) (U.S. Pat. No. 5,849,589, specifically incorporated herein by reference in its entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).

    [0303] CpG immunostimulatory oligonucleotides have also been reported to enhance the effects of adjuvants in a vaccine setting. Other TLR binding molecules such as RNA binding TLR 7, TLR 8 and/or TLR 9 may also be used.

    [0304] Other examples of useful adjuvants include, but are not limited to, chemically modified CpGs (e.g. CpR, Idera), Poly(I:C)(e.g. polyi:CI2U), non-CpG bacterial DNA or RNA as well as immunoactive small molecules and antibodies such as cyclophosphamide, sunitinib, bevacizumab, celebrex, NCX-4016, sildenafil, tadalafil, vardenafil, sorafinib, XL-999, CP-547632, pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175, which may act therapeutically and/or as an adjuvant. The amounts and concentrations of adjuvants and additives can readily be determined by the skilled artisan without undue experimentation. Additional adjuvants include colony-stimulating factors, such as Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, sargramostim).

    [0305] A vaccine composition can comprise more than one different adjuvant. Furthermore, a therapeutic composition can comprise any adjuvant substance including any of the above or combinations thereof. It is also contemplated that a vaccine and an adjuvant can be administered together or separately in any appropriate sequence.

    [0306] A carrier (or excipient) can be present independently of an adjuvant. The function of a carrier can for example be to increase the molecular weight of in particular mutant to increase activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half-life. Furthermore, a carrier can aid presenting peptides to T-cells. A carrier can be any suitable carrier known to the person skilled in the art, for example a protein or an antigen presenting cell. A carrier protein could be but is not limited to keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid. For immunization of humans, the carrier is generally a physiologically acceptable carrier acceptable to humans and safe. However, tetanus toxoid and/or diphtheria toxoid are suitable carriers. Alternatively, the carrier can be dextrans for example Sepharose.

    [0307] Cytotoxic T-cells (CTLs) recognize an antigen in the form of a peptide bound to an MHC molecule rather than the intact foreign antigen itself. The MHC molecule itself is located at the cell surface of an antigen presenting cell. Thus, an activation of CTLs is possible if a trimeric complex of peptide antigen, MHC molecule, and APC is present. Correspondingly, it may enhance the immune response if not only the peptide is used for activation of CTLs, but if additionally APCs with the respective MHC molecule are added. Therefore, in some embodiments a vaccine composition additionally contains at least one antigen presenting cell.

    [0308] Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616-629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev. (2011) 239(1): 45-61, Sakuma et al., Lentiviral vectors: basic to translational, Biochem J. (2012) 443(3):603-18, Cooper et al., Rescue of splicing-mediated intron loss maximizes expression in lentiviral vectors containing the human ubiquitin C promoter, Nucl. Acids Res. (2015) 43 (1): 682-690, Zufferey et al., Self-Inactivating Lentivirus Vector for Safe and Efficient In Vivo Gene Delivery, J. Virol. (1998) 72 (12): 9873-9880). Dependent on the packaging capacity of the above mentioned viral vector-based vaccine platforms, this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides. The sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science. (2016) 352 (6291):1337-41, Lu et al., Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions, Clin Cancer Res. (2014) 20(13):3401-10). Upon introduction into a host, infected cells express the antigens, and thereby stimulate a host immune (e.g., CTL) response against the peptide(s). Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)). A wide variety of other vaccine vectors useful for therapeutic administration or immunization of antigens, e.g., Salmonella typhi vectors, and the like will be apparent to those skilled in the art from the description herein.

    V.A. Antigen Cassette

    [0309] The methods employed for the selection of one or more antigens, the cloning and construction of an antigen cassette and its insertion into a viral vector are within the skill in the art given the teachings provided herein. By antigen cassette or cassette is meant the combination of a selected antigen or plurality of antigens (e.g., antigen-encoding nucleic acid sequences) and the other regulatory elements necessary to transcribe the antigen(s) and express the transcribed product. The selected antigen or plurality of antigens can refer to distinct epitope sequences, e.g., an antigen-encoding nucleic acid sequence in the cassette can encode an epitope-encoding nucleic acid sequence (or plurality of epitope-encoding nucleic acid sequences) such that the epitopes are transcribed and expressed. An antigen or plurality of antigens can be operatively linked to regulatory components in a manner which permits transcription. Such components include conventional regulatory elements that can drive expression of the antigen(s) in a cell transfected with the viral vector. Thus the antigen cassette can also contain a selected promoter which is linked to the antigen(s) and located, with other, optional regulatory elements, within the selected viral sequences of the recombinant vector. A cassette can include one or more antigens (e.g., one or more KRAS-associated neoepitopes in the vaccine composition, such as any of the KRAS-associated neoepitopes shown in SEQ ID NOs. 75-82). A cassette can have one or more antigen-encoding nucleic acid sequences, such as a cassette containing multiple antigen-encoding nucleic acid sequences each independently operably linked to separate promoters and/or linked together using other multicistonic systems, such as 2A ribosome skipping sequence elements (e.g., E2A, P2A, F2A, or T2A sequences) or Internal Ribosome Entry Site (IRES) sequence elements. A linker can also have a cleavage site, such as a TEV or furin cleavage site. Linkers with cleavage sites can be used in combination with other elements, such as those in a multicistronic system. In a non-limiting illustrative example, a furin protease cleavage site can be used in conjunction with a 2A ribosome skipping sequence element such that the furin protease cleavage site is configured to facilitate removal of the 2A sequence following translation. In a cassette containing more than one antigen-encoding nucleic acid sequences, each antigen-encoding nucleic acid sequence can contain one or more epitope-encoding nucleic acid sequences (e.g., an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes).

    [0310] Useful promoters can be constitutive promoters or regulated (inducible) promoters, which will enable control of the amount of antigen(s) to be expressed. For example, a desirable promoter is that of the cytomegalovirus immediate early promoter/enhancer [see, e.g., Boshart et al, Cell, 41:521-530 (1985)]. Another desirable promoter includes the Rous sarcoma virus LTR promoter/enhancer. Still another promoter/enhancer sequence is the chicken cytoplasmic beta-actin promoter [T. A. Kost et al, Nucl. Acids Res., 11(23):8287 (1983)]. Other suitable or desirable promoters can be selected by one of skill in the art.

    [0311] Also disclosed herein is a viral vector comprising a cassette with at least one payload sequence operably linked to a regulatable promoter that is a TET promoter system, such as a TET-On system or TET-Off system. Without wishing to be bound by theory, a TET promoter system can be used to minimize transcription of payload nucleic acids encoded in a cassette, such as antigens encoded in a vaccine cassette, during viral production. TET promoter systems are described in detail in international patent application publication WO2020/243719, herein incorporated by reference for all purposes.

    [0312] A TET promoter system can include a tetracycline (TET) repressor protein (TETr) controlled promoter. Accordingly, also disclosed herein is a viral vector comprising a cassette with at least one payload sequence operably linked to a tetracycline (TET) repressor protein (TETr) controlled promoter. A TETr controlled promoter can include the 19 bp TET operator (TETo) sequence TCCCTATCAGTGATAGAGA (SEQ ID NO: 92). A TETr controlled promoter can include 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more TETo nucleic acid sequences. In TETr controlled promoter have 2 or more TETo nucleic acid sequences, the TETo sequences can be linked together. In TETr controlled promoter have 2 or more TETo nucleic acid sequences, the TETo sequences can be directly linked together. In TETr controlled promoter have 2 or more TETo nucleic acid sequences, the TETo sequences can be linked together with a linker sequence, such as a linker sequence having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more nucleotides. In general, a TETr controlled promoter can use any promoter sequence desired, such as a SV40, EF-1, RSV, PGK, HSA, MCK or EBV promoter sequence. A TETr controlled promoter can use a CMV promoter sequence. A TETr controlled promoter can use a minimal CMV promoter sequence. TETo sequences can be upstream (5) of a promoter sequence region where RNA polymerase binds. In an illustrative example, 7 TETo sequences are upstream (5) of a promoter sequence. A TETr controlled promoter operably linked to the at least one payload nucleic acid sequence with TETo sequence upstream of the promoter sequence region can have an ordered sequence described in the formula, from 5 to 3:


    (T?L.sub.Y).sub.x?P?N

    where N is a payload nucleic acid sequence, P is a RNA polymerase binding sequence of the promoter sequence operably linked to payload nucleic acid sequence, T is a TETo nucleic acid sequences comprising the nucleotide sequence shown in SEQ ID NO:66, L is a linker sequence, where Y=0 or 1 for each X, and wherein X=1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In an illustrative example, X=7 and Y=1 for each X describes where 7 TETo sequences are upstream (5) of the promoter sequence and each TETo sequence is separated by a linker.

    [0313] A TETo sequences can be downstream (3) of a promoter sequence region where RNA polymerase binds. In another illustrative example, 2 TETo sequences are downstream (3) of a promoter sequence. A TETr controlled promoter operably linked to the at least one payload nucleic acid sequence with TETo sequence downstream of the promoter sequence region can have an ordered sequence described in the formula, from 5 to 3:


    P?(T?L.sub.Y).sub.x?N

    where N is a payload nucleic acid sequence, P is a RNA polymerase binding sequence of the promoter sequence operably linked to payload nucleic acid sequence, T is a TETo nucleic acid sequences comprising the nucleotide sequence shown in SEQ ID NO:66, L is a linker sequence, where Y=0 or 1 for each X, and wherein X=1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In an illustrative example, X=2 and Y=1 for each X describes where 2 TETo sequences are downstream (3) of the promoter sequence and each TETo sequence is separated by a linker.

    [0314] Viral production of vectors with TETr controlled promoters can use any viral production cell line engineered to express a TETr sequence (tTS), such as a 293 cell line or its derivatives (e.g., a 293F cell line) engineered to express tTS. Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production. Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral infectivity defined as viral particles (VP) per infectious unit (IU). Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 1.5, at least 2, at least 2.5, at least 3, at least 3.5, at least 4, at least 4.5, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10-fold relative to production in a non-tTS-expressing cell. Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100-fold relative to production in a non-tTS-expressing cell. Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 1.5, at least 2, at least 2.5, at least 3, at least 3.5, at least 4, at least 4.5, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10-fold relative to production of a vector not having a TETr controlled promoter. Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100-fold relative to production of a vector not having a TETr controlled promoter.

    [0315] The antigen cassette can also include nucleic acid sequences heterologous to the viral vector sequences including sequences providing signals for efficient polyadenylation of the transcript (poly(A), poly-A or pA) and introns with functional splice donor and acceptor sites. A common poly-A sequence which is employed in the exemplary vectors of this invention is that derived from the papovavirus SV-40. The poly-A sequence generally can be inserted in the cassette following the antigen-based sequences and before the viral vector sequences. A common intron sequence can also be derived from SV-40, and is referred to as the SV-40 T intron sequence. An antigen cassette can also contain such an intron, located between the promoter/enhancer sequence and the antigen(s). Selection of these and other common vector elements are conventional [see, e.g., Sambrook et al, Molecular Cloning. A Laboratory Manual., 2d edit, Cold Spring Harbor Laboratory, New York (1989) and references cited therein] and many such sequences are available from commercial and industrial sources as well as from Genbank.

    [0316] An antigen cassette can have one or more antigens. For example, a given cassette can include 1-10, 1-20, 1-30, 10-20, 15-25, 15-20, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more antigens. Antigens can be linked directly to one another. Antigens can also be linked to one another with linkers. Antigens can be in any orientation relative to one another including N to C or C to N.

    [0317] As described elsewhere herein, the antigen cassette can be located in the site of any selected deletion in a viral vector, such as the deleted structural proteins of a VEE backbone or the site of the E1 gene region deletion or E3 gene region deletion of a ChAd-based vector, among others which may be selected.

    [0318] The antigen cassette can be described using the following formula to describe the ordered sequence of each element, from 5 to 3:


    (P.sub.a- (L5.sub.b- N.sub.c- L3.sub.d).sub.x).sub.z-(P2.sub.h-(G5.sub.e-U.sub.f).sub.y).sub.w-G3.sub.g

    wherein P and P2 comprise promoter nucleotide sequences, N comprises an MHC class I epitope-encoding nucleic acid sequence, L5 comprises a 5 linker sequence, L3 comprises a 3 linker sequence, G5 comprises a nucleic acid sequences encoding an amino acid linker, G3 comprises one of the at least one nucleic acid sequences encoding an amino acid linker, U comprises an MHC class II antigen-encoding nucleic acid sequence, where for each X the corresponding Nc is an epitope encoding nucleic acid sequence, where for each Y the corresponding Uf is a MHC class II epitope-encoding nucleic acid sequence (e.g., universal MHC class II epitope-encoding nucleic acid sequence). A universal sequence can comprise at least one of Tetanus toxoid and PADRE. A universal sequence can comprise a Tetanus toxoid peptide. A universal sequence can comprise a PADRE peptide. A universal sequence can comprise a Tetanus toxoid and PADRE peptides. The composition and ordered sequence can be further defined by selecting the number of elements present, for example where a=0 or 1, where b=0 or 1, where c=1, where d=0 or 1, where e=0 or 1, where f=1, where g=0 or 1, where h=0 or 1, X=1 to 400, Y=0, 1, 2, 3, 4 or 5, Z=1 to 400, and W=0, 1, 2, 3, 4 or 5.

    [0319] In one example, elements present include where a=0, b=1, d=1, e=1, g=1, h=0, X=10, Y=2, Z=1, and W=1, describing where no additional promoter is present (e.g. only the promoter nucleotide sequence provided by a vector backbone, such as an RNA alphavirus backbone is present), 10 MHC class I epitopes are present, a 5 linker is present for each N, a 3 linker is present for each N, 2 MHC class II epitopes are present, a linker is present linking the two MHC class II epitopes, a linker is present linking the 5 end of the two MHC class II epitopes to the 3 linker of the final MHC class I epitope, and a linker is present linking the 3 end of the two MHC class II epitopes to the to a vector backbone (e.g., an RNA alphavirus backbone). Examples of linking the 3 end of the antigen cassette to a vector backbone (e.g., an RNA alphavirus backbone) include linking directly to the 3 UTR elements provided by the vector backbone, such as a 3 19-nt CSE. Examples of linking the 5 end of the antigen cassette to a vector backbone (e.g., an RNA alphavirus backbone) include linking directly to a promoter or 5 UTR element of the vector backbone, such as a subgenomic promoter sequence (e.g., a 26S subgenomic promoter sequence), an alphavirus 5 UTR, a 51-nt CSE, or a 24-nt CSE.

    [0320] Other examples include: where a=1 describing where a promoter other than the promoter nucleotide sequence provided by a vector backbone (e.g., an RNA alphavirus backbone) is present; where a=1 and Z is greater than 1 where multiple promoters other than the promoter nucleotide sequence provided by the vector backbone are present each driving expression of 1 or more distinct MHC class I epitope encoding nucleic acid sequences; where h=1 describing where a separate promoter is present to drive expression of the MHC class II epitope-encoding nucleic acid sequences; and where g=0 describing the MHC class II epitope-encoding nucleic acid sequence, if present, is directly linked to a vector backbone (e.g., an RNA alphavirus backbone).

    [0321] Other examples include where each MHC class I epitope that is present can have a 5 linker, a 3 linker, neither, or both. In examples where more than one MHC class I epitope is present in the same antigen cassette, some MHC class I epitopes may have both a 5 linker and a 3 linker, while other MHC class I epitopes may have either a 5 linker, a 3 linker, or neither. In other examples where more than one MHC class I epitope is present in the same antigen cassette, some MHC class I epitopes may have either a 5 linker or a 3 linker, while other MHC class I epitopes may have either a 5 linker, a 3 linker, or neither.

    [0322] In examples where more than one MHC class II epitope is present in the same antigen cassette, some MHC class II epitopes may have both a 5 linker and a 3 linker, while other MHC class II epitopes may have either a 5 linker, a 3 linker, or neither. In other examples where more than one MHC class II epitope is present in the same antigen cassette, some MHC class II epitopes may have either a 5 linker or a 3 linker, while other MHC class II epitopes may have either a 5 linker, a 3 linker, or neither.

    [0323] Other examples include where each antigen that is present can have a 5 linker, a 3 linker, neither, or both. In examples where more than one antigen is present in the same antigen cassette, some antigens may have both a 5 linker and a 3 linker, while other antigens may have either a 5 linker, a 3 linker, or neither. In other examples where more than one antigen is present in the same antigen cassette, some antigens may have either a 5 linker or a 3 linker, while other antigens may have either a 5 linker, a 3 linker, or neither.

    [0324] The promoter nucleotide sequences P and/or P2 can be the same as a promoter nucleotide sequence provided by a vector backbone, such as an RNA alphavirus backbone. For example, the promoter sequence provided by the vector backbone, Pn and P2, can each comprise a subgenomic promoter sequence (e.g., a 26S subgenomic promoter sequence) or a CMV promoter. The promoter nucleotide sequences P and/or P2 can be different from the promoter nucleotide sequence provided by a vector backbone (e.g., an RNA alphavirus backbone), as well as can be different from each other.

    [0325] The 5 linker L5 can be a native sequence or a non-natural sequence. Non-natural sequence include, but are not limited to, AAY, RR, and DPP. The 3 linker L3 can also be a native sequence or a non-natural sequence. Additionally, L5 and L3 can both be native sequences, both be non-natural sequences, or one can be native and the other non-natural. For each X, the amino acid linkers can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more amino acids in length. For each X, the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.

    [0326] The amino acid linker G5, for each Y, can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more amino acids in length. For each Y, the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.

    [0327] The amino acid linker G3 can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more amino acids in length. G3 can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.

    [0328] For each X, each N can encode a MHC class I epitope, a MHC class II epitope, an epitope/antigen capable of stimulating a B cell response, or a combination thereof. For each X, each N can encode a combination of a MHC class I epitope, a MHC class II epitope, and an epitope/antigen capable of stimulating a B cell response. For each X, each N can encode a combination of a MHC class I epitope and a MHC class II epitope. For each X, each N can encode a combination of a MHC class I epitope and an epitope/antigen capable of stimulating a B cell response. For each X, each N can encode a combination of a MHC class II epitope and an epitope/antigen capable of stimulating a B cell response. For each X, each N can encode a MHC class II epitope. For each X, each N can encode an epitope/antigen capable of stimulating a B cell response. For each X, each N can encode a MHC class I epitope 7-15 amino acids in length. For each X, each N can also encodes a MHC class I epitope 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids in length. For each X, each N can also encodes a MHC class I epitope at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.

    [0329] The cassette encoding the one or more antigens can be 700 nucleotides or less. The cassette encoding the one or more antigens can be 700 nucleotides or less and encode 2 distinct epitope-encoding nucleic acid sequences (e.g., encode 2 distinct infectious disease or tumor derived nucleic acid sequences encoding an immunogenic polypeptide). The cassette encoding the one or more antigens can be 700 nucleotides or less and encode at least 2 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 700 nucleotides or less and encode 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 700 nucleotides or less and encode at least 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 700 nucleotides or less and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.

    [0330] The cassette encoding the one or more antigens can be between 375-700 nucleotides in length. The cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode 2 distinct epitope-encoding nucleic acid sequences (e.g., encode 2 distinct infectious disease or tumor derived nucleic acid sequences encoding an immunogenic polypeptide). The cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode at least 2 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens be between 375-700 nucleotides in length and encode at least 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be between 375-700 nucleotides in length and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.

    [0331] The cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less. The cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode 2 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode at least 2 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode at least 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.

    [0332] The cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length. The cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode 2 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode at least 2 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode at least 3 distinct epitope-encoding nucleic acid sequences. The cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.

    [0333] In some instances, an antigen or epitope in a cassette encoding additional antigens and/or epitopes may be an immunodominant epitope relative to the others encoded. Immunodominance, in general, is the skewing of an immune response towards only one or a few specific immunogenic peptides. Immunodominance can be assessed as part of an immune monitoring protocol. For example, immunodominance can be assessed through evaluating T cell and/or B cell responses to the encoded antigens.

    [0334] Immunodominance can be assessed as the impact of an immunodominant antigen's presence on the immune response to one or more other antigens. For example, an immunodominant antigen and its respective immune response (e.g., an immunodominant MHC class I epitope) can reduce the immune response of another antigen relative to the immune response in the absence of the immunodominant antigen. This reduction can be such that the immune response in the presence of the immunodominant antigen is not considered a therapeutically effective response. For example, an MHC class I epitope would generally be considered immunodominant if T cell responses to other antigens are no longer considered therapeutically effective responses compared to responses elicited in the absence of the immunodominant MHC class I epitope. An immune response can also be reduced to below a limit of detection or near the limit of detection. relative to the response in the absence of the immunodominant antigen. For example, an MHC class I epitope would generally be considered immunodominant if T cell responses to other antigens are at or below the limit of detection compared to responses elicited in the absence of the immunodominant MHC class I epitope. In general, the assessment of immunodominance is between two antigens both capable of stimulating an immune response, e.g., between two T cell epitopes in a vaccine composition administered to a subject possessing a cognate MHC allele known or predicted to present each epitope, respectively. Immunodominance can be assessed through evaluating relative immune responses to other antigens in the presence and absence of the suspected immunodominant antigen.

    [0335] Immunodominance can be assessed as a relative difference in the immune responses between two or more antigens. Immunodominance can refer to a 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, or 50-fold immune response of a specific antigen relative to another antigen encoded in the same cassette. Immunodominance can refer to a 100-fold, 200-fold, 300-fold, 400-fold, or 500-fold immune response of a specific antigen relative to another antigen encoded in the same cassette. Immunodominance can refer to a 1000-fold, 2000-fold, 3000-fold, 4000-fold, or 5000-fold immune response of a specific antigen relative to another antigen encoded in the same cassette. Immunodominance can refer to a 10,000-fold immune response of a specific antigen relative to another antigen encoded in the same cassette.

    [0336] In some instances, it may be desired to avoid vaccine compositions containing an immunodominant epitope. For example, it may be desired to avoid designing a vaccine cassette encoding an immunodominant epitope. Without wishing to be bound by theory, administering and/or encoding an immunodominant epitope together with additional epitope may reduce the immune response to the additional epitopes, including potentially ultimately reducing vaccine efficacy against the additional epitopes. As an illustrative non-limiting example, vaccine compositions including TP53-associated neoepitopes may have the immune response, e.g., a T cell response, skewed towards the TP53-associated neoepitope negatively impacting (e.g., reducing the immune response to where the immune response is not a therapeutically effective response and/or to below a limit of detection) the immune response to other antigens or epitopes in the vaccine composition (e.g., one or more KRAS-associated neoepitopes in the vaccine composition, such as any of the KRAS-associated neoepitopes shown in SEQ ID NOs. 75-82). Accordingly, vaccine compositions can be designed to not contain an immunodominant epitope, such as designing a vaccine cassette (e.g., a (neo)antigen-encoding cassette) to not encode an immunodominant epitope. For example, the cassette does not encode an epitope that reduces an immune response to another epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other epitope is administered in the absence of the immunodominant MHC class I epitope. In another example, the cassette does not encode an epitope that reduces an immune response to another epitope encoded in the cassette to below a limit of detection when administered in a vaccine composition to a subject relative to an immune response when the other epitope is administered in the absence of the immunodominant MHC class I epitope. In another example, the cassette does not encode an epitope that reduces an immune response to another epitope encoded in the cassette, wherein the immune response is not a therapeutically effective response, when administered in a vaccine composition to a subject relative to an immune response when the other epitope is administered in the absence of the immunodominant MHC class I epitope. In another example, the cassette does not encode an epitope that stimulates a 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, or 50-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject. In another example, the cassette does not encode an epitope that stimulates a 100-fold, 200-fold, 300-fold, 400-fold, or 500-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject. In another example, the cassette does not encode an epitope that stimulates a 1000-fold, 2000-fold, 3000-fold, 4000-fold, or 5000-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject. In another example, the cassette does not encode an epitope that results in a 10,000-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject.

    V.B. Immune Modulators

    [0337] Vectors described herein, such as C68 vectors described herein or alphavirus vectors described herein, can comprise a nucleic acid which encodes at least one antigen and the same or a separate vector can comprise a nucleic acid which encodes at least one immune modulator. An immune modulator can include a binding molecule (e.g., an antibody such as an scFv) which binds to and blocks the activity of an immune checkpoint molecule. An immune modulator can include a cytokine, such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL-15, or IL-21. An immune modulator can include a modified cytokine (e.g., pegIL-2). Vectors can comprise an antigen cassette and one or more nucleic acid molecules encoding an immune modulator.

    [0338] Illustrative immune checkpoint molecules that can be targeted for blocking or inhibition include, but are not limited to, CTLA-4, 4-1BB (CD137), 4-1BBL (CD137L), PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, ??, and memory CD8+ (??) T cells), CD160 (also referred to as BY55), and CGEN-15049. Immune checkpoint inhibitors include antibodies, or antigen binding fragments thereof, or other binding proteins, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4, CD160, and CGEN-15049. Illustrative immune checkpoint inhibitors include Tremelimumab (CTLA-4 blocking antibody), anti-OX40, PD-L1 monoclonal Antibody (Anti-B7-H1; MEDI4736), ipilimumab, MK-3475 (PD-1 blocker), Nivolumab (anti-PD1 antibody), Cemiplimab (anti-PD1 antibody), CT-011 (anti-PD1 antibody), BY55 monoclonal antibody, AMP224 (anti-PDL1 antibody), BMS-936559 (anti-PDL1 antibody), MPLDL3280A/Atezolizumab (anti-PDL1 antibody), MSB0010718C (anti-PDL1 antibody) and Yervoy/ipilimumab (anti-CTLA-4 checkpoint inhibitor). Antibody-encoding sequences can be engineered into vectors such as C68 using ordinary skill in the art. An exemplary method is described in Fang et al., Stable antibody expression at therapeutic levels using the 2A peptide. Nat Biotechnol. 2005 May; 23(5):584-90. Epub 2005 Apr. 17; herein incorporated by reference for all purposes.

    V.C. Additional Considerations for Vaccine Design and Manufacture

    V.C.1. Determination of a Set of Peptides that Cover All Tumor Subclones

    [0339] Truncal peptides, meaning those presented by all or most tumor subclones, can be prioritized for inclusion into a vaccine. Optionally, if there are no truncal peptides predicted to be presented and immunogenic with high probability, or if the number of truncal peptides predicted to be presented and immunogenic with high probability is small enough that additional non-truncal peptides can be included in the vaccine, then further peptides can be prioritized by estimating the number and identity of tumor subclones and choosing peptides so as to maximize the number of tumor subclones covered by a vaccine.

    V.C.2. Antigen Prioritization

    [0340] After all of the above antigen filters are applied, more candidate antigens may still be available for vaccine inclusion than the vaccine technology can support. Additionally, uncertainty about various aspects of the antigen analysis may remain and tradeoffs may exist between different properties of candidate vaccine antigens. Thus, in place of predetermined filters at each step of the selection process, an integrated multi-dimensional model can be considered that places candidate antigens in a space with at least the following axes and optimizes selection using an integrative approach. [0341] 1. Risk of auto-immunity or tolerance (risk of germline) (lower risk of auto-immunity is typically preferred) [0342] 2. Probability of sequencing artifact (lower probability of artifact is typically preferred) [0343] 3. Probability of immunogenicity (higher probability of immunogenicity is typically preferred) [0344] 4. Probability of presentation (higher probability of presentation is typically preferred) [0345] 5. Gene expression (higher expression is typically preferred) [0346] 6. Coverage of HLA genes (larger number of HLA molecules involved in the presentation of a set of antigens may lower the probability that a tumor will escape immune attack via downregulation or mutation of HLA molecules) [0347] 7. Coverage of HLA classes (covering both HLA-I and HLA-II may increase the probability of therapeutic response and decrease the probability of tumor escape)

    [0348] Additionally, optionally, antigens can be deprioritized (e.g., excluded) from the vaccination if they are predicted to be presented by HLA alleles lost or inactivated in either all or part of the patient's tumor. HLA allele loss can occur by either somatic mutation, loss of heterozygosity, or homozygous deletion of the locus. Methods for detection of HLA allele somatic mutation are well known in the art, e.g. (Shukla et al., 2015). Methods for detection of somatic LOH and homozygous deletion (including for HLA locus) are likewise well described. (Carter et al., 2012; McGranahan et al., 2017; Van Loo et al., 2010). Antigens can also be deprioritized if mass-spectrometry data indicates a predicted antigen is not presented by a predicted HLA allele.

    V.D. Alphavirus

    V.D.1. Alphavirus Biology

    [0349] Alphaviruses are members of the family Togaviridae, and are positive-sense single stranded RNA viruses. Members are typically classified as either Old World, such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses, or New World, such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis virus and its derivative strain TC-83 (Strauss Microbial Review 1994). A natural alphavirus genome is typically around 12 kb in length, the first two-thirds of which contain genes encoding non-structural proteins (nsPs) that form RNA replication complexes for self-replication of the viral genome, and the last third of which contains a subgenomic expression cassette encoding structural proteins for virion production (Frolov RNA 2001).

    [0350] A model lifecycle of an alphavirus involves several distinct steps (Strauss Microbial Review 1994, Jose Future Microbiol 2009). Following virus attachment to a host cell, the virion fuses with membranes within endocytic compartments resulting in the eventual release of genomic RNA into the cytosol. The genomic RNA, which is in a plus-strand orientation and comprises a 5 methylguanylate cap and 3 polyA tail, is translated to produce non-structural proteins nsP1-4 that form the replication complex. Early in infection, the plus-strand is then replicated by the complex into a minus-stand template. In the current model, the replication complex is further processed as infection progresses, with the resulting processed complex switching to transcription of the minus-strand into both full-length positive-strand genomic RNA, as well as the 26S subgenomic positive-strand RNA containing the structural genes. Several conserved sequence elements (CSEs) of alphavirus have been identified to potentially play a role in the various RNA replication steps including; a complement of the 5 UTR in the replication of plus-strand RNAs from a minus-strand template, a 51-nt CSE in the replication of minus-strand synthesis from the genomic template, a 24-nt CSE in the junction region between the nsPs and the 26S RNA in the transcription of the subgenomic RNA from the minus-strand, and a 3 19-nt CSE in minus-strand synthesis from the plus-strand template.

    [0351] Following the replication of the various RNA species, virus particles are then typically assembled in the natural lifecycle of the virus. The 26S RNA is translated and the resulting proteins further processed to produce the structural proteins including capsid protein, glycoproteins E1 and E2, and two small polypeptides E3 and 6K (Strauss 1994). Encapsidation of viral RNA occurs, with capsid proteins normally specific for only genomic RNA being packaged, followed by virion assembly and budding at the membrane surface.

    V.D.2. Alphavirus as a Delivery Vector

    [0352] Alphaviruses (including alphavirus sequences, features, and other elements) can be used to generate alphavirus-based delivery vectors (also be referred to as alphavirus vectors, alphavirus viral vectors, alphavirus vaccine vectors, self-replicating RNA (srRNA) vectors, self-amplifying mRNA (SAM) vectors, or samRNA vectors). Alphaviruses have previously been engineered for use as expression vector systems (Pushko 1997, Rheme 2004). Alphaviruses offer several advantages, particularly in a vaccine setting where heterologous antigen expression can be desired. Due to its ability to self-replicate in the host cytosol, alphavirus vectors are generally able to produce high copy numbers of the expression cassette within a cell resulting in a high level of heterologous antigen production. Additionally, the vectors are generally transient, resulting in improved biosafety as well as reduced induction of immunological tolerance to the vector. The public, in general, also lacks pre-existing immunity to alphavirus vectors as compared to other standard viral vectors, such as human adenovirus. Alphavirus based vectors also generally result in cytotoxic responses to infected cells. Cytotoxicity, to a certain degree, can be important in a vaccine setting to properly stimulate an immune response to the heterologous antigen expressed. However, the degree of desired cytotoxicity can be a balancing act, and thus several attenuated alphaviruses have been developed, including the TC-83 strain of VEE. Thus, an example of an antigen expression vector described herein can utilize an alphavirus backbone that allows for a high level of antigen expression, stimulates a robust immune response to antigen, does not stimulate an immune response to the vector itself, and can be used in a safe manner. Furthermore, the antigen expression cassette can be designed to stimulate different levels of an immune response through optimization of which alphavirus sequences the vector uses, including, but not limited to, sequences derived from VEE or its attenuated derivative TC-83.

    [0353] Several expression vector design strategies have been engineered using alphavirus sequences (Pushko 1997). In one strategy, a alphavirus vector design includes inserting a second copy of the 26S promoter sequence elements downstream of the structural protein genes, followed by a heterologous gene (Frolov 1993). Thus, in addition to the natural non-structural and structural proteins, an additional subgenomic RNA is produced that expresses the heterologous protein. In this system, all the elements for production of infectious virions are present and, therefore, repeated rounds of infection of the expression vector in non-infected cells can occur.

    [0354] Another expression vector design makes use of helper virus systems (Pushko 1997). In this strategy, the structural proteins are replaced by a heterologous gene. Thus, following self-replication of viral RNA mediated by still intact non-structural genes, the 26S subgenomic RNA provides for expression of the heterologous protein. Traditionally, additional vectors that expresses the structural proteins are then supplied in trans, such as by co-transfection of a cell line, to produce infectious virus. A system is described in detail in U.S. Pat. No. 8,093,021, which is herein incorporated by reference in its entirety, for all purposes. The helper vector system provides the benefit of limiting the possibility of forming infectious particles and, therefore, improves biosafety. In addition, the helper vector system reduces the total vector length, potentially improving the replication and expression efficiency. Thus, an example of an antigen expression vector described herein can utilize an alphavirus backbone wherein the structural proteins are replaced by an antigen cassette, the resulting vector both reducing biosafety concerns, while at the same time promoting efficient expression due to the reduction in overall expression vector size.

    V.D.3. Alphavirus Production In Vitro

    [0355] Alphavirus delivery vectors are generally positive-sense RNA polynucleotides. A convenient technique well-known in the art for RNA production is in vitro transcription IVT. In this technique, a DNA template of the desired vector is first produced by techniques well-known to those in the art, including standard molecular biology techniques such as cloning, restriction digestion, ligation, gene synthesis (e.g., chemical and/or enzymatic synthesis), and polymerase chain reaction (PCR). The DNA template contains a RNA polymerase promoter at the 5 end of the sequence desired to be transcribed into RNA. Promoters include, but are not limited to, bacteriophage polymerase promoters such as T3, T7, or SP6. The DNA template is then incubated with the appropriate RNA polymerase enzyme, buffer agents, and nucleotides (NTPs). The resulting RNA polynucleotide can optionally be further modified including, but limited to, addition of a 5 cap structure such as 7-methylguanosine or a related structure, and optionally modifying the 3 end to include a polyadenylate (polyA) tail. The RNA can then be purified using techniques well-known in the field, such as phenol-chloroform extraction or column purification (e.g., chromatography-based purification).

    V.D.4. Delivery Via Lipid Nanoparticle

    [0356] An important aspect to consider in vaccine vector design is immunity against the vector itself (Riley 2017). This may be in the form of preexisting immunity to the vector itself, such as with certain human adenovirus systems, or in the form of developing immunity to the vector following administration of the vaccine. The latter is an important consideration if multiple administrations of the same vaccine are performed, such as separate priming and boosting doses, or if the same vaccine vector system is to be used to deliver different antigen cassettes.

    [0357] In the case of alphavirus vectors, the standard delivery method is the previously discussed helper virus system that provides capsid, E1, and E2 proteins in trans to produce infectious viral particles. However, it is important to note that the E1 and E2 proteins are often major targets of neutralizing antibodies (Strauss 1994). Thus, the efficacy of using alphavirus vectors to deliver antigens of interest to target cells may be reduced if infectious particles are targeted by neutralizing antibodies.

    [0358] An alternative to viral particle mediated gene delivery is the use of nanomaterials to deliver expression vectors (Riley 2017). Nanomaterial vehicles, importantly, can be made of non-immunogenic materials and generally avoid eliciting immunity to the delivery vector itself. These materials can include, but are not limited to, lipids, inorganic nanomaterials, and other polymeric materials. Lipids can be cationic, anionic, or neutral. The materials can be synthetic or naturally derived, and in some instances biodegradable. Lipids can include fats, cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethyleneglycol (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, and fat soluble vitamins.

    [0359] Lipid nanoparticles (LNPs) are an attractive delivery system due to the amphiphilic nature of lipids enabling formation of membranes and vesicle like structures (Riley 2017). In general, these vesicles deliver the expression vector by absorbing into the membrane of target cells and releasing nucleic acid into the cytosol. In addition, LNPs can be further modified or functionalized to facilitate targeting of specific cell types. Another consideration in LNP design is the balance between targeting efficiency and cytotoxicity. Lipid compositions generally include defined mixtures of cationic, neutral, anionic, and amphipathic lipids. In some instances, specific lipids are included to prevent LNP aggregation, prevent lipid oxidation, or provide functional chemical groups that facilitate attachment of additional moieties. Lipid composition can influence overall LNP size and stability. In an example, the lipid composition comprises dilinoleylmethyl-4-dimethylaminobutyrate (MC3) or MC3-like molecules. MC3 and MC3-like lipid compositions can be formulated to include one or more other lipids, such as a PEG or PEG-conjugated lipid, a sterol, or neutral lipids.

    [0360] Nucleic-acid vectors, such as expression vectors, exposed directly to serum can have several undesirable consequences, including degradation of the nucleic acid by serum nucleases or off-target stimulation of the immune system by the free nucleic acids. Therefore, encapsulation of the alphavirus vector can be used to avoid degradation, while also avoiding potential off-target affects. In certain examples, an alphavirus vector is fully encapsulated within the delivery vehicle, such as within the aqueous interior of an LNP. Encapsulation of the alphavirus vector within an LNP can be carried out by techniques well-known to those skilled in the art, such as microfluidic mixing and droplet generation carried out on a microfluidic droplet generating device. Such devices include, but are not limited to, standard T-junction devices or flow-focusing devices. In an example, the desired lipid formulation, such as MC3 or MC3-like containing compositions, is provided to the droplet generating device in parallel with the alphavirus delivery vector and other desired agents, such that the delivery vector and desired agents are fully encapsulated within the interior of the MC3 or MC3-like based LNP. In an example, the droplet generating device can control the size range and size distribution of the LNPs produced. For example, the LNP can have a size ranging from 1 to 1000 nanometers in diameter, e.g., 1, 10, 50, 100, 500, or 1000 nanometers. Following droplet generation, the delivery vehicles encapsulating the expression vectors can be further treated or modified to prepare them for administration.

    V.E. Chimpanzee Adenovirus (ChAd)

    V.E.1. Viral Delivery with Chimpanzee Adenovirus

    [0361] Vaccine compositions for delivery of one or more antigens (e.g., via an antigen cassette and including one or more KRAS-associated neoepitopes, such as any of the KRAS-associated neoepitopes shown in SEQ ID NOs. 75-82) can be created by providing adenovirus nucleotide sequences of chimpanzee origin, a variety of novel vectors, and cell lines expressing chimpanzee adenovirus genes. A nucleotide sequence of a chimpanzee C68 adenovirus (also referred to herein as ChAdV68) can be used in a vaccine composition for antigen delivery (See SEQ ID NO: 1). Use of C68 adenovirus derived vectors is described in further detail in U.S. Pat. No. 6,083,716, which is herein incorporated by reference in its entirety, for all purposes. ChAdV68-based vectors and delivery systems are described in detail in US App. Pub. No. US20200197500A1 and international patent application publication WO2020243719A1, each of which is herein incorporated by reference for all purposes.

    [0362] In a further aspect, provided herein is a recombinant adenovirus comprising the DNA sequence of a chimpanzee adenovirus such as C68 and an antigen cassette operatively linked to regulatory sequences directing its expression. The recombinant virus is capable of infecting a mammalian, preferably a human, cell and capable of expressing the antigen cassette product in the cell. In this vector, the native chimpanzee E1 gene, and/or E3 gene, and/or E4 gene can be deleted. An antigen cassette can be inserted into any of these sites of gene deletion. The antigen cassette can include an antigen against which a primed immune response is desired.

    [0363] In another aspect, provided herein is a mammalian cell infected with a chimpanzee adenovirus such as C68.

    [0364] In still a further aspect, a novel mammalian cell line is provided which expresses a chimpanzee adenovirus gene (e.g., from C68) or functional fragment thereof.

    [0365] In still a further aspect, provided herein is a method for delivering an antigen cassette into a mammalian cell comprising the step of introducing into the cell an effective amount of a chimpanzee adenovirus, such as C68, that has been engineered to express the antigen cassette.

    [0366] Still another aspect provides a method for stimulating an immune response in a mammalian host to treat cancer. The method can comprise the step of administering to the host an effective amount of a recombinant chimpanzee adenovirus, such as C68, comprising an antigen cassette that encodes one or more antigens from the tumor against which the immune response is targeted.

    [0367] Still another aspect provides a method for stimulating an immune response in a mammalian host to treat or prevent a disease in a subject, such as cancer. The method can comprise the step of administering to the host an effective amount of a recombinant chimpanzee adenovirus, such as C68, comprising an antigen cassette that encodes one or more antigens, such as from the cancer/tumor against which the immune response is targeted.

    [0368] Also disclosed is a non-simian mammalian cell that expresses a chimpanzee adenovirus gene obtained from the sequence of SEQ ID NO: 1. The gene can be selected from the group consisting of the adenovirus E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 of SEQ ID NO: 1.

    [0369] Also disclosed is a nucleic acid molecule comprising a chimpanzee adenovirus DNA sequence comprising a gene obtained from the sequence of SEQ ID NO: 1. The gene can be selected from the group consisting of said chimpanzee adenovirus E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 genes of SEQ ID NO: 1. In some aspects the nucleic acid molecule comprises SEQ ID NO: 1. In some aspects the nucleic acid molecule comprises the sequence of SEQ ID NO: 1, lacking at least one gene selected from the group consisting of E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 genes of SEQ ID NO: 1.

    [0370] Also disclosed is a vector comprising a chimpanzee adenovirus DNA sequence obtained from SEQ ID NO: 1 and an antigen cassette operatively linked to one or more regulatory sequences which direct expression of the cassette in a heterologous host cell, optionally wherein the chimpanzee adenovirus DNA sequence comprises at least the cis-elements necessary for replication and virion encapsidation, the cis-elements flanking the antigen cassette and regulatory sequences. In some aspects, the chimpanzee adenovirus DNA sequence comprises a gene selected from the group consisting of E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 gene sequences of SEQ ID NO: 1. In some aspects the vector can lack the E1A and/or E1B gene.

    [0371] Also disclosed herein is a adenovirus vector comprising: a partially deleted E4 gene comprising a deleted or partially-deleted E4orf2 region and a deleted or partially-deleted E4orf3 region, and optionally a deleted or partially-deleted E4orf4 region. The partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of nucleotides 34,916 to 34,942 of the sequence shown in SEQ ID NO:1, at least a partial deletion of nucleotides 34,952 to 35,305 of the sequence shown in SEQ ID NO:1, and at least a partial deletion of nucleotides 35,302 to 35,642 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1 The partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,980 to 36,516 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1. The partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,979 to 35,642 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf2, a fully deleted E4Orf3, and at least a partial deletion of E4Orf4. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf2, at least a partial deletion of E4Orf3, and at least a partial deletion of E4Orf4. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf1, a fully deleted E4Orf2, and at least a partial deletion of E4Orf3. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf2 and at least a partial deletion of E4Orf3. The partially deleted E4 can comprise an E4 deletion between the start site of E4Orf1 to the start site of E4Orf5. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf1. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf2. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf3. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf4. The E4 deletion can be at least 50, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, at least 1200, at least 1300, at least 1400, at least 1500, at least 1600, at least 1700, at least 1800, at least 1900, or at least 2000 nucleotides. The E4 deletion can be at least 700 nucleotides. The E4 deletion can be at least 1500 nucleotides. The E4 deletion can be 50 or less, 100 or less, 200 or less, 300 or less, 400 or less, 500 or less, 600 or less, 700 or less, 800 or less, 900 or less, 1000 or less, 1100 or less, 1200 or less, 1300 or less, 1400 or less, 1500 or less, 1600 or less, 1700 or less, 1800 or less, 1900 or less, or 2000 or less nucleotides. The E4 deletion can be 750 nucleotides or less. The E4 deletion can be at least 1550 nucleotides or less.

    [0372] A partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 that lacks at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1. A partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 that lacks the E4 gene sequence shown in SEQ ID NO:1 and that lacks at least nucleotides 34,916 to 34,942, nucleotides 34,952 to 35,305 of the sequence shown in SEQ ID NO:1, and nucleotides 35,302 to 35,642 of the sequence shown in SEQ ID NO:1. A partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 and that lacks at least nucleotides 34,980 to 36,516 of the sequence shown in SEQ ID NO:1. A partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 and that lacks at least nucleotides 34,979 to 35,642 of the sequence shown in SEQ ID NO:1. The adenovirus vector having A partially deleted E4 gene can have a cassette, wherein the cassette comprises at least one payload nucleic acid sequence, and wherein the cassette comprises at least one promoter sequence operably linked to the at least one payload nucleic acid sequence. The adenovirus vector having A partially deleted E4 gene can have one or more genes or regulatory sequences of the ChAdV68 sequence shown in SEQ ID NO: 1, optionally wherein the one or more genes or regulatory sequences comprise at least one of the chimpanzee adenovirus inverted terminal repeat (ITR), E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4, and L5 genes of the sequence shown in SEQ ID NO: 1. The adenovirus vector having A partially deleted E4 gene can have nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO:1, wherein A partially deleted E4 gene is 3 of the nucleotides 2 to 34,915, and optionally the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and/or lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion. The adenovirus vector having A partially deleted E4 gene can have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO:1, and wherein A partially deleted E4 gene is 5 of the nucleotides 35,643 to 36,518. The adenovirus vector having A partially deleted E4 gene can have nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO:1, wherein A partially deleted E4 gene is 3 of the nucleotides 2 to 34,915, the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion. The adenovirus vector having A partially deleted E4 gene can have nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO:1, wherein A partially deleted E4 gene is 3 of the nucleotides 2 to 34,915, the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion, and have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO:1, and wherein A partially deleted E4 gene is 5 of the nucleotides 35,643 to 36,518.

    [0373] A partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 that lacks at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1, nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO:1, wherein A partially deleted E4 gene is 3 of the nucleotides 2 to 34,915, the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion, and have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO:1, and wherein A partially deleted E4 gene is 5 of the nucleotides 35,643 to 36,518.

    [0374] Also disclosed herein is a host cell transfected with a vector disclosed herein such as a C68 vector engineered to expression an antigen cassette. Also disclosed herein is a human cell that expresses a selected gene introduced therein through introduction of a vector disclosed herein into the cell.

    [0375] Also disclosed herein is a method for delivering an antigen cassette to a mammalian cell comprising introducing into said cell an effective amount of a vector disclosed herein, such as a ChAd vector or self-amplifying RNA vector engineered to express an antigen cassette.

    [0376] Also disclosed herein is a method for producing an antigen comprising introducing a vector disclosed herein into a mammalian cell, culturing the cell under suitable conditions and producing the antigen.

    V.E.2. E1-Expressing Complementation Cell Lines

    [0377] To generate recombinant chimpanzee adenoviruses (Ad) deleted in any of the genes described herein, the function of the deleted gene region, if essential to the replication and infectivity of the virus, can be supplied to the recombinant virus by a helper virus or cell line, i.e., a complementation or packaging cell line. For example, to generate a replication-defective chimpanzee adenovirus vector, a cell line can be used which expresses the E1 gene products of the human or chimpanzee adenovirus; such a cell line can include HEK293 or variants thereof. The protocol for the generation of the cell lines expressing the chimpanzee E1 gene products (Examples 3 and 4 of U.S. Pat. No. 6,083,716) can be followed to generate a cell line which expresses any selected chimpanzee adenovirus gene.

    [0378] An AAV augmentation assay can be used to identify a chimpanzee adenovirus E1-expressing cell line. This assay is useful to identify E1 function in cell lines made by using the E1 genes of other uncharacterized adenoviruses, e.g., from other species. That assay is described in Example 4B of U.S. Pat. No. 6,083,716.

    [0379] A selected chimpanzee adenovirus gene, e.g., E1, can be under the transcriptional control of a promoter for expression in a selected parent cell line. Inducible or constitutive promoters can be employed for this purpose. Among inducible promoters are included the sheep metallothionine promoter, inducible by zinc, or the mouse mammary tumor virus (MMTV) promoter, inducible by a glucocorticoid, particularly, dexamethasone. Other inducible promoters, such as those identified in International patent application WO95/13392, incorporated by reference herein can also be used in the production of packaging cell lines. Constitutive promoters in control of the expression of the chimpanzee adenovirus gene can be employed also.

    [0380] A parent cell can be selected for the generation of a novel cell line expressing any desired C68 gene. Without limitation, such a parent cell line can be HeLa [ATCC Accession No. CCL 2], A549 [ATCC Accession No. CCL 185], KB [CCL 17], Detroit [e.g., Detroit 510, CCL 72] and WI-38 [CCL 75] cells. Other suitable parent cell lines can be obtained from other sources. Parent cell lines can include CHO, HEK293 or variants thereof, 911, HeLa, A549, LP-293, PER.C6, or AE1-2a.

    [0381] An E1-expressing cell line can be useful in the generation of recombinant chimpanzee adenovirus E1 deleted vectors. Cell lines constructed using essentially the same procedures that express one or more other chimpanzee adenoviral gene products are useful in the generation of recombinant chimpanzee adenovirus vectors deleted in the genes that encode those products. Further, cell lines which express other human Ad E1 gene products are also useful in generating chimpanzee recombinant Ads.

    V.E.3. Recombinant Viral Particles as Vectors

    [0382] The compositions disclosed herein can comprise viral vectors, that deliver at least one antigen to cells. Such vectors comprise a chimpanzee adenovirus DNA sequence such as C68 and an antigen cassette operatively linked to regulatory sequences which direct expression of the cassette. The C68 vector is capable of expressing the cassette in an infected mammalian cell. The C68 vector can be functionally deleted in one or more viral genes. An antigen cassette comprises at least one antigen under the control of one or more regulatory sequences such as a promoter. Optional helper viruses and/or packaging cell lines can supply to the chimpanzee viral vector any necessary products of deleted adenoviral genes.

    [0383] The term functionally deleted means that a sufficient amount of the gene region is removed or otherwise altered, e.g., by mutation or modification, so that the gene region is no longer capable of producing one or more functional products of gene expression. Mutations or modifications that can result in functional deletions include, but are not limited to, nonsense mutations such as introduction of premature stop codons and removal of canonical and non-canonical start codons, mutations that alter mRNA splicing or other transcriptional processing, or combinations thereof. If desired, the entire gene region can be removed.

    [0384] Modifications of the nucleic acid sequences forming the vectors disclosed herein, including sequence deletions, insertions, and other mutations may be generated using standard molecular biological techniques and are within the scope of this invention.

    V.E.4. Construction of the Viral Plasmid Vector

    [0385] The chimpanzee adenovirus C68 vectors useful in this invention include recombinant, defective adenoviruses, that is, chimpanzee adenovirus sequences functionally deleted in the Ela or E1b genes, and optionally bearing other mutations, e.g., temperature-sensitive mutations or deletions in other genes. It is anticipated that these chimpanzee sequences are also useful in forming hybrid vectors from other adenovirus and/or adeno-associated virus sequences. Homologous adenovirus vectors prepared from human adenoviruses are described in the published literature [see, for example, Kozarsky I and II, cited above, and references cited therein, U.S. Pat. No. 5,240,846].

    [0386] In the construction of useful chimpanzee adenovirus C68 vectors for delivery of an antigen cassette to a human (or other mammalian) cell, a range of adenovirus nucleic acid sequences can be employed in the vectors. A vector comprising minimal chimpanzee C68 adenovirus sequences can be used in conjunction with a helper virus to produce an infectious recombinant virus particle. The helper virus provides essential gene products required for viral infectivity and propagation of the minimal chimpanzee adenoviral vector. When only one or more selected deletions of chimpanzee adenovirus genes are made in an otherwise functional viral vector, the deleted gene products can be supplied in the viral vector production process by propagating the virus in a selected packaging cell line that provides the deleted gene functions in trans.

    V.E.5. Recombinant Minimal Adenovirus

    [0387] A minimal chimpanzee Ad C68 virus is a viral particle containing just the adenovirus cis-elements necessary for replication and virion encapsidation. That is, the vector contains the cis-acting 5 and 3 inverted terminal repeat (ITR) sequences of the adenoviruses (which function as origins of replication) and the native 5 packaging/enhancer domains (that contain sequences necessary for packaging linear Ad genomes and enhancer elements for the E1 promoter). See, for example, the techniques described for preparation of a minimal human Ad vector in International Patent Application WO96/13597 and incorporated herein by reference.

    V.E.6. Other Defective Adenoviruses

    [0388] Recombinant, replication-deficient adenoviruses can also contain more than the minimal chimpanzee adenovirus sequences. These other Ad vectors can be characterized by deletions of various portions of gene regions of the virus, and infectious virus particles formed by the optional use of helper viruses and/or packaging cell lines.

    [0389] As one example, suitable vectors may be formed by deleting all or a sufficient portion of the C68 adenoviral immediate early gene Ela and delayed early gene E1b, so as to eliminate their normal biological functions. Replication-defective E1-deleted viruses are capable of replicating and producing infectious virus when grown on a chimpanzee adenovirus-transformed, complementation cell line containing functional adenovirus Ela and E1b genes which provide the corresponding gene products in trans. Based on the homologies to known adenovirus sequences, it is anticipated that, as is true for the human recombinant E1-deleted adenoviruses of the art, the resulting recombinant chimpanzee adenovirus is capable of infecting many cell types and can express antigen(s), but cannot replicate in most cells that do not carry the chimpanzee E1 region DNA unless the cell is infected at a very high multiplicity of infection.

    [0390] As another example, all or a portion of the C68 adenovirus delayed early gene E3 can be eliminated from the chimpanzee adenovirus sequence which forms a part of the recombinant virus.

    [0391] Chimpanzee adenovirus C68 vectors can also be constructed having a deletion of the E4 gene. Still another vector can contain a deletion in the delayed early gene E2a.

    [0392] Deletions can also be made in any of the late genes L1 through L5 of the chimpanzee C68 adenovirus genome. Similarly, deletions in the intermediate genes IX and IVa2 can be useful for some purposes. Other deletions may be made in the other structural or non-structural adenovirus genes.

    [0393] The above discussed deletions can be used individually, i.e., an adenovirus sequence can contain deletions of E1 only. Alternatively, deletions of entire genes or portions thereof effective to destroy or reduce their biological activity can be used in any combination. For example, in one exemplary vector, the adenovirus C68 sequence can have deletions of the E1 genes and the E4 gene, or of the E1, E2a and E3 genes, or of the E1 and E3 genes, or of E1, E2a and E4 genes, with or without deletion of E3, and so on. As discussed above, such deletions can be used in combination with other mutations, such as temperature-sensitive mutations, to achieve a desired result.

    [0394] The cassette comprising antigen(s) be inserted optionally into any deleted region of the chimpanzee C68 Ad virus. Alternatively, the cassette can be inserted into an existing gene region to disrupt the function of that region, if desired.

    V.E.7. Helper Viruses

    [0395] Depending upon the chimpanzee adenovirus gene content of the viral vectors employed to carry the antigen cassette, a helper adenovirus or non-replicating virus fragment can be used to provide sufficient chimpanzee adenovirus gene sequences to produce an infective recombinant viral particle containing the cassette.

    [0396] Useful helper viruses contain selected adenovirus gene sequences not present in the adenovirus vector construct and/or not expressed by the packaging cell line in which the vector is transfected. A helper virus can be replication-defective and contain a variety of adenovirus genes in addition to the sequences described above. The helper virus can be used in combination with the E1-expressing cell lines described herein.

    [0397] For C68, the helper virus can be a fragment formed by clipping the C terminal end of the C68 genome with SspI, which removes about 1300 bp from the left end of the virus. This clipped virus is then co-transfected into an E1-expressing cell line with the plasmid DNA, thereby forming the recombinant virus by homologous recombination with the C68 sequences in the plasmid.

    [0398] Helper viruses can also be formed into poly-cation conjugates as described in Wu et al, J. Biol. Chem., 264:16985-16987 (1989); K. J. Fisher and J. M. Wilson, Biochem. J., 299:49 (Apr. 1, 1994). Helper virus can optionally contain a reporter gene. A number of such reporter genes are known to the art. The presence of a reporter gene on the helper virus which is different from the antigen cassette on the adenovirus vector allows both the Ad vector and the helper virus to be independently monitored. This second reporter is used to enable separation between the resulting recombinant virus and the helper virus upon purification.

    V.E.8. Assembly of Viral Particle and Infection of a Cell Line

    [0399] Assembly of the selected DNA sequences of the adenovirus, the antigen cassette, and other vector elements into various intermediate plasmids and shuttle vectors, and the use of the plasmids and vectors to produce a recombinant viral particle can all be achieved using conventional techniques. Such techniques include conventional cloning techniques of cDNA, in vitro recombination techniques (e.g., Gibson assembly), use of overlapping oligonucleotide sequences of the adenovirus genomes, polymerase chain reaction, and any suitable method which provides the desired nucleotide sequence. Standard transfection and co-transfection techniques are employed, e.g., CaPO4 precipitation techniques or liposome-mediated transfection methods such as lipofectamine. Other conventional methods employed include homologous recombination of the viral genomes, plaquing of viruses in agar overlay, methods of measuring signal generation, and the like.

    [0400] For example, following the construction and assembly of the desired antigen cassette-containing viral vector, the vector can be transfected in vitro in the presence of a helper virus into the packaging cell line. Homologous recombination occurs between the helper and the vector sequences, which permits the adenovirus-antigen sequences in the vector to be replicated and packaged into virion capsids, resulting in the recombinant viral vector particles.

    [0401] The resulting recombinant chimpanzee C68 adenoviruses are useful in transferring an antigen cassette to a selected cell. In in vivo experiments with the recombinant virus grown in the packaging cell lines, the E1-deleted recombinant chimpanzee adenovirus demonstrates utility in transferring a cassette to a non-chimpanzee, preferably a human, cell.

    V.E.9. Use of the Recombinant Virus Vectors

    [0402] The resulting recombinant chimpanzee C68 adenovirus containing the antigen cassette (produced by cooperation of the adenovirus vector and helper virus or adenoviral vector and packaging cell line, as described above) thus provides an efficient gene transfer vehicle which can deliver antigen(s) to a subject in vivo or ex vivo.

    [0403] The above-described recombinant vectors are administered to humans according to published methods for gene therapy. A chimpanzee viral vector bearing an antigen cassette can be administered to a patient, preferably suspended in a biologically compatible solution or pharmaceutically acceptable delivery vehicle. A suitable vehicle includes sterile saline. Other aqueous and non-aqueous isotonic sterile injection solutions and aqueous and non-aqueous sterile suspensions known to be pharmaceutically acceptable carriers and well known to those of skill in the art may be employed for this purpose.

    [0404] The chimpanzee adenoviral vectors are administered in sufficient amounts to transduce the human cells and to provide sufficient levels of antigen transfer and expression to provide a therapeutic benefit without undue adverse or with medically acceptable physiological effects, which can be determined by those skilled in the medical arts. Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, direct delivery to the liver, intranasal, intravenous, intramuscular, subcutaneous, intradermal, oral and other parental routes of administration. Routes of administration may be combined, if desired.

    [0405] Dosages of the viral vector will depend primarily on factors such as the condition being treated, the age, weight and health of the patient, and may thus vary among patients. The dosage will be adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed. The levels of expression of antigen(s) can be monitored to determine the frequency of dosage administration.

    [0406] Recombinant, replication defective adenoviruses can be administered in a pharmaceutically effective amount, that is, an amount of recombinant adenovirus that is effective in a route of administration to transfect the desired cells and provide sufficient levels of expression of the selected gene to provide a vaccinal benefit, i.e., some measurable level of protective immunity. C68 vectors comprising an antigen cassette can be co-administered with adjuvant. Adjuvant can be separate from the vector (e.g., alum) or encoded within the vector, in particular if the adjuvant is a protein. Adjuvants are well known in the art.

    [0407] Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, intranasal, intramuscular, intratracheal, subcutaneous, intradermal, rectal, oral and other parental routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the immunogen or the disease. For example, in prophylaxis of rabies, the subcutaneous, intratracheal and intranasal routes are preferred. The route of administration primarily will depend on the nature of the disease being treated.

    [0408] The levels of immunity to antigen(s) can be monitored to determine the need, if any, for boosters. Following an assessment of antibody titers in the serum, for example, optional booster immunizations may be desired

    VI. Therapeutic and Manufacturing Methods

    [0409] Also provided is a method of stimulating a tumor specific immune response in a subject, vaccinating against a tumor, treating and/or alleviating a symptom of cancer in a subject by administering to the subject one or more antigens such as a plurality of antigens identified using methods disclosed herein.

    [0410] In some aspects, a subject has been diagnosed with cancer or is at risk of developing cancer. A subject can be a human, dog, cat, horse or any animal in which a tumor specific immune response is desired. A tumor can be any solid tumor such as breast, ovarian, prostate, lung, kidney, gastric, colon, testicular, head and neck, pancreas, brain, melanoma, and other tumors of tissue organs and hematological tumors, such as lymphomas and leukemias, including acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, and B cell lymphomas.

    [0411] An antigen can be administered in an amount sufficient to stimulate a CTL response. An antigen can be administered in an amount sufficient to stimulate a T cell response. An antigen can be administered in an amount sufficient to stimulate a B cell response. An antigen can be administered in an amount sufficient to stimulate both a T cell response and a B cell response

    [0412] An antigen can be administered alone or in combination with other therapeutic agents. Therapeutic agents can include those that target an infectious disease organism, such as an anti-viral or antibiotic agent.

    [0413] In addition, a subject can be further administered an anti-immunosuppressive/immunostimulatory agent such as a checkpoint inhibitor. For example, the subject can be further administered an anti-CTLA antibody or anti-PD-1 or anti-PD-L1. Blockade of CTLA-4 or PD-L1 by antibodies can enhance the immune response to cancerous cells in the patient. In particular, CTLA-4 blockade has been shown effective when following a vaccination protocol.

    [0414] The optimum amount of each antigen to be included in a vaccine composition and the optimum dosing regimen can be determined. For example, an antigen or its variant can be prepared for intravenous (i.v.) injection, sub-cutaneous (s.c.) injection, intradermal (i.d.) injection, intraperitoneal (i.p.) injection, intramuscular (i.m.) injection. Methods of injection include s.c., i.d., i.p., i.m., and i.v. Methods of DNA or RNA injection include i.d., i.m., s.c., i.p. and i.v. Other methods of administration of the vaccine composition are known to those skilled in the art.

    [0415] A vaccine can be compiled so that the selection, number and/or amount of antigens present in the composition is/are tissue, cancer, infectious disease, and/or patient-specific. For instance, the exact selection of peptides can be guided by expression patterns of the parent proteins in a given tissue or guided by mutation or disease status of a patient. The selection can be dependent on the specific type of cancer, the status of the disease, the goal of the vaccination (e.g., preventative or targeting an ongoing disease), earlier treatment regimens, the immune status of the patient, and, of course, the HLA-haplotype of the patient. Furthermore, a vaccine can contain individualized components, according to personal needs of the particular patient. Examples include varying the selection of antigens according to the expression of the antigen in the particular patient or adjustments for secondary treatments following a first round or scheme of treatment.

    [0416] A patient can be identified for administration of an antigen vaccine through the use of various diagnostic methods, e.g., patient selection methods described further below. Patient selection can involve identifying mutations in, or expression patterns of, one or more genes. In some cases, patient selection involves identifying the haplotype of the patient. The various patient selection methods can be performed in parallel, e.g., a sequencing diagnostic can identify both the mutations and the haplotype of a patient. The various patient selection methods can be performed sequentially, e.g., one diagnostic test identifies the mutations and separate diagnostic test identifies the haplotype of a patient, and where each test can be the same (e.g., both high-throughput sequencing) or different (e.g., one high-throughput sequencing and the other Sanger sequencing) diagnostic methods.

    [0417] For a composition to be used as a vaccine for cancer or an infectious disease, antigens with similar normal self-peptides that are expressed in high amounts in normal tissues can be avoided or be present in low amounts in a composition described herein. On the other hand, if it is known that the tumor or infected cell of a patient expresses high amounts of a certain antigen, the respective pharmaceutical composition for treatment of this cancer or infection can be present in high amounts and/or more than one antigen specific for this particularly antigen or pathway of this antigen can be included.

    [0418] Compositions comprising an antigen can be administered to an individual already suffering from cancer. In therapeutic applications, compositions are administered to a subject in an amount sufficient to stimulate an immune response, such as stimulating an effective CTL response to the tumor antigen and to cure or at least partially arrest symptoms and/or complications. An immune response can include a reduction in tumor size or volume. Reduction in tumor size or volume can include at least a 5%, at least a 10%, at least a 15%, at least a 20%, at least a 25%, at least a 30%, at least a 35%, at least a 40%, at least a 45%, at least a 50%, at least a 55%, at least a 60%, at least a 65%, at least a 70%, at least a 75%, at least a 80%, at least a 85%, at least a 90%, or at least a 95% reduction. Reduction in tumor size or volume can include at least a 15% reduction. Reduction in tumor size or volume can include at least a 20% reduction. An immune response can include stabilization of tumor size or volume. An immune response can result in amelioration of a subject's disease, such a complete response (CR), partial response (PR), or stable disease (SD) (e.g., as assessed by criteria set forth in a clinical study). An amount adequate to accomplish this is defined as a therapeutically effective dose. Amounts effective for this use will depend on, e.g., the composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. It should be kept in mind that compositions can generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations, especially when the cancer has metastasized. In such cases, in view of the minimization of extraneous substances and the relative nontoxic nature of an antigen, it is possible and can be felt desirable by the treating physician to administer substantial excesses of these compositions.

    [0419] For therapeutic use, administration can begin at the detection or surgical removal of tumors. This can be followed by boosting doses until at least symptoms are substantially abated and for a period thereafter, or immunity is considered to be provided (e.g., a memory B cell or T cell population, or antigen specific B cells or antibodies are produced).

    [0420] Compositions comprising an antigen can be administered as an adjuvant therapy or maintenance therapy as a combination therapy with an additional therapy, such as administered in combination with chemotherapy, immune checkpoint inhibitor therapy, radiation therapy, or combinations thereof. Combination therapies can include fluoropyrimidine, bevacizumab, and/or an immune checkpoint inhibitor therapy. Combination therapies can include fluoropyrimidine and bevacizumab. Combination therapies can include fluoropyrimidine, bevacizumab, and an immune checkpoint inhibitor therapy (e.g., an anti-PD-1 or anti-PD-L1 antibody).

    [0421] Immune checkpoint inhibitors can include (1) an anti-PD-1 antibody or an antigen-binding fragment thereof, (2) an anti-PD-L1 antibody or an antigen-binding fragment thereof, and/or (3) an anti-CTLA-4 antibody or an antigen-binding fragment thereof. Immune checkpoint inhibitor therapy can include administration of an anti-CTLA-4 antibody or an antigen-binding fragment thereof only with the priming dose and the first boosting dose. Immune checkpoint inhibitor therapy can include the anti-CTLA-4 antibody ipilimumab. Immune checkpoint inhibitor therapy can include ipilimumab administered at a dose of 30 mg subcutaneously. Immune checkpoint inhibitor therapy can include administration of an anti-PD-L1 antibody or an antigen-binding fragment thereof every 4 weeks (Q4W). Immune checkpoint inhibitor therapy can include the anti-PD-L1 antibody atezolizumab or nivolumab. Atezolizumab can be administered at a dose of 1680 mg intravenously. Nivolumab is administered at a dose of 480 mg intravenously.

    [0422] Immune checkpoint inhibitor therapy can include at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 separate administrations, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 separate administrations on or about every 28 days (or every 4 weeks and/or every month). Immune checkpoint inhibitor therapy can include administration of the anti-PD-L1 antibody or an antigen-binding fragment thereof including at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 administrations, e.g., on or about every 28 days (or every 4 weeks and/or every month). Immune checkpoint inhibitor therapy can include at least 13 separate administrations, e.g., on or about every 28 days (or every 4 weeks and/or every month). In some aspects, the administration of the anti-PD-L1 antibody or an antigen-binding fragment thereof comprises at least 13 administrations, e.g., on or about every 28 days (or every 4 weeks and/or every month).

    [0423] A ChAdV-based expression system can be administered as a boosting dose on or about day 140 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or about week 20 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or about month 5 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or after day 140 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or after week 20 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or after month 5 after the priming dose of the ChAdV-based expression system.

    [0424] A self-replicating alphavirus-based expression system can be administered as at least two boosting doses. A self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 28 days apart. A self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 4 weeks (Q4W) apart. A self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least one month apart. A self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 56 days apart. A self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 8 weeks (Q8W) apart. A self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 2 months apart.

    [0425] A self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about days 28 and 84 after the priming dose of the ChAdV-based expression system. A self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about weeks 4 and 12 after the priming dose of the ChAdV-based expression system. A self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about months 1 and 3 after the priming dose of the ChAdV-based expression system.

    [0426] A self-replicating alphavirus-based expression system can be administered as at least four boosting doses. A self-replicating alphavirus-based expression system can be administered on or about days 28, 84, 196, and 252 relative to the priming dose of the ChAdV-based expression system. A self-replicating alphavirus-based expression system can be administered on or about weeks 4, 12, 28, and 40 relative to the priming dose of the ChAdV-based expression system. A self-replicating alphavirus-based expression system can be administered on or about months 1, 3, 7, and 10 relative to the priming dose of the ChAdV-based expression system.

    [0427] A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 28 days apart. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 4 weeks (Q4W) apart. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least one month apart. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 56 days apart. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 8 weeks (Q8W) apart. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 2 months apart.

    [0428] A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about days 28 and 84 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about weeks 4 and 12 after the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about months 1 and 3 after the priming dose of the ChAdV-based expression system.

    [0429] A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least four boosting doses. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered on or about days 28, 84, 196, and 252 relative to the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered on or about weeks 4, 12, 28, and 40 relative to the priming dose of the ChAdV-based expression system. A ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered on or about months 1, 3, 7, and 10 relative to the priming dose of the ChAdV-based expression system.

    [0430] The pharmaceutical compositions (e.g., vaccine compositions) for therapeutic treatment are intended for parenteral, topical, nasal, oral or local administration. A pharmaceutical compositions can be administered parenterally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly. The compositions can be administered at a site of surgical excision to stimulate a local immune response to a tumor. The compositions can be administered to target specific tissues, organs, and/or cells of a subject. Disclosed herein are compositions for parenteral administration which comprise a solution of the antigen and vaccine compositions are dissolved or suspended in an acceptable carrier, e.g., an aqueous carrier. A variety of aqueous carriers can be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like. These compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered. The resulting aqueous solutions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.

    [0431] Antigens can also be administered via liposomes, which target them to a particular cells tissue, such as lymphoid tissue. Liposomes are also useful in increasing half-life. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations the antigen to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to, e.g., a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions. Thus, liposomes filled with a desired antigen can be directed to the site of lymphoid cells, where the liposomes then deliver the selected therapeutic/immunogenic compositions. Liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9; 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728, 4,501,728, 4,837,028, and 5,019,369.

    [0432] For targeting to the immune cells, a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells. A liposome suspension can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.

    [0433] For therapeutic or immunization purposes, nucleic acids encoding a peptide and optionally one or more of the peptides described herein can also be administered to the patient. A number of methods are conveniently used to deliver the nucleic acids to the patient. For instance, the nucleic acid can be delivered directly, as naked DNA. This approach is described, for instance, in Wolff et al., Science 247: 1465-1468 (1990) as well as U.S. Pat. Nos. 5,580,859 and 5,589,466. The nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of DNA can be administered. Alternatively, DNA can be adhered to particles, such as gold particles. Approaches for delivering nucleic acid sequences can include viral vectors, mRNA vectors, and DNA vectors with or without electroporation.

    [0434] The nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids. Lipid-mediated gene delivery methods are described, for instance, in 9618372WOAWO 96/18372; 9324640WOAWO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682-691 (1988); U.S. Pat. No. 5,279,833 Rose U.S. Pat. Nos. 5,279,833; 9,106,309WOAWO 91/06309; and Felgner et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).

    [0435] Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616-629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev. (2011) 239(1): 45-61, Sakuma et al., Lentiviral vectors: basic to translational, Biochem J. (2012) 443(3):603-18, Cooper et al., Rescue of splicing-mediated intron loss maximizes expression in lentiviral vectors containing the human ubiquitin C promoter, Nucl. Acids Res. (2015) 43 (1): 682-690, Zufferey et al., Self-Inactivating Lentivirus Vector for Safe and Efficient In Vivo Gene Delivery, J. Virol. (1998) 72 (12): 9873-9880). Dependent on the packaging capacity of the above mentioned viral vector-based vaccine platforms, this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides. The sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science. (2016) 352 (6291):1337-41, Lu et al., Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions, Clin Cancer Res. (2014) 20(13):3401-10). Upon introduction into a host, infected cells express the antigens, and thereby stimulate a host immune (e.g., CTL) response against the peptide(s). Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)). A wide variety of other vaccine vectors useful for therapeutic administration or immunization of antigens, e.g., Salmonella typhi vectors, and the like will be apparent to those skilled in the art from the description herein.

    [0436] A means of administering nucleic acids uses minigene constructs encoding one or multiple epitopes. To create a DNA sequence encoding the selected CTL epitopes (minigene) for expression in human cells, the amino acid sequences of the epitopes are reverse translated. A human codon usage table is used to guide the codon choice for each amino acid. These epitope-encoding DNA sequences are directly adjoined, creating a continuous polypeptide sequence. To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design. Examples of amino acid sequence that could be reverse translated and included in the minigene sequence include: helper T lymphocyte, epitopes, a leader (signal) sequence, and an endoplasmic reticulum retention signal. In addition, MHC presentation of CTL epitopes can be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL epitopes. The minigene sequence is converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) are synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides are joined using T4 DNA ligase. This synthetic minigene, encoding the CTL epitope polypeptide, can then cloned into a desired expression vector.

    [0437] Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). A variety of methods have been described, and new techniques can become available. As noted above, nucleic acids are conveniently formulated with cationic lipids. In addition, glycolipids, fusogenic liposomes, peptides and compounds referred to collectively as protective, interactive, non-condensing (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.

    [0438] Also disclosed is a method of manufacturing a vaccine, comprising performing the steps of a method disclosed herein; and producing a vaccine comprising a plurality of antigens or a subset of the plurality of antigens.

    [0439] Antigens disclosed herein can be manufactured using methods known in the art. For example, a method of producing an antigen or a vector (e.g., a vector including at least one sequence encoding one or more antigens) disclosed herein can include culturing a host cell under conditions suitable for expressing the antigen or vector wherein the host cell comprises at least one polynucleotide encoding the antigen or vector, and purifying the antigen or vector. Standard purification methods include chromatographic techniques, electrophoretic, immunological, precipitation, dialysis, filtration, concentration, and chromatofocusing techniques.

    [0440] Host cells can include a Chinese Hamster Ovary (CHO) cell, NSO cell, yeast, or a HEK293 cell. Host cells can be transformed with one or more polynucleotides comprising at least one nucleic acid sequence that encodes an antigen or vector disclosed herein, optionally wherein the isolated polynucleotide further comprises a promoter sequence operably linked to the at least one nucleic acid sequence that encodes the antigen or vector. In certain embodiments the isolated polynucleotide can be cDNA.

    VII. Antigen Use and Administration

    [0441] A vaccination protocol can be used to dose a subject with one or more antigens. A priming vaccine and a boosting vaccine can be used to dose the subject. Vaccination methods, protocols, and schedules that can be used include, but are not limited to, those described in international application publication WO2021092095, herein incorporated by reference for all purposes.

    [0442] A priming vaccine, can be based on C68 (e.g., the sequences shown in SEQ ID NO:1 or 2) or samRNA (e.g., the sequences shown in SEQ ID NO:3 or 4). A boosting vaccine can also be based on C68 (e.g., the sequences shown in SEQ ID NO:1 or 2) or samRNA (e.g., the sequences shown in SEQ ID NO:3 or 4).

    [0443] Each vector in a prime/boost strategy typically includes a cassette that includes antigens. Cassettes can include about 1-50 antigens, separated by spacers such as the natural sequence that normally surrounds each antigen or other non-natural spacer sequences such as AAY. Cassettes can also include MHCII antigens such a tetanus toxoid antigen and PADRE antigen, which can be considered universal class II antigens. Cassettes can also include a targeting sequence such as a ubiquitin targeting sequence. In addition, each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) an immune modulator. Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a checkpoint inhibitor (CPI). CPI's can include those that inhibit CTLA4, PD1, and/or PDL1 such as antibodies or antigen-binding portions thereof. Such antibodies can include atezolizumab, ipilimumab, nivolumamb, cemiplimab, tremelimumab or durvalumab. Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a cytokine, such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL-15, or IL-21. Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a modified cytokine (e.g., pegIL-2).

    [0444] A priming vaccine can be injected (e.g., intramuscularly) in a subject. Bilateral injections per dose can be used. For example, one or more injections of ChAdV68 (C68) can be used (e.g., total dose 1?10.sup.12 viral particles); one or more injections of SAM vectors at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used; or one or more injections of SAM vectors at high vaccine dose selected from the range 1 to 100 ug RNA, in particular 10 or 100 ug can be used.

    [0445] A vaccine boost (boosting vaccine) can be injected (e.g., intramuscularly) after prime vaccination. A boosting vaccine can be administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks, e.g., every 4 weeks and/or 8 weeks after the prime. Bilateral injections per dose can be used. For example, one or more injections of ChAdV68 (C68) can be used (e.g., total dose 1?10.sup.12 viral particles); one or more injections of SAM vectors at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used; or one or more injections of SAM vectors at high vaccine dose selected from the range 1 to 100 ug RNA, in particular 10 or 100 ug can be used.

    [0446] Anti-CTLA-4 (e.g., tremelimumab) can also be administered to the subject. For example, anti-CTLA4 can be administered subcutaneously near the site of the intramuscular vaccine injection (ChAdV68 prime or samRNA low doses) to ensure drainage into the same lymph node. Tremelimumab is a selective human IgG2 mAb inhibitor of CTLA-4. Target Anti-CTLA-4 (tremelimumab) subcutaneous dose is typically 70-75 mg (in particular 75 mg) with a dose range of, e.g., 1-100 mg or 5-420 mg.

    [0447] In certain instances an anti-PD-L1 antibody can be used such as durvalumab (MEDI 4736). Durvalumab is a selective, high affinity human IgG1 mAb that blocks PD-L1 binding to PD-1 and CD80. Durvalumab is generally administered at 20 mg/kg i.v. every 4 weeks.

    [0448] Immune monitoring can be performed before, during, and/or after vaccine administration. Such monitoring can inform safety and efficacy, among other parameters.

    [0449] To perform immune monitoring, PBMCs are commonly used. PBMCs can be isolated before prime vaccination, and after prime vaccination (e.g. 4 weeks and 8 weeks). PBMCs can be harvested just prior to boost vaccinations and after each boost vaccination (e.g. 4 weeks and 8 weeks).

    [0450] Immune responses, such as T cell responses and B cell responses, can be assessed as part of an immune monitoring protocol. For example, the ability of a vaccine composition described herein to stimulate an immune response can be monitored and/or assessed. As used herein, stimulate an immune response refers to any increase in a immune response, such as initiating an immune response (e.g., a priming vaccine stimulating the initiation of an immune response in a na?ve subject) or enhancement of an immune response (e.g., a boosting vaccine stimulating the enhancement of an immune response in a subject having a pre-existing immune response to an antigen, such as a pre-existing immune response initiated by a priming vaccine). T cell responses can be measured using one or more methods known in the art such as ELISpot, intracellular cytokine staining, cytokine secretion and cell surface capture, T cell proliferation, MHC multimer staining, or by cytotoxicity assay. T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines, such as IFN-gamma, using an ELISpot assay. Specific CD4 or CD8 T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines captured intracellularly or extracellularly, such as IFN-gamma, using flow cytometry. Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring T cell populations expressing T cell receptors specific for epitope/MHC class I complexes using MHC multimer staining. Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring the ex vivo expansion of T cell populations following 3H-thymidine, bromodeoxyuridine and carboxyfluoresceine-diacetate-succinimidylester (CFSE) incorporation. The antigen recognition capacity and lytic activity of PBMC-derived T cells that are specific for epitopes encoded in vaccines can be assessed functionally by chromium release assay or alternative colorimetric cytotoxicity assays.

    [0451] B cell responses can be measured using one or more methods known in the art such as assays used to determine B cell differentiation (e.g., differentiation into plasma cells), B cell or plasma cell proliferation, B cell or plasma cell activation (e.g., upregulation of costimulatory markers such as CD80 or CD86), antibody class switching, and/or antibody production (e.g., an ELISA). Antibodies can also be assessed for function, such as assessed for neutralizing ability.

    [0452] Disease status of a subject can be monitored following administration of any of the vaccine compositions described herein. For example, disease status may be monitored using isolated cell-free DNA (cfDNA) from a subject (also referred to as circulating tumor DNA ctDNA). In addition, the efficacy of a vaccine therapy may be monitored using isolated cfDNA from a subject. cfDNA monitoring can include the steps of: a. isolating or having isolated cfDNA from a subject; b. sequencing or having sequenced the isolated cfDNA; c. determining or having determined a frequency of one or more mutations in the cfDNA relative to a wild-type germline nucleic acid sequence of the subject, and d. assessing or having assessed from step (c) the status of a disease in the subject. The method can also include, following step (c) above, d. performing more than one iteration of steps (a)-(c) for the given subject and comparing the frequency of the one or more mutations determined in the more than one iterations; and f. assessing or having assessed from step (d) the status of a disease in the subject. The more than one iterations can be performed at different time points, such as a first iteration of steps (a)-(c) performed prior to administration of the vaccine composition and a second iteration of steps (a)-(c) is performed subsequent to administration of the vaccine composition. Step (c) can include comparing: the frequency of the one or more mutations determined in the more than one iterations, or the frequency of the one or more mutations determined in the first iteration to the frequency of the one or more mutations determined in the second iteration. An increase in the frequency of the one or more mutations determined in subsequent iterations or the second iteration can be assessed as disease progression. A decrease in the frequency of the one or more mutations determined in subsequent iterations or the second iteration can be assessed as a response. In some aspects, the response is a Complete Response (CR) or a Partial Response (PR). A therapy can be administered to a subject following an assessment step, such as where assessment of the frequency of the one or more mutations in the cfDNA indicates the subject has the disease. The cfDNA isolation step can use centrifugation to separate cfDNA from cells or cellular debris. cfDNA can be isolated from whole blood, such as by separating the plasma layer, buffy coat, and red bloods. cfDNA sequencing can use next generation sequencing (NGS), Sanger sequencing, duplex sequencing, whole-exome sequencing, whole-genome sequencing, de novo sequencing, phased sequencing, targeted amplicon sequencing, shotgun sequencing, or combinations thereof, and may include enriching the cfDNA for one or more polynucleotide regions of interest prior to sequencing (e.g., polynucleotides known or suspected to encode the one or more mutations, coding regions, and/or tumor exome polynucleotides). Enriching the cfDNA may include hybridizing one or more polynucleotide probes, which may be modified (e.g., biotinylated), to the one or more polynucleotide regions of interest. In general, any number of mutations may be monitored simultaneously or in parallel.

    [0453] Response to treatment (i.e., therapeutic response) may be determined by radiological assessment and/or a molecular response by monitoring neoantigen ctDNA (e.g., variant allele frequency VAF) as described, for example, in Zhang et al. Cancer Discov. 2020; 10:1842-1853, Parikh et al. Clin Cancer Res. 2020; 26:1877-1885, and Vega et al. JCO Precision Oncology 2022; 6:e2100372 or neoantigen mutated haploid genome equivalents (mutated hGE) as described, for example, in Palmer et al. Nat. Med. 2022; 28:1619-1629 and Chabon et al. Nature 2020; 580(7802): 245-251. Molecular response may be defined as a decrease in ctDNA relative to baseline ctDNA, for example a ?20%, ?30%, ?40%, ?50%, ?60%, ?70%, ?80%, ?90%, or ?95% decrease in ctDNA relative to baseline ctDNA. In some embodiments, molecular response is defined as ?30% decrease in ctDNA relative to baseline ctDNA. In some embodiments, molecular response is defined as ?30% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 24 months, by 18 months, by 12 months, or by 6 months of treatment. In some embodiments, molecular response is defined as ?30% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 12 weeks, by 8 weeks, by 4 weeks, or by 2 weeks of treatment. In other embodiments, molecular response is defined as ?50% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 24 months, by 18 months, by 12 months, or by 6 months of treatment. In other embodiments, molecular response is defined as ?50% decrease in ctDNA relative to baseline ctDNA. In some embodiments, molecular response is defined as ?50% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 12 weeks, by 8 weeks, by 4 weeks, or by 2 weeks of treatment. Molecular response may be observed during early on-treatment radiological stable disease (SD) and/or in patients with radiological progressive disease (PD).

    VIII. Antigen Identification

    VIII.A. Antigen Candidate Identification

    [0454] Research methods for NGS analysis of tumor and normal exome and transcriptomes have been described and applied in the antigen identification space. .sup.6, 14, 15 Certain optimizations for greater sensitivity and specificity for antigen identification in the clinical setting can be considered. These optimizations can be grouped into two areas, those related to laboratory processes and those related to the NGS data analysis. Examples of optimizations are known to those skilled in the art, for example the methods described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.

    VIII.B. Isolation and Detection of HLA Peptides

    [0455] Isolation of HLA-peptide molecules was performed using classic immunoprecipitation (IP) methods after lysis and solubilization of the tissue sample (55-58). A clarified lysate was used for HLA specific IP.

    [0456] Immunoprecipitation was performed using antibodies coupled to beads where the antibody is specific for HLA molecules. For a pan-Class I HLA immunoprecipitation, a pan-Class I CR antibody is used, for Class II HLA-DR, an HLA-DR antibody is used. Antibody is covalently attached to NHS-sepharose beads during overnight incubation. After covalent attachment, the beads were washed and aliquoted for IP. (59, 60) Immunoprecipitations can also be performed with antibodies that are not covalently attached to beads. Typically this is done using sepharose.sup.122 or magnetic beads coated with Protein A and/or Protein G to hold the antibody to the column. Some antibodies that can be used to selectively enrich MHC/peptide complex are listed below.

    TABLE-US-00002 Antibody Name Specificity W6/32 Class I HLA-A, B, C L243 Class II - HLA-DR Tu36 Class II - HLA-DR LN3 Class II - HLA-DR Tu39 Class II - HLA-DR, DP, DQ SPVL3 Class II - HLA - DQ B7/21 Class II - HLA - DP

    [0457] The clarified tissue lysate is added to the antibody beads for the immunoprecipitation. After immunoprecipitation, the beads are removed from the lysate and the lysate stored for additional experiments, including additional IPs. The IP beads are washed to remove non-specific binding and the HLA/peptide complex is eluted from the beads using standard techniques. The protein components are removed from the peptides using a molecular weight spin column or C18 fractionation. The resultant peptides are taken to dryness by SpeedVac evaporation and in some instances are stored at ?20C prior to MS analysis. HLA IPs can also be performed in 96well plate format using plates that contain filter bottoms. Use of the plates allows for multiple IPs to be performed in tandem.

    [0458] Dried peptides are reconstituted in an HPLC buffer suitable for reverse phase chromatography and loaded onto a C-18 microcapillary HPLC column for gradient elution in a Fusion Lumos mass spectrometer (Thermo). MS1 spectra of peptide mass/charge (m/z) were collected in the Orbitrap detector at high resolution followed by MS2 low resolution scans collected in the ion trap detector after HCD fragmentation of the selected ion. Additionally, MS2 spectra can be obtained using either CID or ETD fragmentation methods or any combination of the three techniques to attain greater amino acid coverage of the peptide. MS2 spectra can also be measured with high resolution mass accuracy in the Orbitrap detector with targeted method known as parallel reaction monitoring. In targeted PRM, specific peptide precursor ions are isolated in the Orbitrap detector and all resulting HCD fragmentation ions are scanned across the elution of the peptide peak. This enables both peptide identification and quantitation of endogenous peptide in the presence of a co-injected stabile isotopically labeled peptide standard.

    [0459] MS2 spectra from each analysis are searched against a protein database using Comet (61, 62) and the peptide identification are scored using Percolator (63-65). Additional sequencing is performed using PEAKS studio (Bioinformatics Solutions Inc.) and other search engines or sequencing methods can be used including spectral matching and de novo sequencing (97). Targeted MS1 and MS2 spectra can be processed through Skyline (104).

    VIII.B.1. MS Limit of Detection Studies in Support of Comprehensive HLA Peptide Sequencing

    [0460] Using the peptide YVYVADVAAK (SEQ ID NO: 88) it was determined what the limits of detection are using different amounts of peptide loaded onto the LC column. The amounts of peptide tested were 1 pmol, 100 fmol, 10 fmol, 1 fmol, and 100 amol. (Table 1) These results indicate that the lowest limit of detection (LoD) is in the attomol.sup.123 range (10.sup.?18), that the dynamic range spans five orders of magnitude, and that the signal to noise appears sufficient for sequencing at low femtomol.sup.123 ranges (10.sup.?15).

    TABLE-US-00003 TABLE 1 Loaded Copies/Cell Peptide m/z on Column in 1e9cells 566.830 1 pmol 600 562.823 100 fmol 60 559.816 10 fmol 6 556.810 1 fmol 0.6 553.802 100 amol 0.06

    IX. Presentation Model

    [0461] Presentation models can be used to identify likelihoods of peptide presentation in patients. Various presentation models are known to those skilled in the art, for example the presentation models described in more detail in U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1 and US20110293637, and international patent application publications WO/2018/195357, WO/2018/208856, and WO2016187508, each herein incorporated by reference, in their entirety, for all purposes.

    X. Training Module

    [0462] Training modules can be used to construct one or more presentation models based on training data sets that generate likelihoods of whether peptide sequences will be presented by MHC alleles associated with the peptide sequences. Various training modules are known to those skilled in the art, for example the presentation models described in more detail in U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes. A training module can construct a presentation model to predict presentation likelihoods of peptides on a per-allele basis. A training module can also construct a presentation model to predict presentation likelihoods of peptides in a multiple-allele setting where two or more MHC alleles are present.

    XI. Prediction Module

    [0463] A prediction module can be used to receive sequence data and select candidate antigens in the sequence data using a presentation model. Specifically, the sequence data may be DNA sequences, RNA sequences, and/or protein sequences extracted from tumor tissue cells of patients. A prediction module may identify candidate neoantigens that are mutated peptide sequences by comparing sequence data extracted from normal tissue cells of a patient with the sequence data extracted from tumor tissue cells of the patient to identify portions containing one or more mutations. A prediction module may identify candidate antigens that have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue by comparing sequence data extracted from normal tissue cells of a patient with the sequence data extracted from tumor tissue cells of the patient to identify improperly expressed candidate antigens.

    [0464] A presentation module can apply one or more presentation model to processed peptide sequences to estimate presentation likelihoods of the peptide sequences. Specifically, the prediction module may select one or more candidate antigen peptide sequences that are likely to be presented on tumor HLA molecules by applying presentation models to the candidate antigens. In one implementation, the presentation module selects candidate antigen sequences that have estimated presentation likelihoods above a predetermined threshold. In another implementation, the presentation model selects the N candidate antigen sequences that have the highest estimated presentation likelihoods (where N is generally the maximum number of epitopes that can be delivered in a vaccine). A vaccine including the selected candidate antigens for a given patient can be injected into a subject to stimulate immune responses.

    XI.B. Cassette Design Module

    XI.B.1 Overview

    [0465] A cassette design module can be used to generate a vaccine cassette sequence based on selected candidate peptides for injection into a patient. Various cassette design modules are known to those skilled in the art, for example the cassette design modules described in more detail in U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.

    [0466] A set of therapeutic epitopes may be generated based on the selected peptides determined by a prediction module associated with presentation likelihoods above a predetermined threshold, where the presentation likelihoods are determined by the presentation models. However it is appreciated that in other embodiments, the set of therapeutic epitopes may be generated based on any one or more of a number of methods (alone or in combination), for example, based on binding affinity or predicted binding affinity to HLA class I or class II alleles of the patient, binding stability or predicted binding stability to HLA class I or class II alleles of the patient, random sampling, and the like.

    [0467] Therapeutic epitopes may correspond to selected peptides themselves. Therapeutic epitopes may also include C- and/or N-terminal flanking sequences in addition to the selected peptides. N- and C-terminal flanking sequences can be the native N- and C-terminal flanking sequences of the therapeutic vaccine epitope in the context of its source protein. Therapeutic epitopes can represent a fixed-length epitope Therapeutic epitopes can represent a variable-length epitope, in which the length of the epitope can be varied depending on, for example, the length of the C- or N-flanking sequence. For example, the C-terminal flanking sequence and the N-terminal flanking sequence can each have varying lengths of 2-5 residues, resulting in 16 possible choices for the epitope.

    [0468] A cassette design module can also generate cassette sequences by taking into account presentation of junction epitopes that span the junction between a pair of therapeutic epitopes in the cassette. Junction epitopes are novel non-self but irrelevant epitope sequences that arise in the cassette due to the process of concatenating therapeutic epitopes and linker sequences in the cassette. The novel sequences of junction epitopes are different from the therapeutic epitopes of the cassette themselves.

    [0469] A cassette design module can generate a cassette sequence that reduces the likelihood that junction epitopes are presented in the patient. Specifically, when the cassette is injected into the patient, junction epitopes have the potential to be presented by HLA class I or HLA class II alleles of the patient, and stimulate a CD8 or CD4 T-cell response, respectively. Such reactions are often times undesirable because T-cells reactive to the junction epitopes have no therapeutic benefit, and may diminish the immune response to the selected therapeutic epitopes in the cassette by antigenic competition..sup.76

    [0470] A cassette design module can iterate through one or more candidate cassettes, and determine a cassette sequence for which a presentation score of junction epitopes associated with that cassette sequence is below a numerical threshold. The junction epitope presentation score is a quantity associated with presentation likelihoods of the junction epitopes in the cassette, and a higher value of the junction epitope presentation score indicates a higher likelihood that junction epitopes of the cassette will be presented by HLA class I or HLA class II or both.

    [0471] In one embodiment, a cassette design module may determine a cassette sequence associated with the lowest junction epitope presentation score among the candidate cassette sequences.

    [0472] A cassette design module may iterate through one or more candidate cassette sequences, determine the junction epitope presentation score for the candidate cassettes, and identify an optimal cassette sequence associated with a junction epitope presentation score below the threshold.

    [0473] A cassette design module may further check the one or more candidate cassette sequences to identify if any of the junction epitopes in the candidate cassette sequences are self-epitopes for a given patient for whom the vaccine is being designed. To accomplish this, the cassette design module checks the junction epitopes against a known database such as BLAST. In one embodiment, the cassette design module may be configured to design cassettes that avoid junction self-epitopes.

    [0474] A cassette design module can perform a brute force approach and iterate through all or most possible candidate cassette sequences to select the sequence with the smallest junction epitope presentation score. However, the number of such candidate cassettes can be prohibitively large as the capacity of the vaccine increases. For example, for a vaccine capacity of 20 epitopes, the cassette design module has to iterate through ?1018 possible candidate cassettes to determine the cassette with the lowest junction epitope presentation score. This determination may be computationally burdensome (in terms of computational processing resources required), and sometimes intractable, for the cassette design module to complete within a reasonable amount of time to generate the vaccine for the patient. Moreover, accounting for the possible junction epitopes for each candidate cassette can be even more burdensome. Thus, a cassette design module may select a cassette sequence based on ways of iterating through a number of candidate cassette sequences that are significantly smaller than the number of candidate cassette sequences for the brute force approach.

    [0475] A cassette design module can generate a subset of randomly or at least pseudo-randomly generated candidate cassettes, and selects the candidate cassette associated with a junction epitope presentation score below a predetermined threshold as the cassette sequence. Additionally, the cassette design module may select the candidate cassette from the subset with the lowest junction epitope presentation score as the cassette sequence. For example, the cassette design module may generate a subset of ?1 million candidate cassettes for a set of 20 selected epitopes, and select the candidate cassette with the smallest junction epitope presentation score. Although generating a subset of random cassette sequences and selecting a cassette sequence with a low junction epitope presentation score out of the subset may be sub-optimal relative to the brute force approach, it requires significantly less computational resources thereby making its implementation technically feasible. Further, performing the brute force method as opposed to this more efficient technique may only result in a minor or even negligible improvement in junction epitope presentation score, thus making it not worthwhile from a resource allocation perspective. A cassette design module can determine an improved cassette configuration by formulating the epitope sequence for the cassette as an asymmetric traveling salesman problem (TSP). Given a list of nodes and distances between each pair of nodes, the TSP determines a sequence of nodes associated with the shortest total distance to visit each node exactly once and return to the original node. For example, given cities A, B, and C with known distances between each other, the solution of the TSP generates a closed sequence of cities, for which the total distance traveled to visit each city exactly once is the smallest among possible routes. The asymmetric version of the TSP determines the optimal sequence of nodes when the distance between a pair of nodes are asymmetric. For example, the distance for traveling from node A to node B may be different from the distance for traveling from node B to node A. By solving for an improved optimal cassette using an asymmetric TSP, the cassette design module can find a cassette sequence that results in a reduced presentation score across the junctions between epitopes of the cassette. The solution of the asymmetric TSP indicates a sequence of therapeutic epitopes that correspond to the order in which the epitopes should be concatenated in a cassette to minimize the junction epitope presentation score across the junctions of the cassette. A cassette sequence determined through this approach can result in a sequence with significantly less presentation of junction epitopes while potentially requiring significantly less computational resources than the random sampling approach, especially when the number of generated candidate cassette sequences is large. Illustrative examples of different computational approaches and comparisons for optimizing cassette design are described in more detail in U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.

    [0476] An illustrative non-limiting cassette of concatenated KRAS-associated MHC class I neoepitopes that are linked through their native flanking sequences, includes 4 iterations for each of the KRAS neoepitopes having the mutations KRAS G12C, KRAS G12D, KRAS G12V, and KRAS Q61H, and has been ordered to minimize potential junctional epitopes is represented by the amino acid sequence shown in SEQ ID NO: 65 and having the order of KRAS-associated neoepitopes: G12C G12D Q61H G12D G12V G12C Q61H G12D G12V G12C Q61H G12D G12V Q61H G12V G12C.

    [0477] Shared (neo)antigen sequences for inclusion in a shared antigen vaccine and appropriate patients for treatment with such vaccine can be chosen by one of skill in the art, e.g., as described in U.S. application Ser. No. 17/058,128, herein incorporated by reference for all purposes. Mass spectrometry (MS) validation of candidate shared (neo)antigens can performed as part of the selection process.

    XIII. Example Computer

    [0478] A computer can be used for any of the computational methods described herein. One skilled in the art will recognize a computer can have different architectures. Examples of computers are known to those skilled in the art, for example the computers described in more detail U.S. Pat. No. 10,055,540, US Application Pub. No. US20200010849A1, and in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.

    XIV. Examples

    [0479] Below are examples of specific embodiments for carrying out the present invention. The examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for.

    [0480] The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W. H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2.sup.nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18.sup.th Edition (Easton, Pennsylvania: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3.sup.rd Ed. (Plenum Press) Vols A and B(1992).

    XIV.A. Evaluation of Cassettes with Repeated Neoepitopess and/or Removal of Immunodominant Neoepitopes Overview

    [0481] Through vaccination, multiple class I MHC restricted neoantigens that stimulate the corresponding cellular immune response(s) can be delivered. Several vaccine cassettes were engineered to encode multiple neoepitopes, specifically multiple distinct KRAS-associated neoepitopes, as a single gene product where the epitopes were embedded within their natural, surrounding peptide sequence. Various cassettes designs feature multiple copies (i.e., iterations) of one or more neoepitopes. Various cassettes designs also feature removing immunodominant neoepitopes.

    XIV.B. Repeated Neoepitopes and/or Removal of Immunodominant Neoepitopes Evaluation Materials and Methods Antigens

    [0482] The epitope-containing 25 mer amino acid sequences (i.e., epitope flanked by native N and C terminal amino acid linkers) used in the examples below are presented in Table 2A were used as described below. The antigen-encoding sequences of the cassettes for the various constructs were constructed by directly linking each 25 mer sequence to each other (i.e., no additional amino acids in between consecutive 25 mer sequences) in the order and number described in the examples below, e.g., see FIGS. 1A, 2A, 3A, and 4A. The cassettes containing the full-length antigen-encoding sequences containing the multiple distinct epitopes linked together, as well as universal MHC class II antigens tetanus toxoid and PADRE (bolded sequence), are presented in Table 2B. The complete exogenous nucleotide insertions into the vectors include from 5 to 3: a Kozak sequence (GCCACC), nucleotides encoding three amino acids MAG (ATGGCCGGG), one of the cassette sequences of Table 2B, and two stop codons (TAATGA). Further cassettes were generated with 4 iterations of individual KRAS mutations G12V, G12C, and G12D (i.e., separate concatemers of SEQ ID NOs 57, 58, or 59).

    TABLE-US-00004 TABLE2A 25merNeoepitopeContainingSequences SEQ Antigen ID Name 25merSequence NO: KRASG12C MTEYKLVVVGACGVGKSALTIQLIQ 57 KRASG12D MTEYKLVVVGADGVGKSALTIQLIQ 58 KRASG12V MTEYKLVVVGAVGVGKSALTIQLIQ 59 KRASQ61H ETCLLDILDTAGHEEYSAMRDQYMR 60 TP53R213L LRVEYLDDRNTFLHSVVVPYEPPEV 61 TP53S127Y HSGTAKSVTCTYYPALNKMFCQLAK 62

    TABLE-US-00005 TABLE2B Full-LengthMulti-Neoepitope SequencesinCassettes 1X(20x1)Cassette(SEQIDNO:63) MTEYKLVVVGAGDVGKSALTIQLIQETCLLDILDTAGKEE YSAMRDQYMRMCNSSCMGGMNRMPILTIITLEDSSSGIHS GATTTAPPLSGKGNPEEEDVSGIHSGATTTAPFLSGKGNP EEEDVEILDEAYVMAYVMAGVGSPYVSRLLMTEYKLVVVG ADGVGKSALTIQLIQETCLLDILDTAGREEYSAMRDQYMR SYLDSGIHSGATATAPSLSGKGNPEKSVTCTYSPALNNMF CQLAKTCPVQMTEYKLVVVGAAGVGKSALTIQLIQETCLL DILDTAGLEEYSAMRDQYMRLRVEYLDDRNTFLHSVVVPY EPPEVDGQITVGQRIGSVSFGTVYKGKWHGMTEYKLVVVG AVGVGKSALTIQLIQETCLLDILDTAGHEEYSAMRDQYMR WQQQSYLDSGIHFGATTTAPSLSGKHSGTAKSVTCTYYPA LNKMFCQLAKKSVTCTYSPALNEMFCQLAKTCPVQMTEYK LVVVGACGVGKSALTIQLIQGPGPGAKFVAAWTLKAAAGP GPGQYIKANSKFIGITELGPGPG KRAS2X(8x2)Cassette(SEQIDNO:64) MTEYKLVVVGACGVGKSALTIQLIQETCLLDILDTAGHEE YSAMRDQYMRMTEYKLVVVGAGDVGKSALTIQLIQETCLL DILDTAGREEYSAMRDQYMRMTEYKLVVVGADGVGKSALT IQLIQETCLLDILDTAGLEEYSAMRDQYMRMTEYKLVVVG AVGVGKSALTIQLIQETCLLDILDTAGKEEYSAMRDQYMR MTEYKLVVVGACGVGKSALTIQLIQETCLLDILDTAGKEE YSAMRDQYMRMTEYKLVVVGAGDVGKSALTIQLIQETCLL DILDTAGHEEYSAMRDQYMRMTEYKLVVVGAVGVGKSALT IQLIQETCLLDILDTAGREEYSAMRDQYMRMTEYKLVVVG ADGVGKSALTIQLIQETCLLDILDTAGLEEYSAMRDQYMR GPGPGAKFVAAWTLKAAAGPGPGQYIKANSKFIGITELGP GPG KRAS4X(4x4)Cassette(SEQIDNO:65) MTEYKLVVVGACGVGKSALTIQLIQMTEYKLVVVGADGVG KSALTIQLIQETCLLDILDTAGHEEYSAMRDQYMRMTEYK LVVVGADGVGKSALTIQLIQMTEYKLVVVGAVGVGKSALT IQLIQMTEYKLVVVGACGVGKSALTIQLIQETCLLDILDT AGHEEYSAMRDQYMRMTEYKLVVVGADGVGKSALTIQLIQ MTEYKLVVVGAVGVGKSALTIQLIQMTEYKLVVVGACGVG KSALTIQLIQETCLLDILDTAGHEEYSAMRDQYMRMTEYK LVVVGADGVGKSALTIQLIQMTEYKLVVVGAVGVGKSALT IQLIQETCLLDILDTAGHEEYSAMRDQYMRMTEYKLVVVG AVGVGKSALTIQLIQMTEYKLVVVGACGVGKSALTIQLIQ GPGPGAKFVAAWTLKAAAGPGPGQYIKANSKFIGITELGP GPG KRAS4x1Cassette(SEQIDNO:66) MTEYKLVVVGACGVGKSALTIQLIQMTEYKLVVVGADGVG KSALTIQLIQETCLLDILDTAGHEEYSAMRDQYMRMTEYK LVVVGAVGVGKSALTIQLIQGPGPGAKFVAAWTLKAAAGP GPGQYIKANSKFIGITELGPGPG KRAS4x1+R213LCassette(SEQIDNO:67) MTEYKLVVVGACGVGKSALTIQLIQMTEYKLVVVGADGVG KSALTIQLIQETCLLDILDTAGHEEYSAMRDQYMRMTEYK LVVVGAVGVGKSALTIQLIQLRVEYLDDRNTFLHSVVVPY EPPEVGPGPGAKFVAAWTLKAAAGPGPGQYIKANSKFIGI TELGPGPG KRAS4x1+S127YCassette(SEQIDNO:68) MTEYKLVVVGACGVGKSALTIQLIQMTEYKLVVVGADGVG KSALTIQLIQETCLLDILDTAGHEEYSAMRDQYMRMTEYK LVVVGAVGVGKSALTIQLIQHSGTAKSVTCTYYPALNKMF CQLAKGPGPGAKFVAAWTLKAAAGPGPGQYIKANSKFIGI TELGPGPG

    Adenoviral Vectors

    [0483] A modified ChAdV68 vector for the antigen expression system was generated based on AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,125-31,825) sequences deleted and the corresponding ATCC VR-594 (Independently sequenced Full-Length VR-594 C68 SEQ ID NO:10) nucleotides substituted at five positions. The full-length ChAdVC68 AC_000011.1 sequence with corresponding ATCC VR-594 nucleotides substituted at five positions is referred to as ChAdV68.5WTnt (SEQ ID NO:1). Antigen cassettes under the control of the CMV promoter/enhancer were inserted in place of deleted E1 sequences. A representative ChAdV68 vector containing 20 model antigens in an antigen cassette is ChAdV68.5WTnt.MAG25 mer (SEQ ID NO:2). The vectors featuring antigen cassettes described below having the MAG25 mer cassette can be replaced by the antigen cassettes described above, e.g., in Table 2B.

    Adenoviral Production in 293F cells

    [0484] ChAdV68 virus production was performed in 293F cells grown in 293 FreeStyle? (ThermoFisher) media in an incubator at 8% CO.sub.2. On the day of infection cells were diluted to 10.sup.6 cells per mL, with 98% viability and 400 mL were used per production run in 1L Shake flasks (Corning). 4 mL of the tertiary viral stock with a target MOI of >3.3 was used per infection. The cells were incubated for 48-72 h until the viability was <70% as measured by Trypan blue. The infected cells were then harvested by centrifugation, full speed bench top centrifuge and washed in 1?PBS, re-centrifuged and then re-suspended in 20 mL of 10 mM Tris pH7.4. The cell pellet was lysed by freeze thawing 3? and clarified by centrifugation at 4,300?g for 5 minutes.

    Adenoviral Purification by CsCl centrifugation

    [0485] Viral DNA was purified by CsCl centrifugation. Two discontinuous gradient runs were performed. The first to purify virus from cellular components and the second to further refine separation from cellular components and separate defective from infectious particles.

    [0486] 10 mL of 1.2 (26.8g CsCl dissolved in 92 mL of 10 mM Tris pH 8.0) CsCl was added to polyallomer tubes. Then 8 mL of 1.4 CsCl (53g CsCl dissolved in 87 mL of 10 mM Tris pH 8.0) was carefully added using a pipette delivering to the bottom of the tube. The clarified virus was carefully layered on top of the 1.2 layer. If needed more 10 mM Tris was added to balance the tubes. The tubes were then placed in a SW-32Ti rotor and centrifuged for 2 h 30 min at 10? C. The tube was then removed to a laminar flow cabinet and the virus band pulled using an 18 gauge needle and a 10 mL syringe. Care was taken not to remove contaminating host cell DNA and protein. The band was then diluted at least 2? with 10 mM Tris pH 8.0 and layered as before on a discontinuous gradient as described above. The run was performed as described before except that this time the run was performed overnight. The next day the band was pulled with care to avoid pulling any of the defective particle band. The virus was then dialyzed using a Slide-a-Lyzer? Cassette (Pierce) against ARM buffer (20 mM Tris pH 8.0, 25 mM NaCl, 2.5% Glycerol). This was performed 3?, 1 h per buffer exchange. The virus was then aliquoted for storage at ?80? C.

    Adenoviral Viral Assays

    [0487] VP concentration was performed by using an OD 260 assay based on the extinction coefficient of 1.1?10.sup.12 viral particles (VP) is equivalent to an Absorbance value of 1 at OD260 nm. Two dilutions (1:5 and 1:10) of adenovirus were made in a viral lysis buffer (0.1% SDS, 10 mM Tris pH 7.4, 1 mM EDTA). OD was measured in duplicate at both dilutions and the VP concentration/mL was measured by multiplying the OD260 value X dilution factor X 1.1?10.sup.12VP.

    [0488] An infectious unit (IU) titer was calculated by a limiting dilution assay of the viral stock. The virus was initially diluted 100? in DMEM/5% NS/1? PS and then subsequently diluted using 10-fold dilutions down to 1?10.sup.?7. 100 ?L of these dilutions were then added to 293A cells that were seeded at least an hour before at 3e5 cells/well of a 24 well plate. This was performed in duplicate. Plates were incubated for 48 h in a CO2 (5%) incubator at 37? C. The cells were then washed with 1?PBS and were then fixed with 100% cold methanol (?20? C.). The plates were then incubated at ?20? C. for a minimum of 20 minutes. The wells were washed with 1?PBS then blocked in 1?PBS/0.1% BSA for 1 h at room temperature. A rabbit anti-Ad antibody (Abcam, Cambridge, MA) was added at 1:8,000 dilution in blocking buffer (0.25 ml per well) and incubated for 1 h at room temperature. The wells were washed 4? with 0.5 mL PBS per well. A HRP conjugated Goat anti-Rabbit antibody (Bethyl Labs, Montgomery Texas) diluted 1000? was added per well and incubated for 1 h prior to a final round of washing. 5 PBS washes were performed and the plates were developed using DAB (Diaminobenzidine tetrahydrochloride) substrate in Tris buffered saline (0.67 mg/mL DAB in 50 mM Tris pH 7.5, 150 mM NaCl) with 0.01% H.sub.2O.sub.2. Wells were developed for 5 min prior to counting. Cells were counted under a 10? objective using a dilution that gave between 4-40 stained cells per field of view. The field of view that was used was a 0.32 mm.sup.2 grid of which there are equivalent to 625 per field of view on a 24 well plate. The number of infectious viruses/mL can be determined by the number of stained cells per grid multiplied by the number of grids per field of view multiplied by a dilution factor 10. Similarly, when working with GFP expressing cells florescent can be used rather than capsid staining to determine the number of GFP expressing virions per mL.

    SAM Vectors

    [0489] A RNA alphavirus backbone for the antigen expression system was generated from a self-replicating Venezuelan Equine Encephalitis (VEE) virus (Kinney, 1986, Virology 152: 400-413) by deleting the structural proteins of VEE located 3 of the 26S sub-genomic promoter (VEE sequences 7544 to 11,175 deleted; numbering based on Kinney et al 1986; SEQ ID NO:6). To generate the self-amplifying mRNA (SAM) vector, the deleted sequences are replaced by antigen sequences. A representative SAM vector containing 20 model antigens is VEE-MAG25 mer (SEQ ID NO:4). The vectors featuring the antigen cassettes described having the MAG25 mer cassette can be replaced by the SARS-CoV-2 cassettes and/or full-length proteins described herein.

    In Vitro Transcription to Generate SAM

    [0490] For in vivo studies: SAM vectors were generated as AU-SAM vectors. A modified T7 RNA polymerase promoter (TAATACGACTCACTATA [SEQ ID NO:89]), which lacks the canonical 3 dinucleotide GG, was added to the 5 end of the SAM vector to generate the in vitro transcription template DNA (e.g., the sequence set forth in SEQ ID NO:6; SAM with 7544 to 11,175 deleted without an inserted antigen cassette). Reaction conditions are described below: [0491] 1? transcription buffer (40 mM Tris-HCL [pH7.9], 10 mM dithiothreitol, 2 mM spermidine, 0.002% Triton X-100, and 27 mM magnesium chloride) using final concentrations of 1?T7 RNA polymerase mix (E2040S); 0.025 mg/mL DNA transcription template (linearized by restriction digest); 8 mM CleanCap Reagent AU (Cat. No. N-7114) and 10 mM each of ATP, cytidine triphosphate (CTP), GTP, and uridine triphosphate (UTP) [0492] Transcription reactions were incubated at 37? C. for 2 hr and treated with final 2 U DNase I (AM2239)/0.001 mg DNA transcription template in DNase I buffer for 1 hr at 37? C. [0493] SAM was purified by RNeasy Maxi (QIAGEN, 75162)

    [0494] Alternatively to co-transcriptional addition of a 5 cap structure, a 7-methylguanosine or a related 5 cap structure can be enzymatically added following transcription using a vaccinia capping system (NEB Cat. No. M2080) containing mRNA 2-O-methyltransferase and S-Adenosyl methionine.

    Immunizations

    [0495] For ChAdV68 vaccines, transgenic mice expressing a chimeric HLA-A11:01 (Taconic Model #9660-[CB6F1-Tg(HLA-A*1101/H2-Kb)A11.01]) were injected with 8?10.sup.10 viral particles (VP) or 5?10.sup.10 VP, as indicated, in 100 ?L volume, bilateral intramuscular injection (50 ?L per leg).

    [0496] For SAM vaccines, 10 ?g of RNA-LNP complexes in 100 ?L volume were administered as a bilateral intramuscular injection (50 ?L per leg).

    Splenocyte Dissociation

    [0497] Splenocytes were isolated 14 days post-immunization. Spleens for each mouse were pooled in 3 mL of complete RPMI (RPMI, 10% FBS, penicillin/streptomycin). Mechanical dissociation was performed using the gentleMACS Dissociator (Miltenyi Biotec), following manufacturer's protocol. Dissociated cells were filtered through a 40 micron filter and red blood cells were lysed with ACK lysis buffer (150 mM NH.sub.4Cl, 10 mM KHCO.sub.3, 0.1 mM Na.sub.2EDTA). Cells were filtered again through a 30 micron filter and then resuspended in complete RPMI. Cells were counted on the Cytoflex LX (Beckman Coulter) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis.

    Ex Vivo Enzyme-Linked Immunospot (ELISpot) Analysis

    [0498] ELISPOT analysis was performed according to ELISPOT harmonization guidelines {DOI: 10.1038/nprot.2015.068} with the mouse IFNg ELISpotPLUS kit (MABTECH). 1?10.sup.5 splenocytes were incubated with 10 uM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was terminated by running plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISPOT analysis, wells with saturation>50% were recorded as too numerous to count. Samples with deviation of replicate wells >10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count+2?(spot count?% confluence/[100%?% confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.

    XIV.C. Repeated Neopitope Evaluation Results

    [0499] Vaccine efficacy with cassettes having repeated (i.e., iterated) neoepitopes was compared against cassettes having only a single copy of a given neoepitope. Mice engineered to express human HLA-A11:01 were immunized with 8?10.sup.10 VP using the ChAdV68 delivery vectors described below and efficacy was assessed by IFN? ELISpot.

    [0500] As illustrated in FIG. 1A, a series of ChAdV68 delivery vectors were designed to assess efficacy of cassettes featuring either a single copy of KRAS neoepitopes G12C, G12V, G12D, and Q61H (KRAS 1? (20?1); cassette=SEQ ID NO: 63), 2 repeats of the KRAS G12C, G12V, G12D, and Q61H neoepitopes and 2 repeats of additional KRAS neoepitopes (KRAS 2? (8?2); cassette=SEQ ID NO: 64), or 4 repeats of the KRAS neoepitopes (KRAS 4? (4?4); cassette=SEQ ID NO: 65). HLA-A11:01 was previously predicted to present KRAS G12C, G12V, and G12D neoepitopes (data not shown).

    [0501] As shown in FIG. 1B and presented in Table 3, vaccination with vectors featuring multiple repeats of the neoepitopes demonstrated increased spot forming colonies (SFC), indicating repetition of epitope-encoding sequences in a cassette led to an increased antigen-specific immune response against KRAS neoepitope G12C. However, upon further observation that there was a response to the G12C peptide with the G12V 1?4 cassette (only expressing G12V) and none with the G12C 1?4 cassette (only expressing G12C), the observed response to the G12C peptide with the 4?4 cassette was likely driven by the G12V epitope. Mass spec analysis confirmed that the G12C peptide was contaminated with G12V peptide.

    [0502] As shown in FIG. 1C and FIG. 1D and presented in Table 3A, vaccination with vectors featuring multiple repeats of the neoepitopes demonstrated increased spot forming colonies (SFC), indicating repetition of epitope-encoding sequences in a cassette led to an increased antigen-specific immune response against KRAS neoepitopes, specifically G12V and G12D neoepitopes, using a ChAdV68 delivery system.

    TABLE-US-00006 TABLE 3 ELISpot data for KRAS Neoepitopes G12C, G12V, and G12D +/? Repetition Antigen G12C G12V G12D Cassette Mean +/?SE Mean +/?SE Mean +/?SE 20 ? 1 17 7 3 2 5 3 4 ? 4 2277.sup.+.sup. 580 6169* 31 970 864 8 ? 2 66 31 1563 293 97 45 *5/6 samples were too numerous to count (max value 6200) .sup.+likely due to contamination with G12V

    XIV.D. Immunodominant Epitope Removal Evaluation Results

    [0503] Vaccine efficacy with cassettes having a potentially immunodominant TP53 neoepitope capable of stimulating an immune response was compared against cassettes without a TP53 neoepitope capable of stimulating an immune response. Mice engineered to express human HLA-A11:01 were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors described below and efficacy was assessed by ELISpot. HLA-A11:01 was previously predicted to present KRAS G12C, G12V, G12D, and TP53 S127Y neoepitopes (data not shown).

    [0504] As illustrated in FIG. 2A, a series of ChAdV68 delivery vectors were designed to assess immunodominance of a TP53 epitope. Vector containing only KRAS neoepitopes G12C, G12V, G12D, and Q61H (KRAS 4?1; cassette=SEQ ID NO: 66), KRAS neoepitopes in combination with a TP53 R213L neoepitope considered unable to stimulate an immune response in the HLA-A11:01 mouse model as it is predicted to be presented by human HLA-A02:01 and not HLA-A11:01 (KRAS 4?1+R213L; cassette=SEQ ID NO: 67), or KRAS neoepitopes in combination with a TP53 S127Y neoepitope predicted to be presented by HLA-A11:01 (KRAS 4?1+S127Y; cassette=SEQ ID NO: 68).

    [0505] As shown in FIG. 2B and presented in Table 4, vaccination with vectors including the immunogenic TP53 S127Y epitope demonstrated reduced spot forming colonies (SFC) for KRAS epitope G12C relative to vectors not including a TP53 neoepitope (4?1) or including a non-immunogenic TP53 neoepitope (4?1+R213L), indicating presence of the TP53 S127Y neoepitope in the vaccine cassette acts as an immunodominant neoepitope decreasing KRAS-specific T cell responses. However, upon further observation that there was a response to the G12C peptide with the G12V 1?4 cassette (only expressing G12V) and none with the G12C 1?4 cassette (only expressing G12C), the observed response to the G12C peptide with the 4?4 cassette was likely driven by the G12V epitope. Mass spec analysis confirmed that the G12C peptide was contaminated with G12V peptide.

    [0506] As shown in FIGS. 2C-E and presented in Table 4, vaccination with vectors including the immunogenic TP53 S127Y epitope demonstrated reduced spot forming colonies (SFC) for KRAS epitopes G12V and G12D relative to vectors not including a TP53 neoepitope (4?1) or including a non-immunogenic TP53 neoepitope (4?1+R213L), indicating presence of the TP53 S127Y neoepitope in the vaccine cassette acts as an immunodominant neoepitope decreasing KRAS-specific T cell responses.

    TABLE-US-00007 TABLE 4 ELISpot data for KRAS and TP53 Neoepitopes Antigen G12C G12D G12V R213L S127Y Cassette Mean +/?SE Mean +/?SE Mean +/?SE Mean +/?SE Mean +/?SE 4 ? 1 92 41 32 21 1570 833 ND ND ND ND 4 ? 1 + R213L 86 74 62 46 773 378 5 3 ND ND 4 ? 1 + S127Y 2 1 7 5 0 0 ND ND 6118* 264 ND = Not Determined; *3/6 samples were too numerous to count (max value 6200)

    XIV.E. Evaluation of Presentation of KRAS Neoepitopes by Mass Spectrometry

    [0507] Mass spectrometry (MS) validation of candidate KRAS epitopes was performed using targeted mass spectrometry methods. Either donor tumor resections (multi-allelic; allele assignment from EDGE prediction) or single allelic K562 lines engineered to express the indicated multi-epitope cassettes (Table 2B) or the indicated neoepitope containing 25 mer sequences in Table 2A were assessed. Mass spectrometry analysis methods are described in more detail in Gillete et al. (Nat Methods. 2013 January; 10(1):28-34), herein incorporated by reference in its entirety for all purposes. Targeted mass spectrometry analysis, including use of K562 single allelic in vitro systems, is described in international application publication WO2021092095, herein incorporated by reference for all purposes. Results are shown in Table 5 demonstrating confirmation of HLA-specific presentation by various KRAS neoepitopes.

    TABLE-US-00008 TABLE5 KRASNeoepitopeMassSpectrometry 20x1 K562 4x4K562 8x2K562 SEQID57 Cell Cell Cell or59 Mutation HLA Sequence Tumors Lines Lines Lines 25mer G12C A*02:01 KLVVVGACGV No No No No Yes (SEQIDNO:76) G12C A*03:01 VVVGACGVGK No Yes NA NA NA (SEQIDNO:75) G12C A*11:01 VVVGACGVGK No Yes Yes No NA (SEQIDNO:75) G12C A*68:01 VVVGACGVGK No Yes NA NA NA (SEQIDNO:75) G12C B*07:02 GACGVGKSAL No Yes NA NA NA (SEQIDNO:93) G12C C*03:04 GACGVGKSAL No Yes NA NA NA (SEQIDNO:93) G12D A*02:01 KLVVVGADGV No No Yes No NA (SEQIDNO:94) G12D A*03:01 VVGADGVGK No Yes NA NA NA (SEQIDNO:77) G12D A*03:01 VVVGADGVGK No Yes NA NA NA (SEQIDNO:78) G12D A*11:01 VVGADGVGK Yes Yes Yes No NA (SEQIDNO:77) G12D A*11:01 VVVGADGVGK Yes Yes Yes Yes NA (SEQIDNO:78) G12D A*68:01 VVVGADGVGK No Yes NA NA NA (SEQIDNO:78) G12D B*07:02 GADGVGKSAL No Yes NA NA NA (SEQIDNO:95) G12D C*03:04 GADGVGKSAL No Yes NA NA NA (SEQIDNO:95) G12V A*02:01 KLVVVGAVGV No No Yes No Yes (SEQIDNO:97) G12V A*03:01 VVGAVGVGK No Yes NA NA NA (SEQIDNO:79) G12V A*03:01 VVVGAVGVGK Yes Yes NA NA NA (SEQIDNO:81) G12V A*11:01 VVGAVGVGK Yes Yes Yes Yes Yes (SEQIDNO:79) G12V A*11:01 VVVGAVGVGK Yes Yes Yes Yes Yes (SEQIDNO:81) G12V A*68:01 VVVGAVGVGK No Yes NA NA NA (SEQIDNO:81) G12V B*07:02 AVGVGKSAL No Yes NA NA NA (SEQIDNO:80) G12V C*01:02 AVGVGKSAL Yes NA NA NA NA (SEQIDNO:80) G12V C*03:04 GAVGVGKSAL No Yes NA NA NA (SEQIDNO:96) Q61H A*01:01 ILDTAGHEEY NA Yes Yes Yes NA (SEQIDNO:82) NA =not applicable (either tumor or cell line not available/generated to test)

    XIV.F. Iterated KRAS Neoepitope Cassette Evaluation Results

    [0508] Vaccine efficacy with various cassettes having repeated (i.e., iterated) neoepitopes or a single copy of a given neoepitope were evaluated. Mice engineered to express human HLA-A11:01 for KRAS G12 mutations or human HLA-A01:01 for KRAS Q61H were immunized with 5?10.sup.10 VP using the ChAdV68 delivery vectors described below and efficacy was assessed by IFN? ELISpot.

    [0509] A series of ChAdV68 delivery vectors were designed to assess efficacy of cassettes featuring either a single copy of KRAS neoepitopes G12C, G12V, G12D, and Q61H (KRAS 4?1; cassette=SEQ ID NO: 66), 4 iterations of each of the KRAS neoepitopes G12C, G12V, G12D, and Q61H (KRAS 4?(4?4); cassette=SEQ ID NO: 65), or 4 iterations of only one of the KRAS neoepitopes G12C, G12V, G12D, or Q61H (KRAS 1?4).

    [0510] Cassettes featuring either a single copy of KRAS neoepitopes (4?1) or 4 iterations of each of the KRAS neoepitopes (4?4) were compared. As shown in FIG. 3 and quantified in Table 6, vaccination with vectors featuring multiple iterations of the neoepitopes demonstrated increased spot forming colonies (SFC), indicating repetition of epitope-encoding sequences in a cassette led to an increased antigen-specific immune response against KRAS neoepitopes, specifically G12V and G12D neoepitopes, using a ChAdV68 delivery system.

    [0511] Cassettes featuring either 4 iterations of each of the KRAS neoepitopes (4?4) or 4 iterations of only one of the KRAS (1?4) were compared. As shown in FIG. 4 and quantified in Table 7, vaccination with vectors featuring multiple iterations of the neoepitopes in either the 4?4 or 1?4 formats generated immune responses by spot forming colonies (SFC) and were comparable across formats, indicating repetition of epitope-encoding sequences in a cassette led to an increased antigen-specific immune response against KRAS neoepitopes, specifically G12V and G12D neoepitopes, using a ChAdV68 delivery system.

    [0512] Immune responses for cassette formats for KRAS Q61H were compared, including cassettes featuring either a single copy of KRAS Q61H with 19 other distinct neoepitopes (20?1), 2 iterations of the KRAS Q61H (8?2), a single copy of KRAS Q61H together with single copies of KRAS G12 neoepitopes (4?1), 4 iterations of the KRAS Q61H together with KRAS G12 neoepitope iterations (4?4); or 4 iterations of only KRAS Q61H (1?4). As shown in FIG. 5 and quantified in Table 8, while vaccination with a vector a single copy of KRAS Q61H together with single copies of KRAS G12 neoepitopes demonstrated a small improvement over larger cassettes (4?1 vs 20?1 or 8?2), vaccination with vectors featuring multiple iterations of the neoepitopes in either the 4?4 or 1?4 formats generated immune responses by spot forming colonies (SFC) with the 1?4 format demonstrating the most robust response, indicating repetition of epitope-encoding sequences in a cassette as well as shorter formats and/or removal of additional distinct neoepitopes led to an increased antigen-specific immune response against the KRAS neoepitopes Q61H, using a ChAdV68 delivery system.

    [0513] Responses following immunization with either a ChAdV68 delivery system or a SAM delivery system we compared. Cassettes featuring either a single copy of KRAS neoepitopes as well as other neoepitopes (20?1) or 4 iterations of each of the KRAS neoepitopes (4?4) were assessed. As shown in FIG. 6 and FIG. 7 and quantified in Table 9, vaccination with vectors featuring multiple iterations of the neoepitopes demonstrated increased spot forming colonies (SFC) for both ChAdV68 and SAM formats, indicating repetition of epitope-encoding sequences in a cassette led to an increased antigen-specific immune response against KRAS neoepitopes, specifically G12V and G12D neoepitopes, using either a ChAdV68 or SAM delivery system suggesting the improved response with cassettes featuring iterations of neoepitopes is agnostic of the vector platform used.

    TABLE-US-00009 TABLE6 ELISpotdataforKRASNeoepitopes G12VandG12D+/?Repetition G12V(VVVGAVGGK) G12D(VVVGADGVGK) Antigen (SEQIDNO:91) (SEQIDNO:78) Cassette Mean +/?SE Mean +/?SE 4x4 5632 237.9 1069 361.4 4x1 1570 833.2 32 20.6

    TABLE-US-00010 TABLE7 ELISpotdataforKRASNeoepitopes G12VandG12D+/?Repetition G12V(VVVGAVGGK) G12D(VVVGADGVGK)* (SEQIDNO:91) (SEQIDNO:78) Antigen +/? +/? Cassette Mean SE Mean SE 4x4 3700 404.9 536 316.1 1x4 3358 310.8 1726 784.7 *Results were not significantly different between formats (p =0.1896)

    TABLE-US-00011 TABLE 8 ELISpot data for KRAS Neoepitope Q61H +/? Repetition Q61H (ILDTAGHEEY) Antigen (SEQ ID NO: 82) Cassette Mean +/?SE 20 ? 1 3 1.3 4 ? 4 554 225 8 ? 2 20 10.8 4 ? 1 262 112.2 1 ? 4 1289 451.7 Naive 1 0.6

    TABLE-US-00012 TABLE9 ELISpotforKRASG12VandG12D+/? RepetitioninChad/SAMFormats ChAdV6820x1 SAM20x1 ChAdV684x4 SAM4x4 Mean SEM N Mean SEM N Mean SEM N Mean SEM N G12V 13 6 6 33 6 6 4483 767 6 6939 1149 6 pool G12D 5 2 6 6 3 6 297 227 6 560 163 6 pool G12V 4 2 6 12 3 6 3167 846 6 6878 1216 6 (VVGAV GVGK) (SEQID NO:79) G12D 4 3 6 8 3 6 356 288 6 564 148 6 (VVVGA DGVGK) (SEQID NO:78)

    XIV.G. Clinical Assessment of a Neoantigen Vaccine

    [0514] An open-label, multi-center, multi-dose Phase 1/2 study is performed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of a heterologous prime/boost vaccination strategy. A vaccine program exploring the iterated KRAS neoepitope cassettes described herein is assessed.

    [0515] The purpose of this study is to evaluate the dose, safety, immunogenicity and early clinical activity of a ChAdV vector (GRT-C903) and a samRNA vector (GRT-R904), neoantigen-based therapeutic cancer vaccines, in combination with immune checkpoint blockade, in patients with advanced or metastatic non-small cell lung cancer, microsatellite stable colorectal cancer, pancreatic cancer, and shared neoantigen-positive tumors. Tumors harboring non-synonymous deoxyribonucleic acid (DNA) mutations can present peptides containing these mutations as non-self antigens in the context of HLA on the tumor cell surface. A fraction of mutated peptides result in neoantigens capable of generating T-cell responses that exclusively target tumor cells. Some of these tumor-specific neoantigens are known or expected to be common across a subset of patients and are called shared neoantigens. This study targets shared neoantigens using a heterologous prime/boost therapeutic vaccine approach (GRT-C903 first followed by GRT-R904) in combination with checkpoint blockade to stimulate an immune response. This study explores the safety and early clinical activity of this neoantigen-based immunotherapy in inducing T-cell responses specific for the shared neoantigens contained within the therapeutic vaccine. Phase 1 tests multiple doses and combinations with checkpoint blockade and Phase 2 tests for early signs of clinical activity using a vaccine regimen based on Phase 1 data.

    [0516] A cancer vaccine encoding the iterated KRAS neoepitope cassettes described herein (SLATE v2 or SLATE-KRAS) is administered in combination with immune checkpoint blockade in patients with advanced cancer. The SLATE heterologous prime/boost vaccine regimen involves (1) a ChAdV that is used as a prime vaccination and (2) a samRNA formulated in a LNP that is used for boost vaccinations following the ChAdV vector. Both the ChAdV and samRNA vectors encode the same iterated KRAS neoepitope cassette, which also encodes two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). For subject inclusion, tumors are used for whole-exome and transcriptome sequencing to detect somatic mutations, and blood is used for HLA typing.

    [0517] The ChAdV vector is a replication-defective, E1, E3, E4 open reading frames 2-4 (ORF2-4) deleted adenoviral vector based on chimpanzee adenovirus 68 (C68, 68/SAdV-25, originally designated as Pan 9), which is a subgroup E adenovirus [ChAdV68-Empty-E4deleted; see SEQ ID NO:83 which represents SEQ ID NO:1 with an E1 deletion (577 to 3403), E3 deletion (27,125-31,825), and a partial E4 deletion spanning ORF2-4 (34,916 to 35,642)]. The ChAdV vector is formulated in solution at 5?10.sup.11 vp/mL and 1.0 mL is injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles (deltoid muscle preferred, gluteus [dorso or ventro] or rectus femoris on each side may be used).

    [0518] The samRNA vector is derived from an alphavirus. The samRNA vector encodes the viral proteins and the 5 and 3 RNA sequences required for RNA amplification but encoded no structural proteins. The samRNA vector is formulated in LNPs composed of 4 lipids: an ionizable amino lipid, a phosphatidylcholine, cholesterol, and a PEG-based coat lipid to encapsulate the samRNA and form samRNA-LNPs. The samRNA vector contains the same neoantigen expression cassette as used in the ChAdV vector. The samRNA vector is formulated in solution at 1 mg/mL and was injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles (deltoid muscle preferred, gluteus [dorso or ventro] or rectus femoris on each side may be used). The boost vaccination sites are as close to the prime vaccination site as possible. The injection volume is based on the dose to be administered. The dose level amount refers explicitly to the amount of the samRNA vector, i.e., it does not refer to other components, such as the LNP. The ratio of LNP:samRNA is approximately 24:1. Accordingly, the dose of LNP is 720 ?g a samRNA vector dose level of 30 ?g.

    [0519] Ipilimumab is a human monoclonal IgG1 antibody that binds to the cytotoxic T-lymphocyte associated antigen 4 (CTLA-4). Ipilimumab is formulated in solution at 5 mg/mL and is injected SC proximally (within ?2 cm) to each of the bilateral vaccination sites. The SC route of ipilimumab is distinct from the approved IV route of administration. Ipilimumab is administered at a dose of 30 mg in one of two methods listed below: [0520] 1. Four 1.5 mL (7.5 mg) injections proximal to the vaccine draining LN at each of the bilateral vaccination sites (i.e., 1.5 mL below the vaccination site and 1.5 mL above the vaccination site on each bilateral side in each deltoid, ventrogluteal, dorsogluteal, or rectus femoris [deltoid preferred, but dependent on clinical site and patient preference]). [0521] 2. Six 1 mL (5 mg) injections proximal to the vaccine draining LN at each of the bilateral vaccination sites (i.e., 1 mL below the vaccination site, 1 mL to the side of the vaccination site, and 1 mL above the vaccination site on each bilateral side in each deltoid, ventrogluteal, dorsogluteal, or rectus femoris [deltoid preferred, but dependent on clinical site and patient preference]).

    [0522] Nivolumab is a human monoclonal IgG4 antibody that blocks the interaction of PD-1 and its ligands, PD-L1 and PD-L2. Nivolumab is formulated in solution at 10 mg/mL and is administered as an IV infusion through a 0.2-micron to 1.2-micron pore size, low-protein binding in-line filter at the protocol-specified doses. It is not administered as an IV push or bolus injection. When the dose is fixed (e.g., 240 mg flat dose), nivolumab injection may be infused undiluted or diluted so as not to exceed a total infusion volume of 160 mL. Nivolumab infusion is promptly followed by a flush of diluent to clear the line. Nivolumab is administered following each vaccination (i.e., each of the samRNA or ChAdV vaccines) with or without ipilimumab on the same day. The dose and route of nivolumab is based on the Food and Drug Administration approved dose and route. Doses of nivolumab may be interrupted, delayed, or discontinued depending on how well the participant tolerates the treatment. Dosing visits are not skipped, only delayed. Vaccination does not occur in the absence of nivolumab unless the Investigator and Sponsor believe treatment with samRNA vectors in the absence of nivolumab is in the best interest of the patient. Cemiplimab may be administered in place of nivolumab, e.g., according to manufacturer's directions and/or appropriate dosing determined as recognized by one skilled in the art. Other PD1 and/or PD-L1 checkpoint inhibitors may alternatively be used.

    [0523] A Phase 1 trial examined prime vaccination with the ChAdV vector followed by multiple dose levels of the samRNA vector with all patients receiving IV nivolumab. Eligible patients included those with advanced or metastatic (1) a solid tumor expressing the KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), including microsatellite-stable CRC (MSS-CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA). Following the initial demonstration of the safety and tolerability of Dose Level 1 (30 ?g), patients were treated at Dose Level 2 which incorporated SC ipilimumab (30 mg) at the same dose of the samRNA vector as in Dose Level 1 (30 ?g). The dose of the SAM vector was escalated to Dose Level 3 (100 ?g) followed by Dose Level 4 (300 ?g) with all patients continuing to receive SC ipilimumab (30 mg). Phase 2 involves tumor-specific expansion cohorts and a cohort of mutation-positive tumors outside of tumor types already represented by other expansion cohorts. Cohorts 1 and 4 enroll patients who have not experienced disease progression to routine therapy and Cohorts 2, 3, 5, and 6 enroll patients who experienced disease progression on, or after, routine therapy. Patients in Phase 2 receive SC ipilimumab at the dose determined to be well tolerated in Phase 1. Patients receive IV nivolumab at 480 mg Q4W throughout Phase 1 and 2. Details of the Phase 1/2 trials are illustrated in FIG. 8 and FIG. 11. Phase 2 arms include both a monthly treatment schedule or a treatment schedule of every two months. FIG. 17 shows the two-month treatment schedule.

    [0524] Inclusion criteria specifically include: [0525] 1. Patients with the indicated advanced or metastatic solid tumor as follows: [0526] a. Microsatellite-stable colorectal cancer (MSS-CRC) who are currently receiving systemic treatment with a fluoropyrimidine and oxaliplatin and/or irinotecan that may include a VEGF or EGFR targeting therapy as their 1L therapy for metastatic disease OR who have experienced disease progression following treatment with a fluoropyrimidine, oxaliplatin, and irinotecan that may include a VEGF or EGFR targeting therapy and have not received additional lines of systemic therapy in the metastatic setting. [0527] b. Non-small cell lung cancer (NSCLC) who are currently receiving systemic treatment with an anti-PD-(L)1 antibody in combination with cytotoxic, platinum-based chemotherapy OR who have experienced disease progression following treatment with an anti-PD-(L)1 antibody in combination with cytotoxic, platinum-based chemotherapy (or anti-PD-(L)1 alone if patient refuses platinum based chemotherapy), and have not received additional lines of systemic therapy in the metastatic setting. [0528] c. Pancreatic ductal adenocarcinoma (PDA) who are currently receiving systemic cytotoxic chemotherapy as their 1L therapy for metastatic disease OR who have experienced disease progression on 1L systemic cytotoxic chemotherapy and have received no more than 1 prior line of therapy in the metastatic setting. [0529] d. Any solid tumor histology where the patient has experienced disease progression with all available therapies known to confer clinical benefit; AND/OR [0530] 2. Patient's tumor possesses one of the mutations listed below, and is determined to express a HLA allele for antigen presentation of the identified tumor mutation (Table 10): KRAS_G12C or NRAS_G12C; KRAS_G12D or NRAS_G12D; KRAS_G12V or NRAS_G12V; KRAS_Q61H or NRAS_Q61H.

    TABLE-US-00013 TABLE 10 Neoantigen and HLA Allele Pairs KRAS_G12C A0201, A0301, A1101, A6801, B0702, C0304 KRAS_G12D A0201, A0301, A1101, A6801, B0702, C0304, C0802 KRAS_G12V A0201, A0301, A1101, A6801, B0702, C0102, C0304 KRAS_Q61H A0101

    [0531] Inclusion criteria also includes: ECOG Performance Status 0 or 1; Measurable disease according to RECIST v1.1; Adequate organ function, as measured by laboratory values.

    [0532] Exclusion criteria also includes: Tumors with genetic characteristics as follows: (a) For NSCLC, patients with a known genetic driver alteration in EGFR, ALK, ROS1, RET, or TRK; (b) Patients with known MSI-high disease based on institutional standard; Known exposure to chimpanzee adenovirus or any history of anaphylaxis in reaction to a vaccination; Bleeding disorder (e.g., factor deficiency, coagulopathy) or history of significant bruising or bleeding following IM injections or blood draws; History of allogenic/solid organ transplant; Active, known, or suspected autoimmune disease; Active tuberculosis or recent (<2 week) clinically significant infection, or evidence of active hepatitis B or hepatitis C; Known history of positive test for human immunodeficiency (HIV) or known acquired immunodeficiency syndrome (AIDS).

    [0533] The overall demographics for patients assessed in the Phase 1/2 trial are shown below in Table 11.

    TABLE-US-00014 TABLE 11 Subject Demographics SLATE- Version 1 KRAS Overall N = 26 N = 12 N = 38 Demographics and Tumor Type Age: mean years (min, max) 60 59 60 (33, 83) (36, 86) (33, 86) Gender (Male/Female) 10/16 4/8 14/24 Tumor Types Non-small Cell Lung Cancer 13 5 18 (NSCLC) No. Prior therapy (median, 1 2 1.5 range) (1-4) (1-3) (1-4) Prior anti-PD-(L)1 therapy 13 5 18 Microsatellite-Stable (MSS) 6 7 13 Colorectal Cancer No. Prior therapy (median, 1.5 1 1 range) (1-2) (1-2) (1-2) No. Prior Oxaliplatin/Irinotecan 6 6 12 Pancreatic Ductal Adenocarcinoma 5 0 5 (PDA) No. Prior therapy (median, range) 1 0 1 (1-3) (1-3) Other 2 0 2 No. Prior therapy (median, range) 3 0 3 (3) (3)

    [0534] A summary of adverse events for heterologous prime-boost neoantigen directed VI and SLATE-KRAS was well-tolerated in advanced solid cancer patients, as in shown in Table 12.

    TABLE-US-00015 TABLE 12 Summary of Adverse Events Preferred V1 (n = 26) KRAS-SLATE (n = 12) Overall (n = 38) Terms; n(%) Grade 1/2 ?Grade 3 Grade 1/2 ?Grade 3 All Grades Pyrexia 14 (53.8) 0.0 3 (25.0) 0.0 17 (44.7) Fatigue 8 (30.8) 1(3.8) 2 (16.7) 0.0 11 (28.9) Nausea 6 (23.1) 0.0 3 (25.0) 0.0 9 (23.7) Vomiting 7 (26.9) 0.0 1 (8.3) 0.0 8 (21.1) Chills 3 (11.5) 0.0 4 (33.3) 0.0 7 (18.4) Diarrhoea 5 (19.2) 0.0 1 (8.3) 0.0 6 (15.8) Myalgia 2 (7.7) 0.0 3 (25.0) 0.0 5 (13.2) Decreased appetite 2 (7.7) 0.0 2 (16.7) 0.0 4 (10.5) Injection site pain 2 (7.7) 0.0 2 (16.7) 0.0 4 (10.5) Injection site reaction 4 (15.4) 0.0 0.00 0.0 4 (10.5) Treatment-related Grade 3/4 AEs with frequency <10%: With V1, one patient experienced transient Grade 3 increase in alanine aminotransferase and aspartate aminotransferase With V1, one patient had Grade 3 confusional state associated with pyrexia

    [0535] The cancer vaccine encoding the optimized SLATE v2 iterated KRAS neoepitope cassette was administered to a SLATE patient (S31) that was 41-year-old male with metastatic NSCLC identified as having a KRAS G12V mutation as well as haplotyped as A*03:01. S31 had prior treatment with pembrolizumab, carboplatin, and pemetrexed for 16 months with progressive disease. S31 received Dose 1-ChAdV vector in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as the prime vaccination followed by dosing visits every 4 weeks as follows: [0536] Dose 2samRNA vector (30 ?g) in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as a boost vaccination [0537] Dose 3nivolumab (480 mg) monotherapy [0538] Dose 4SAM vector in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as a boost vaccination [0539] Dose 5nivolumab (480 mg) monotherapy [0540] S31 remained on the study treatment for 6 months

    [0541] T cell responses were assessed and compared between the patient S31 administered the optimized SLATE v2 cassette that included the iterated KRAS neoepitopes and a SLATE patient (S21) that was administered the prior SLATE version 1 (v1) cassette. As shown in FIG. 9, patient S31 receiving the SLATE v2 cassette demonstrated an increased response (?100-fold) relative to the patient receiving the SLATE v1 cassette, in particular for the KRAS G12V peptide. Accordingly, the cassette featuring the iterated KRAS neoepitopes demonstrated an improved immune response stimulatory capacity. Further, as shown in FIG. 10, patient S31 demonstrated a 37% reduction in tumor size at week 8 (FIG. 10 top and bottom left panels) and 28% at week 18 (FIG. 10 bottom left panel), as well as a molecular response as assessed by monitoring neoantigen ctDNA (FIG. 10 right panel), demonstrating potential clinical efficacy at the timepoints assessed here.

    [0542] The cancer vaccine encoding the optimized SLATE v2 iterated KRAS neoepitope cassette was administered to a SLATE patient (S37) that was 64-year-old female with metastatic CRC identified as having a KRAS G12V mutation as well as haplotyped as A*11:01. S37 had prior treatment with FOLFOX/FOLFIR/bevacizumab for 23 months with progressive disease. S37 received Dose 1-ChAdV vector in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as the prime vaccination followed by dosing visits every 4 weeks (Q4W) as follows (e.g., as illustrated in FIG. 17): [0543] Dose 2samRNA vector (30 ?g) in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as a boost vaccination [0544] Dose 3nivolumab (480 mg) monotherapy [0545] Dose 4samRNA vector (30 ?g) in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as a boost vaccination [0546] Dose 5nivolumab (480 mg) monotherapy [0547] Dose 6ChAdV vector (same dose as prime) in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) [0548] Dose 7nivolumab (480 mg) monotherapy [0549] Dose 8samRNA vector (30 ?g) in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as a boost vaccination [0550] Dose 9nivolumab (480 mg) monotherapy [0551] Dose 10samRNA vector (30 ?g) in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as a boost vaccination [0552] S37 remained on the study treatment

    [0553] T cell responses were assessed and compared between the patient S37 administered the optimized SLATE v2 cassette that included the iterated KRAS neoepitopes and a SLATE patient (S21) that was administered the prior SLATE version 1 (v1) cassette. As shown in FIG. 9, patient S31 receiving the SLATE v2 cassette demonstrated an increased response (?100-fold) relative to the patient receiving the SLATE v1 cassette, in particular for the KRAS G12V peptide. A summary of T cells responses assessed by IFN? ELISpot for various G12 mutations, alleles, and cassettes in shown in FIG. 12. Accordingly, the cassette featuring the iterated KRAS neoepitopes demonstrated an improved immune response stimulatory capacity.

    [0554] Further, as shown in FIG. 13, patient S37 demonstrated a 23% reduction in tumor size at week 24 (FIG. 13 right panels; week 24), as well as a molecular response as assessed by monitoring neoantigen ctDNA (FIG. 13 left top panel) and standard serum tumor markers CEA and CA 19-9 (FIG. 13 left bottom panel), demonstrating potential clinical efficacy.

    [0555] Clinical efficacy was assessed in patients with NSCLC. Molecular responses (reduction in ctDNA>30%) and survival probabilities are shown in FIG. 14, demonstrating a trend of improved overall survival in patients with NSCLC with a molecular response compared to those without. A summary of clinical results for patients with NSCLC is presented FIG. 15, demonstrating early signals of durability and molecular response in NSCLC subjects following immune-checkpoint blockade (anti-PD-(L)1 therapy).

    [0556] Clinical efficacy was assessed in patients with late-stage CRC. A summary of clinical results for patients with late-stage CRC is presented FIG. 16, demonstrating early signals of durability and molecular response in late-stage CRC.

    [0557] Overall, a molecular response (reduction in ctDNA) was observed in 31.8% of patients with CRC and NSCLC preceding clinical benefit, including a molecular and clinical benefit in a patient with KRAS G12V mutant CRC who had progressed on 2 prior therapies. Additionally, assessing molecular responses by ctDNA may provided an improved biomarker of benefit versus RECIST radiology with this immunotherapy.

    [0558] Vectors, cassettes, and antibodies referred to herein are described below and referred to by SEQ ID NO.

    TABLE-US-00016 TremelimumabVL(SEQIDNO:16) TremelimumabVH(SEQIDNO:17) TremelimumabVHCDR1(SEQIDNO:18) TremelimumabVHCDR2(SEQIDNO:19) TremelimumabVHCDR3(SEQIDNO:20) TremelimumabVLCDR1(SEQIDNO:21) TremelimumabVLCDR2(SEQIDNO:22) TremelimumabVLCDR3(SEQIDNO:23) Durvalumab(MEDI4736)VL(SEQIDNO:24) MEDI4736VH(SEQIDNO:25) MEDI4736VHCDR1(SEQIDNO:26) MEDI4736VHCDR2(SEQIDNO:27) MEDI4736VHCDR3(SEQIDNO:28) MEDI4736VLCDR1(SEQIDNO:29) MEDI4736VLCDR2(SEQIDNO:30) MEDI4736VLCDR3(SEQIDNO:31) UbA76-25merPDTTnucleotide(SEQIDNO:32) UbA76-25merPDTTpolypeptide(SEQIDNO:33) MAG-25merPDTTnucleotide(SEQIDNO:34) MAG-25merPDTTpolypeptide(SEQIDNO:35) Ub7625merPDTT_NoSFLnucleotide(SEQIDNO:36) Ub7625merPDTT_NoSFLpolypeptide(SEQIDNO:37) ChAdV68.5WTnt.MAG25mer(SEQIDNO:2); AC_000011.1withE1(nt577to3403)and E3(nt27,125-31,825)sequencesdeleted; correspondingATCCVR-594nucleotides substitutedatfivepositions;model neoantigencassetteunderthecontrol oftheCMVpromoter/enhancerinserted inplaceofdeletedE1;SV40polyA 3ofcassette Venezuelanequineencephalitisvirus [VEE](SEQIDNO:3)GenBank:L01442.2 VEE-MAG25mer(SEQIDNO:4);contains MAG-25merPDTTnucleotide(bases30-1755) Venezuelanequineencephalitisvirus strainTC-83[TC-83](SEQIDNO:5) GenBank:L01443.1 ATAGGCGGCGCATGAGAGAAGCCCAGACCAATTACCTACCCAAAA TGGAGAAAGTTCACGTTGACATCGAGGAAGACAGCCCATTCCTCA GAGCTTTGCAGCGGAGCTTCCCGCAGTTTGAGGTAGAAGCCAAGC AGGTCACTGATAATGACCATGCTAATGCCAGAGCGTTTTCGCATC TGGCTTCAAAACTGATCGAAACGGAGGTGGACCCATCCGACACGA TCCTTGACATTGGAAGTGCGCCCGCCCGCAGAATGTATTCTAAGC ACAAGTATCATTGTATCTGTCCGATGAGATGTGCGGAAGATCCGG ACAGATTGTATAAGTATGCAACTAAGCTGAAGAAAAACTGTAAGG AAATAACTGATAAGGAATTGGACAAGAAAATGAAGGAGCTCGCCG CCGTCATGAGCGACCCTGACCTGGAAACTGAGACTATGTGCCTCC ACGACGACGAGTCGTGTCGCTACGAAGGGCAAGTCGCTGTTTACC AGGATGTATACGCGGTTGACGGACCGACAAGTCTCTATCACCAAG CCAATAAGGGAGTTAGAGTCGCCTACTGGATAGGCTTTGACACCA CCCCTTTTATGTTTAAGAACTTGGCTGGAGCATATCCATCATACT CTACCAACTGGGCCGACGAAACCGTGTTAACGGCTCGTAACATAG GCCTATGCAGCTCTGACGTTATGGAGCGGTCACGTAGAGGGATGT CCATTCTTAGAAAGAAGTATTTGAAACCATCCAACAATGTTCTAT TCTCTGTTGGCTCGACCATCTACCACGAGAAGAGGGACTTACTGA GGAGCTGGCACCTGCCGTCTGTATTTCACTTACGTGGCAAGCAAA ATTACACATGTCGGTGTGAGACTATAGTTAGTTGCGACGGGTACG TCGTTAAAAGAATAGCTATCAGTCCAGGCCTGTATGGGAAGCCTT CAGGCTATGCTGCTACGATGCACCGCGAGGGATTCTTGTGCTGCA AAGTGACAGACACATTGAACGGGGAGAGGGTCTCTTTTCCCGTGT GCACGTATGTGCCAGCTACATTGTGTGACCAAATGACTGGCATAC TGGCAACAGATGTCAGTGCGGACGACGCGCAAAAACTGCTGGTTG GGCTCAACCAGCGTATAGTCGTCAACGGTCGCACCCAGAGAAACA CCAATACCATGAAAAATTACCTTTTGCCCGTAGTGGCCCAGGCAT TTGCTAGGTGGGCAAAGGAATATAAGGAAGATCAAGAAGATGAAA GGCCACTAGGACTACGAGATAGACAGTTAGTCATGGGGTGTTGTT GGGCTTTTAGAAGGCACAAGATAACATCTATTTATAAGCGCCCGG ATACCCAAACCATCATCAAAGTGAACAGCGATTTCCACTCATTCG TGCTGCCCAGGATAGGCAGTAACACATTGGAGATCGGGCTGAGAA CAAGAATCAGGAAAATGTTAGAGGAGCACAAGGAGCCGTCACCTC TCATTACCGCCGAGGACGTACAAGAAGCTAAGTGCGCAGCCGATG AGGCTAAGGAGGTGCGTGAAGCCGAGGAGTTGCGCGCAGCTCTAC CACCTTTGGCAGCTGATGTTGAGGAGCCCACTCTGGAAGCCGATG TCGACTTGATGTTACAAGAGGCTGGGGCCGGCTCAGTGGAGACAC CTCGTGGCTTGATAAAGGTTACCAGCTACGATGGCGAGGACAAGA TCGGCTCTTACGCTGTGCTTTCTCCGCAGGCTGTACTCAAGAGTG AAAAATTATCTTGCATCCACCCTCTCGCTGAACAAGTCATAGTGA TAACACACTCTGGCCGAAAAGGGCGTTATGCCGTGGAACCATACC ATGGTAAAGTAGTGGTGCCAGAGGGACATGCAATACCCGTCCAGG ACTTTCAAGCTCTGAGTGAAAGTGCCACCATTGTGTACAACGAAC GTGAGTTCGTAAACAGGTACCTGCACCATATTGCCACACATGGAG GAGCGCTGAACACTGATGAAGAATATTACAAAACTGTCAAGCCCA GCGAGCACGACGGCGAATACCTGTACGACATCGACAGGAAACAGT GCGTCAAGAAAGAACTAGTCACTGGGCTAGGGCTCACAGGCGAGC TGGTGGATCCTCCCTTCCATGAATTCGCCTACGAGAGTCTGAGAA CACGACCAGCCGCTCCTTACCAAGTACCAACCATAGGGGTGTATG GCGTGCCAGGATCAGGCAAGTCTGGCATCATTAAAAGCGCAGTCA CCAAAAAAGATCTAGTGGTGAGCGCCAAGAAAGAAAACTGTGCAG AAATTATAAGGGACGTCAAGAAAATGAAAGGGCTGGACGTCAATG CCAGAACTGTGGACTCAGTGCTCTTGAATGGATGCAAACACCCCG TAGAGACCCTGTATATTGACGAAGCTTTTGCTTGTCATGCAGGTA CTCTCAGAGCGCTCATAGCCATTATAAGACCTAAAAAGGCAGTGC TCTGCGGGGATCCCAAACAGTGCGGTTTTTTTAACATGATGTGCC TGAAAGTGCATTTTAACCACGAGATTTGCACACAAGTCTTCCACA AAAGCATCTCTCGCCGTTGCACTAAATCTGTGACTTCGGTCGTCT CAACCTTGTTTTACGACAAAAAAATGAGAACGACGAATCCGAAAG AGACTAAGATTGTGATTGACACTACCGGCAGTACCAAACCTAAGC AGGACGATCTCATTCTCACTTGTTTCAGAGGGTGGGTGAAGCAGT TGCAAATAGATTACAAAGGCAACGAAATAATGACGGCAGCTGCCT CTCAAGGGCTGACCCGTAAAGGTGTGTATGCCGTTCGGTACAAGG TGAATGAAAATCCTCTGTACGCACCCACCTCAGAACATGTGAACG TCCTACTGACCCGCACGGAGGACCGCATCGTGTGGAAAACACTAG CCGGCGACCCATGGATAAAAACACTGACTGCCAAGTACCCTGGGA ATTTCACTGCCACGATAGAGGAGTGGCAAGCAGAGCATGATGCCA TCATGAGGCACATCTTGGAGAGACCGGACCCTACCGACGTCTTCC AGAATAAGGCAAACGTGTGTTGGGCCAAGGCTTTAGTGCCGGTGC TGAAGACCGCTGGCATAGACATGACCACTGAACAATGGAACACTG TGGATTATTTTGAAACGGACAAAGCTCACTCAGCAGAGATAGTAT TGAACCAACTATGCGTGAGGTTCTTTGGACTCGATCTGGACTCCG GTCTATTTTCTGCACCCACTGTTCCGTTATCCATTAGGAATAATC ACTGGGATAACTCCCCGTCGCCTAACATGTACGGGCTGAATAAAG AAGTGGTCCGTCAGCTCTCTCGCAGGTACCCACAACTGCCTCGGG CAGTTGCCACTGGAAGAGTCTATGACATGAACACTGGTACACTGC GCAATTATGATCCGCGCATAAACCTAGTACCTGTAAACAGAAGAC TGCCTCATGCTTTAGTCCTCCACCATAATGAACACCCACAGAGTG ACTTTTCTTCATTCGTCAGCAAATTGAAGGGCAGAACTGTCCTGG TGGTCGGGGAAAAGTTGTCCGTCCCAGGCAAAATGGTTGACTGGT TGTCAGACCGGCCTGAGGCTACCTTCAGAGCTCGGCTGGATTTAG GCATCCCAGGTGATGTGCCCAAATATGACATAATATTTGTTAATG TGAGGACCCCATATAAATACCATCACTATCAGCAGTGTGAAGACC ATGCCATTAAGCTTAGCATGTTGACCAAGAAAGCTTGTCTGCATC TGAATCCCGGCGGAACCTGTGTCAGCATAGGTTATGGTTACGCTG ACAGGGCCAGCGAAAGCATCATTGGTGCTATAGCGCGGCAGTTCA AGTTTTCCCGGGTATGCAAACCGAAATCCTCACTTGAAGAGACGG AAGTTCTGTTTGTATTCATTGGGTACGATCGCAAGGCCCGTACGC ACAATCCTTACAAGCTTTCATCAACCTTGACCAACATTTATACAG GTTCCAGACTCCACGAAGCCGGATGTGCACCCTCATATCATGTGG TGCGAGGGGATATTGCCACGGCCACCGAAGGAGTGATTATAAATG CTGCTAACAGCAAAGGACAACCTGGCGGAGGGGTGTGCGGAGCGC TGTATAAGAAATTCCCGGAAAGCTTCGATTTACAGCCGATCGAAG TAGGAAAAGCGCGACTGGTCAAAGGTGCAGCTAAACATATCATTC ATGCCGTAGGACCAAACTTCAACAAAGTTTCGGAGGTTGAAGGTG ACAAACAGTTGGCAGAGGCTTATGAGTCCATCGCTAAGATTGTCA ACGATAACAATTACAAGTCAGTAGCGATTCCACTGTTGTCCACCG GCATCTTTTCCGGGAACAAAGATCGACTAACCCAATCATTGAACC ATTTGCTGACAGCTTTAGACACCACTGATGCAGATGTAGCCATAT ACTGCAGGGACAAGAAATGGGAAATGACTCTCAAGGAAGCAGTGG CTAGGAGAGAAGCAGTGGAGGAGATATGCATATCCGACGACTCTT CAGTGACAGAACCTGATGCAGAGCTGGTGAGGGTGCATCCGAAGA GTTCTTTGGCTGGAAGGAAGGGCTACAGCACAAGCGATGGCAAAA CTTTCTCATATTTGGAAGGGACCAAGTTTCACCAGGCGGCCAAGG ATATAGCAGAAATTAATGCCATGTGGCCCGTTGCAACGGAGGCCA ATGAGCAGGTATGCATGTATATCCTCGGAGAAAGCATGAGCAGTA TTAGGTCGAAATGCCCCGTCGAAGAGTCGGAAGCCTCCACACCAC CTAGCACGCTGCCTTGCTTGTGCATCCATGCCATGACTCCAGAAA GAGTACAGCGCCTAAAAGCCTCACGTCCAGAACAAATTACTGTGT GCTCATCCTTTCCATTGCCGAAGTATAGAATCACTGGTGTGCAGA AGATCCAATGCTCCCAGCCTATATTGTTCTCACCGAAAGTGCCTG CGTATATTCATCCAAGGAAGTATCTCGTGGAAACACCACCGGTAG ACGAGACTCCGGAGCCATCGGCAGAGAACCAATCCACAGAGGGGA CACCTGAACAACCACCACTTATAACCGAGGATGAGACCAGGACTA GAACGCCTGAGCCGATCATCATCGAAGAGGAAGAAGAGGATAGCA TAAGTTTGCTGTCAGATGGCCCGACCCACCAGGTGCTGCAAGTCG AGGCAGACATTCACGGGCCGCCCTCTGTATCTAGCTCATCCTGGT CCATTCCTCATGCATCCGACTTTGATGTGGACAGTTTATCCATAC TTGACACCCTGGAGGGAGCTAGCGTGACCAGCGGGGCAACGTCAG CCGAGACTAACTCTTACTTCGCAAAGAGTATGGAGTTTCTGGCGC GACCGGTGCCTGCGCCTCGAACAGTATTCAGGAACCCTCCACATC CCGCTCCGCGCACAAGAACACCGTCACTTGCACCCAGCAGGGCCT GCTCGAGAACCAGCCTAGTTTCCACCCCGCCAGGCGTGAATAGGG TGATCACTAGAGAGGAGCTCGAGGCGCTTACCCCGTCACGCACTC CTAGCAGGTCGGTCTCGAGAACCAGCCTGGTCTCCAACCCGCCAG GCGTAAATAGGGTGATTACAAGAGAGGAGTTTGAGGCGTTCGTAG CACAACAACAATGACGGTTTGATGCGGGTGCATACATCTTTTCCT CCGACACCGGTCAAGGGCATTTACAACAAAAATCAGTAAGGCAAA CGGTGCTATCCGAAGTGGTGTTGGAGAGGACCGAATTGGAGATTT CGTATGCCCCGCGCCTCGACCAAGAAAAAGAAGAATTACTACGCA AGAAATTACAGTTAAATCCCACACCTGCTAACAGAAGCAGATACC AGTCCAGGAAGGTGGAGAACATGAAAGCCATAACAGCTAGACGTA TTCTGCAAGGCCTAGGGCATTATTTGAAGGCAGAAGGAAAAGTGG AGTGCTACCGAACCCTGCATCCTGTTCCTTTGTATTCATCTAGTG TGAACCGTGCCTTTTCAAGCCCCAAGGTCGCAGTGGAAGCCTGTA ACGCCATGTTGAAAGAGAACTTTCCGACTGTGGCTTCTTACTGTA TTATTCCAGAGTACGATGCCTATTTGGACATGGTTGACGGAGCTT CATGCTGCTTAGACACTGCCAGTTTTTGCCCTGCAAAGCTGCGCA GCTTTCCAAAGAAACACTCCTATTTGGAACCCACAATACGATCGG CAGTGCCTTCAGCGATCCAGAACACGCTCCAGAACGTCCTGGCAG CTGCCACAAAAAGAAATTGCAATGTCACGCAAATGAGAGAATTGC CCGTATTGGATTCGGCGGCCTTTAATGTGGAATGCTTCAAGAAAT ATGCGTGTAATAATGAATATTGGGAAACGTTTAAAGAAAACCCCA TCAGGCTTACTGAAGAAAACGTGGTAAATTACATTACCAAATTAA AAGGACCAAAAGCTGCTGCTCTTTTTGCGAAGACACATAATTTGA ATATGTTGCAGGACATACCAATGGACAGGTTTGTAATGGACTTAA AGAGAGACGTGAAAGTGACTCCAGGAACAAAACATACTGAAGAAC GGCCCAAGGTACAGGTGATCCAGGCTGCCGATCCGCTAGCAACAG CGTATCTGTGCGGAATCCACCGAGAGCTGGTTAGGAGATTAAATG CGGTCCTGCTTCCGAACATTCATACACTGTTTGATATGTCGGCTG AAGACTTTGACGCTATTATAGCCGAGCACTTCCAGCCTGGGGATT GTGTTCTGGAAACTGACATCGCGTCGTTTGATAAAAGTGAGGACG ACGCCATGGCTCTGACCGCGTTAATGATTCTGGAAGACTTAGGTG TGGACGCAGAGCTGTTGACGCTGATTGAGGCGGCTTTCGGCGAAA TTTCATCAATACATTTGCCCACTAAAACTAAATTTAAATTCGGAG CCATGATGAAATCTGGAATGTTCCTCACACTGTTTGTGAACACAG TCATTAACATTGTAATCGCAAGCAGAGTGTTGAGAGAACGGCTAA CCGGATCACCATGTGCAGCATTCATTGGAGATGACAATATCGTGA AAGGAGTCAAATCGGACAAATTAATGGCAGACAGGTGCGCCACCT GGTTGAATATGGAAGTCAAGATTATAGATGCTGTGGTGGGCGAGA AAGCGCCTTATTTCTGTGGAGGGTTTATTTTGTGTGACTCCGTGA CCGGCACAGCGTGCCGTGTGGCAGACCCCCTAAAAAGGCTGTTTA AGCTTGGCAAACCTCTGGCAGCAGACGATGAACATGATGATGACA GGAGAAGGGCATTGCATGAAGAGTCAACACGCTGGAACCGAGTGG GTATTCTTTCAGAGCTGTGCAAGGCAGTAGAATCAAGGTATGAAA CCGTAGGAACTTCCATCATAGTTATGGCCATGACTACTCTAGCTA GCAGTGTTAAATCATTCAGCTACCTGAGAGGGGCCCCTATAACTC TCTACGGCTAACCTGAATGGACTACGACATAGTCTAGTCCGCCAA GATGTTCCCGTTCCAGCCAATGTATCCGATGCAGCCAATGCCCTA TCGCAACCCGTTCGCGGCCCCGCGCAGGCCCTGGTTCCCCAGAAC CGACCCTTTTCTGGCGATGCAGGTGCAGGAATTAACCCGCTCGAT GGCTAACCTGACGTTCAAGCAACGCCGGGACGCGCCACCTGAGGG GCCATCCGCTAAGAAACCGAAGAAGGAGGCCTCGCAAAAACAGAA AGGGGGAGGCCAAGGGAAGAAGAAGAAGAACCAAGGGAAGAAGAA GGCTAAGACAGGGCCGCCTAATCCGAAGGCACAGAATGGAAACAA GAAGAAGACCAACAAGAAACCAGGCAAGAGACAGCGCATGGTCAT GAAATTGGAATCTGACAAGACGTTCCCAATCATGTTGGAAGGGAA GATAAACGGCTACGCTTGTGTGGTCGGAGGGAAGTTATTCAGGCC GATGCATGTGGAAGGCAAGATCGACAACGACGTTCTGGCCGCGCT TAAGACGAAGAAAGCATCCAAATACGATCTTGAGTATGCAGATGT GCCACAGAACATGCGGGCCGATACATTCAAATACACCCATGAGAA ACCCCAAGGCTATTACAGCTGGCATCATGGAGCAGTCCAATATGA AAATGGGCGTTTCACGGTGCCGAAAGGAGTTGGGGCCAAGGGAGA CAGCGGACGACCCATTCTGGATAACCAGGGACGGGTGGTCGCTAT TGTGCTGGGAGGTGTGAATGAAGGATCTAGGACAGCCCTTTCAGT CGTCATGTGGAACGAGAAGGGAGTTACCGTGAAGTATACTCCGGA GAACTGCGAGCAATGGTCACTAGTGACCACCATGTGTCTGCTCGC CAATGTGACGTTCCCATGTGCTCAACCACCAATTTGCTACGACAG AAAACCAGCAGAGACTTTGGCCATGCTCAGCGTTAACGTTGACAA CCCGGGCTACGATGAGCTGCTGGAAGCAGCTGTTAAGTGCCCCGG AAGGAAAAGGAGATCCACCGAGGAGCTGTTTAATGAGTATAAGCT AACGCGCCCTTACATGGCCAGATGCATCAGATGTGCAGTTGGGAG CTGCCATAGTCCAATAGCAATCGAGGCAGTAAAGAGCGACGGGCA CGACGGTTATGTTAGACTTCAGACTTCCTCGCAGTATGGCCTGGA TTCCTCCGGCAACTTAAAGGGCAGGACCATGCGGTATGACATGCA CGGGACCATTAAAGAGATACCACTACATCAAGTGTCACTCTATAC ATCTCGCCCGTGTCACATTGTGGATGGGCACGGTTATTTCCTGCT TGCCAGGTGCCCGGCAGGGGACTCCATCACCATGGAATTTAAGAA AGATTCCGTCAGACACTCCTGCTCGGTGCCGTATGAAGTGAAATT TAATCCTGTAGGCAGAGAACTCTATACTCATCCCCCAGAACACGG AGTAGAGCAAGCGTGCCAAGTCTACGCACATGATGCACAGAACAG AGGAGCTTATGTCGAGATGCACCTCCCGGGCTCAGAAGTGGACAG CAGTTTGGTTTCCTTGAGCGGCAGTTCAGTCACCGTGACACCTCC TGATGGGACTAGCGCCCTGGTGGAATGCGAGTGTGGCGGCACAAA GATCTCCGAGACCATCAACAAGACAAAACAGTTCAGCCAGTGCAC AAAGAAGGAGCAGTGCAGAGCATATCGGCTGCAGAACGATAAGTG GGTGTATAATTCTGACAAACTGCCCAAAGCAGCGGGAGCCACCTT AAAAGGAAAACTGCATGTCCCATTCTTGCTGGCAGACGGCAAATG CACCGTGCCTCTAGCACCAGAACCTATGATAACCTTCGGTTTCAG ATCAGTGTCACTGAAACTGCACCCTAAGAATCCCACATATCTAAT CACCCGCCAACTTGCTGATGAGCCTCACTACACGCACGAGCTCAT ATCTGAACCAGCTGTTAGGAATTTTACCGTCACCGAAAAAGGGTG GGAGTTTGTATGGGGAAACCACCCGCCGAAAAGGTTTTGGGCACA GGAAACAGCACCCGGAAATCCACATGGGCTACCGCACGAGGTGAT AACTCATTATTACCACAGATACCCTATGTCCACCATCCTGGGTTT GTCAATTTGTGCCGCCATTGCAACCGTTTCCGTTGCAGCGTCTAC CTGGCTGTTTTGCAGATCTAGAGTTGCGTGCCTAACTCCTTACCG GCTAACACCTAACGCTAGGATACCATTTTGTCTGGCTGTGCTTTG CTGCGCCCGCACTGCCCGGGCCGAGACCACCTGGGAGTCCTTGGA TCACCTATGGAACAATAACCAACAGATGTTCTGGATTCAATTGCT GATCCCTCTGGCCGCCTTGATCGTAGTGACTCGCCTGCTCAGGTG CGTGTGCTGTGTCGTGCCTTTTTTAGTCATGGCCGGCGCCGCAGG CGCCGGCGCCTACGAGCACGCGACCACGATGCCGAGCCAAGCGGG AATCTCGTATAACACTATAGTCAACAGAGCAGGCTACGCACCACT CCCTATCAGCATAACACCAACAAAGATCAAGCTGATACCTACAGT GAACTTGGAGTACGTCACCTGCCACTACAAAACAGGAATGGATTC ACCAGCCATCAAATGCTGCGGATCTCAGGAATGCACTCCAACTTA CAGGCCTGATGAACAGTGCAAAGTCTTCACAGGGGTTTACCCGTT CATGTGGGGTGGTGCATATTGCTTTTGCGACACTGAGAACACCCA AGTCAGCAAGGCCTACGTAATGAAATCTGACGACTGCCTTGCGGA TCATGCTGAAGCATATAAAGCGCACACAGCCTCAGTGCAGGCGTT CCTCAACATCACAGTGGGAGAACACTCTATTGTGACTACCGTGTA TGTGAATGGAGAAACTCCTGTGAATTTCAATGGGGTCAAAATAAC TGCAGGTCCGCTTTCCACAGCTTGGACACCCTTTGATCGCAAAAT CGTGCAGTATGCCGGGGAGATCTATAATTATGATTTTCCTGAGTA TGGGGCAGGACAACCAGGAGCATTTGGAGATATACAATCCAGAAC AGTCTCAAGCTCTGATCTGTATGCCAATACCAACCTAGTGCTGCA GAGACCCAAAGCAGGAGCGATCCACGTGCCATACACTCAGGCACC TTCGGGTTTTGAGCAATGGAAGAAAGATAAAGCTCCATCATTGAA ATTTACCGCCCCTTTCGGATGCGAAATATATACAAACCCCATTCG CGCCGAAAACTGTGCTGTAGGGTCAATTCCATTAGCCTTTGACAT TCCCGACGCCTTGTTCACCAGGGTGTCAGAAACACCGACACTTTC AGCGGCCGAATGCACTCTTAACGAGTGCGTGTATTCTTCCGACTT TGGTGGGATCGCCACGGTCAAGTACTCGGCCAGCAAGTCAGGCAA GTGCGCAGTCCATGTGCCATCAGGGACTGCTACCCTAAAAGAAGC AGCAGTCGAGCTAACCGAGCAAGGGTCGGCGACTATCCATTTCTC GACCGCAAATATCCACCCGGAGTTCAGGCTCCAAATATGCACATC ATATGTTACGTGCAAAGGTGATTGTCACCCCCCGAAAGACCATAT TGTGACACACCCTCAGTATCACGCCCAAACATTTACAGCCGCGGT GTCAAAAACCGCGTGGACGTGGTTAACATCCCTGCTGGGAGGATC AGCCGTAATTATTATAATTGGCTTGGTGCTGGCTACTATTGTGGC CATGTACGTGCTGACCAACCAGAAACATAATTGAATACAGCAGCA ATTGGCAAGCTGCTTACATAGAACTCGCGGCGATTGGCATGCCGC CTTAAAATTTTTATTTTATTTTTCTTTTCTTTTCCGAATCGGATT TTGTTTTTAATATTTC VEEDeliveryVector(SEQIDNO:6);VEE genomewithnucleotides7544-11175deleted [alphavirusstructuralproteinsremoved] ATGggcggcgcatgagagaagcccagaccaattacctacccaaaA TGGagaaagttcacgttgacatcgaggaagacagcccattcctca gagctttgcagcggagcttcccgcagtttgaggtagaagccaagc aggtcactgataatgaccatgctaatgccagagcgttttcgcatc tggcttcaaaactgatcgaaacggaggtggacccatccgacacga tccttgacattggaagtgcgcccgcccgcagaatgtattctaagc acaagtatcattgtatctgtccgatgagatgtgcggaagatccgg acagattgtataagtatgcaactaagctgaagaaaaactgtaagg aaataactgataaggaattggacaagaaaatgaaggagctcgccg ccgtcatgagcgaccctgacctggaaactgagactatgtgcctcc acgacgacgagtcgtgtcgctacgaagggcaagtcgctgtttacc aggatgtatacgcggttgacggaccgacaagtctctatcaccaag ccaataagggagttagagtcgcctactggataggctttgacacca ccccttttatgtttaagaacttggctggagcatatccatcatact ctaccaactgggccgacgaaaccgtgttaacggctcgtaacatag gcctatgcagctctgacgttatggagcggtcacgtagagggatgt ccattcttagaaagaagtatttgaaaccatccaacaatgttctat tctctgttggctcgaccatctaccacgagaagagggacttactga ggagctggcacctgccgtctgtatttcacttacgtggcaagcaaa attacacatgtcggtgtgagactatagttagttgcgacgggtacg tcgttaaaagaatagctatcagtccaggcctgtatgggaagcctt caggctatgctgctacgatgcaccgcgagggattcttgtgctgca aagtgacagacacattgaacggggagagggtctcttttcccgtgt gcacgtatgtgccagctacattgtgtgaccaaatgactggcatac tggcaacagatgtcagtgcggacgacgcgcaaaaactgctggttg ggctcaaccagcgtatagtcgtcaacggtcgcacccagagaaaca ccaataccatgaaaaattaccttttgcccgtagtggcccaggcat ttgctaggtgggcaaaggaatataaggaagatcaagaagatgaaa ggccactaggactacgagatagacagttagtcatggggtgttgtt gggcttttagaaggcacaagataacatctatttataagcgcccgg atacccaaaccatcatcaaagtgaacagcgatttccactcattcg tgctgcccaggataggcagtaacacattggagatcgggctgagaa caagaatcaggaaaatgttagaggagcacaaggagccgtcacctc tcattaccgccgaggacgtacaagaagctaagtgcgcagccgatg aggctaaggaggtgcgtgaagccgaggagttgcgcgcagctctac cacctttggcagctgatgttgaggagcccactctggaagccgatg tcgacttgatgttacaagaggctggggccggctcagtggagacac ctcgtggcttgataaaggttaccagctacgctggcgaggacaaga tcggctcttacgctgtgctttctccgcaggctgtactcaagagtg aaaaattatcttgcatccaccctctcgctgaacaagtcatagtga taacacactctggccgaaaagggcgttatgccgtggaaccatacc atggtaaagtagtggtgccagagggacatgcaatacccgtccagg actttcaagctctgagtgaaagtgccaccattgtgtacaacgaac gtgagttcgtaaacaggtacctgcaccatattgccacacatggag gagcgctgaacactgatgaagaatattacaaaactgtcaagccca gcgagcacgacggcgaatacctgtacgacatcgacaggaaacagt gcgtcaagaaagaactagtcactgggctagggctcacaggcgagc tggtggatcctcccttccatgaattcgcctacgagagtctgagaa cacgaccagccgctccttaccaagtaccaaccataggggtgtatg gcgtgccaggatcaggcaagtctggcatcattaaaagcgcagtca ccaaaaaagatctagtggtgagcgccaagaaagaaaactgtgcag aaattataagggacgtcaagaaaatgaaagggctggacgtcaatg ccagaactgtggactcagtgctcttgaatggatgcaaacaccccg tagagaccctgtatattgacgaagcttttgcttgtcatgcaggta ctctcagagcgctcatagccattataagacctaaaaaggcagtgc tctgcggggatcccaaacagtgcggtttttttaacatgatgtgcc tgaaagtgcattttaaccacgagatttgcacacaagtcttccaca aaagcatctctcgccgttgcactaaatctgtgacttcggtcgtct caaccttgttttacgacaaaaaaatgagaacgacgaatccgaaag agactaagattgtgattgacactaccggcagtaccaaacctaagc aggacgatctcattctcacttgtttcagaggggggtgaagcagtt gcaaatagattacaaaggcaacgaaataatgacggcagctgcctc tcaagggctgacccgtaaaggtgtgtatgccgttcggtacaaggt gaatgaaaatcctctgtacgcacccacctcagaacatgtgaacgt cctactgacccgcacggaggaccgcatcgtgtggaaaacactagc cggcgacccatggataaaaacactgactgccaagtaccctgggaa tttcactgccacgatagaggagtggcaagcagagcatgatgccat catgaggcacatcttggagagaccggaccctaccgacgtcttcca gaataaggcaaacgtgtgttgggccaaggctttagtgccggtgct gaagaccgctggcatagacatgaccactgaacaatggaacactgt ggattattttgaaacggacaaagctcactcagcagagatagtatt gaaccaactatgcgtgaggttctttggactcgatctggactccgg tctattttctgcacccactgttccgttatccattaggaataatca ctgggataactccccgtcgcctaacatgtacgggctgaataaaga agtggtccgtcagctctctcgcaggtacccacaactgcctcgggc agttgccactggaagagtctatgacatgaacactggtacactgcg caattatgatccgcgcataaacctagtacctgtaaacagaagact gcctcatgctttagtcctccaccataatgaacacccacagagtga cttttcttcattcgtcagcaaattgaagggcagaactgtcctggt ggtcggggaaaagttgtccgtcccaggcaaaatggttgactggtt gtcagaccggcctgaggctaccttcagagctcggctggatttagg catcccaggtgatgtgcccaaatatgacataatatttgttaatgt gaggaccccatataaataccatcactatcagcagtgtgaagacca tgccattaagcttagcatgttgaccaagaaagcttgtctgcatct gaatcccggcggaacctgtgtcagcataggttatggttacgctga cagggccagcgaaagcatcattggtgctatagcgcggcagttcaa gttttcccgggtatgcaaaccgaaatcctcacttgaagagacgga agttctgtttgtattcattgggtacgatcgcaaggcccgtacgca caatccttacaagctttcatcaaccttgaccaacatttatacagg ttccagactccacgaagccggatgtgcaccctcatatcatgtggt gcgaggggatattgccacggccaccgaaggagtgattataaatgc tgctaacagcaaaggacaacctggcggaggggtgtgcggagcgct gtataagaaattcccggaaagcttcgatttacagccgatcgaagt aggaaaagcgcgactggtcaaaggtgcagctaaacatatcattca tgccgtaggaccaaacttcaacaaagtttcggaggttgaaggtga caaacagttggcagaggcttatgagtccatcgctaagattgtcaa cgataacaattacaagtcagtagcgattccactgttgtccaccgg catcttttccgggaacaaagatcgactaacccaatcattgaacca tttgctgacagctttagacaccactgatgcagatgtagccatata ctgcagggacaagaaatgggaaatgactctcaaggaagcagtggc taggagagaagcagtggaggagatatgcatatccgacgactcttc agtgacagaacctgatgcagagctggtgagggtgcatccgaagag ttctttggctggaaggaagggctacagcacaagcgatggcaaaac tttctcatatttggaagggaccaagtttcaccaggcggccaagga tatagcagaaattaatgccatgtggcccgttgcaacggaggccaa tgagcaggtatgcatgtatatcctcggagaaagcatgagcagtat taggtcgaaatgccccgtcgaagagtcggaagcctccacaccacc tagcacgctgccttgcttgtgcatccatgccatgactccagaaag agtacagcgcctaaaagcctcacgtccagaacaaattactgtgtg ctcatcctttccattgccgaagtatagaatcactggtgtgcagaa gatccaatgctcccagcctatattgttctcaccgaaagtgcctgc gtatattcatccaaggaagtatctcgtggaaacaccaccggtaga cgagactccggagccatcggcagagaaccaatccacagaggggac acctgaacaaccaccacttataaccgaggatgagaccaggactag aacgcctgagccgatcatcatcgaagaggaagaagaggatagcat aagtttgctgtcagatggcccgacccaccaggtgctgcaagtcga ggcagacattcacgggccgccctctgtatctagctcatcctggtc cattcctcatgcatccgactttgatgtggacagtttatccatact tgacaccctggagggagctagcgtgaccagcggggcaacgtcagc cgagactaactcttacttcgcaaagagtatggagtttctggcgcg accggtgcctgcgcctcgaacagtattcaggaaccctccacatcc cgctccgcgcacaagaacaccgtcacttgcacccagcagggcctg ctcgagaaccagcctagtttccaccccgccaggcgtgaatagggt gatcactagagaggagctcgaggcgcttaccccgtcacgcactcc tagcaggtcggtctcgagaaccagcctggtctccaacccgccagg cgtaaatagggtgattacaagagaggagtttgaggcgttcgtagc acaacaacaatgacggtttgatgcgggtgcatacatcttttcctc cgacaccggtcaagggcatttacaacaaaaatcagtaaggcaaac ggtgctatccgaagtggtgttggagaggaccgaattggagatttc gtatgccccgcgcctcgaccaagaaaaagaagaattactacgcaa gaaattacagttaaatcccacacctgctaacagaagcagatacca gtccaggaaggtggagaacatgaaagccataacagctagacgtat tctgcaaggcctagggcattatttgaaggcagaaggaaaagtgga gtgctaccgaaccctgcatcctgttcctttgtattcatctagtgt gaaccgtgccttttcaagccccaaggtcgcagtggaagcctgtaa cgccatgttgaaagagaactttccgactgtggcttcttactgtat tattccagagtacgatgcctatttggacatggttgacggagcttc atgctgcttagacactgccagtttttgccctgcaaagctgcgcag ctttccaaagaaacactcctatttggaacccacaatacgatcggc agtgccttcagcgatccagaacacgctccagaacgtcctggcagc tgccacaaaaagaaattgcaatgtcacgcaaatgagagaattgcc cgtattggattcggcggcctttaatgtggaatgcttcaagaaata tgcgtgtaataatgaatattgggaaacgtttaaagaaaaccccat caggcttactgaagaaaacgtggtaaattacattaccaaattaaa aggaccaaaagctgctgctctttttgcgaagacacataatttgaa tatgttgcaggacataccaatggacaggtttgtaatggacttaaa gagagacgtgaaagtgactccaggaacaaaacatactgaagaacg gcccaaggtacaggtgatccaggctgccgatccgctagcaacagc gtatctgtgcggaatccaccgagagctggttaggagattaaatgc ggtcctgcttccgaacattcatacactgtttgatatgtcggctga agactttgacgctattatagccgagcacttccagcctggggattg tgttctggaaactgacatcgcgtcgtttgataaaagtgaggacga cgccatggctctgaccgcgttaatgattctggaagacttaggtgt ggacgcagagctgttgacgctgattgaggcggctttcggcgaaat ttcatcaatacatttgcccactaaaactaaatttaaattcggagc catgatgaaatctggaatgttcctcacactgtttgtgaacacagt cattaacattgtaatcgcaagcagagtgttgagagaacggctaac cggatcaccatgtgcagcattcattggagatgacaatatcgtgaa aggagtcaaatcggacaaattaatggcagacaggtgcgccacctg gttgaatatggaagtcaagattatagatgctgtggtgggcgagaa agcgccttatttctgtggagggtttattttgtgtgactccgtgac cggcacagcgtgccgtgtggcagaccccctaaaaaggctgtttaa gcttggcaaacctctggcagcagacgatgaacatgatgatgacag gagaagggcattgcatgaagagtcaacacgctggaaccgagtggg tattctttcagagctgtgcaaggcagtagaatcaaggtatgaaac cgtaggaacttccatcatagttatggccatgactactctagctag cagtgttaaatcattcagctacctgagaggggcccctataactct ctacggcTAAcctgaatggactacgacgtatcacgcccaaacatt tacagccgcggtgtcaaaaaccgcgtggacgtggttaacatccct gctgggaggatcagccgtaattattataattggcttggtgctggc tactattgtggccatgtacgtgctgaccaaccagaaacataattg aatacagcagcaattggcaagctgcttacatagaactcgcggcga ttggcatgccgccttaaaatttttattttattttttttttctttt ccgaatcggattttgtttttaatatttcAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAA TC-83DeliveryVector(SEQIDNO:7);TC-83 genomewithnucleotides7544-11175deleted [alphavirusstructuralproteinsremoved] ATAGGCGGCGCATGAGAGAAGCCCAGACCAATTACCTACCCAAAA TGGAGAAAGTTCACGTTGACATCGAGGAAGACAGCCCATTCCTCA GAGCTTTGCAGCGGAGCTTCCCGCAGTTTGAGGTAGAAGCCAAGC AGGTCACTGATAATGACCATGCTAATGCCAGAGCGTTTTCGCATC TGGCTTCAAAACTGATCGAAACGGAGGTGGACCCATCCGACACGA TCCTTGACATTGGAAGTGCGCCCGCCCGCAGAATGTATTCTAAGC ACAAGTATCATTGTATCTGTCCGATGAGATGTGCGGAAGATCCGG ACAGATTGTATAAGTATGCAACTAAGCTGAAGAAAAACTGTAAGG AAATAACTGATAAGGAATTGGACAAGAAAATGAAGGAGCTCGCCG CCGTCATGAGCGACCCTGACCTGGAAACTGAGACTATGTGCCTCC ACGACGACGAGTCGTGTCGCTACGAAGGGCAAGTCGCTGTTTACC AGGATGTATACGCGGTTGACGGACCGACAAGTCTCTATCACCAAG CCAATAAGGGAGTTAGAGTCGCCTACTGGATAGGCTTTGACACCA CCCCTTTTATGTTTAAGAACTTGGCTGGAGCATATCCATCATACT CTACCAACTGGGCCGACGAAACCGTGTTAACGGCTCGTAACATAG GCCTATGCAGCTCTGACGTTATGGAGCGGTCACGTAGAGGGATGT CCATTCTTAGAAAGAAGTATTTGAAACCATCCAACAATGTTCTAT TCTCTGTTGGCTCGACCATCTACCACGAGAAGAGGGACTTACTGA GGAGCTGGCACCTGCCGTCTGTATTTCACTTACGTGGCAAGCAAA ATTACACATGTCGGTGTGAGACTATAGTTAGTTGCGACGGGTACG TCGTTAAAAGAATAGCTATCAGTCCAGGCCTGTATGGGAAGCCTT CAGGCTATGCTGCTACGATGCACCGCGAGGGATTCTTGTGCTGCA AAGTGACAGACACATTGAACGGGGAGAGGGTCTCTTTTCCCGTGT GCACGTATGTGCCAGCTACATTGTGTGACCAAATGACTGGCATAC TGGCAACAGATGTCAGTGCGGACGACGCGCAAAAACTGCTGGTTG GGCTCAACCAGCGTATAGTCGTCAACGGTCGCACCCAGAGAAACA CCAATACCATGAAAAATTACCTTTTGCCCGTAGTGGCCCAGGCAT TTGCTAGGTGGGCAAAGGAATATAAGGAAGATCAAGAAGATGAAA GGCCACTAGGACTACGAGATAGACAGTTAGTCATGGGGTGTTGTT GGGCTTTTAGAAGGCACAAGATAACATCTATTTATAAGCGCCCGG ATACCCAAACCATCATCAAAGTGAACAGCGATTTCCACTCATTCG TGCTGCCCAGGATAGGCAGTAACACATTGGAGATCGGGCTGAGAA CAAGAATCAGGAAAATGTTAGAGGAGCACAAGGAGCCGTCACCTC TCATTACCGCCGAGGACGTACAAGAAGCTAAGTGCGCAGCCGATG AGGCTAAGGAGGTGCGTGAAGCCGAGGAGTTGCGCGCAGCTCTAC CACCTTTGGCAGCTGATGTTGAGGAGCCCACTCTGGAAGCCGATG TCGACTTGATGTTACAAGAGGCTGGGGCCGGCTCAGTGGAGACAC CTCGTGGCTTGATAAAGGTTACCAGCTACGATGGCGAGGACAAGA TCGGCTCTTACGCTGTGCTTTCTCCGCAGGCTGTACTCAAGAGTG AAAAATTATCTTGCATCCACCCTCTCGCTGAACAAGTCATAGTGA TAACACACTCTGGCCGAAAAGGGCGTTATGCCGTGGAACCATACC ATGGTAAAGTAGTGGTGCCAGAGGGACATGCAATACCCGTCCAGG ACTTTCAAGCTCTGAGTGAAAGTGCCACCATTGTGTACAACGAAC GTGAGTTCGTAAACAGGTACCTGCACCATATTGCCACACATGGAG GAGCGCTGAACACTGATGAAGAATATTACAAAACTGTCAAGCCCA GCGAGCACGACGGCGAATACCTGTACGACATCGACAGGAAACAGT GCGTCAAGAAAGAACTAGTCACTGGGCTAGGGCTCACAGGCGAGC TGGTGGATCCTCCCTTCCATGAATTCGCCTACGAGAGTCTGAGAA CACGACCAGCCGCTCCTTACCAAGTACCAACCATAGGGGTGTATG GCGTGCCAGGATCAGGCAAGTCTGGCATCATTAAAAGCGCAGTCA CCAAAAAAGATCTAGTGGTGAGCGCCAAGAAAGAAAACTGTGCAG AAATTATAAGGGACGTCAAGAAAATGAAAGGGCTGGACGTCAATG CCAGAACTGTGGACTCAGTGCTCTTGAATGGATGCAAACACCCCG TAGAGACCCTGTATATTGACGAAGCTTTTGCTTGTCATGCAGGTA CTCTCAGAGCGCTCATAGCCATTATAAGACCTAAAAAGGCAGTGC TCTGCGGGGATCCCAAACAGTGCGGTTTTTTTAACATGATGTGCC TGAAAGTGCATTTTAACCACGAGATTTGCACACAAGTCTTCCACA AAAGCATCTCTCGCCGTTGCACTAAATCTGTGACTTCGGTCGTCT CAACCTTGTTTTACGACAAAAAAATGAGAACGACGAATCCGAAAG AGACTAAGATTGTGATTGACACTACCGGCAGTACCAAACCTAAGC AGGACGATCTCATTCTCACTTGTTTCAGAGGGTGGGTGAAGCAGT TGCAAATAGATTACAAAGGCAACGAAATAATGACGGCAGCTGCCT CTCAAGGGCTGACCCGTAAAGGTGTGTATGCCGTTCGGTACAAGG TGAATGAAAATCCTCTGTACGCACCCACCTCAGAACATGTGAACG TCCTACTGACCCGCACGGAGGACCGCATCGTGTGGAAAACACTAG CCGGCGACCCATGGATAAAAACACTGACTGCCAAGTACCCTGGGA ATTTCACTGCCACGATAGAGGAGTGGCAAGCAGAGCATGATGCCA TCATGAGGCACATCTTGGAGAGACCGGACCCTACCGACGTCTTCC AGAATAAGGCAAACGTGTGTTGGGCCAAGGCTTTAGTGCCGGTGC TGAAGACCGCTGGCATAGACATGACCACTGAACAATGGAACACTG TGGATTATTTTGAAACGGACAAAGCTCACTCAGCAGAGATAGTAT TGAACCAACTATGCGTGAGGTTCTTTGGACTCGATCTGGACTCCG GTCTATTTTCTGCACCCACTGTTCCGTTATCCATTAGGAATAATC ACTGGGATAACTCCCCGTCGCCTAACATGTACGGGCTGAATAAAG AAGTGGTCCGTCAGCTCTCTCGCAGGTACCCACAACTGCCTCGGG CAGTTGCCACTGGAAGAGTCTATGACATGAACACTGGTACACTGC GCAATTATGATCCGCGCATAAACCTAGTACCTGTAAACAGAAGAC TGCCTCATGCTTTAGTCCTCCACCATAATGAACACCCACAGAGTG ACTTTTCTTCATTCGTCAGCAAATTGAAGGGCAGAACTGTCCTGG TGGTCGGGGAAAAGTTGTCCGTCCCAGGCAAAATGGTTGACTGGT TGTCAGACCGGCCTGAGGCTACCTTCAGAGCTCGGCTGGATTTAG GCATCCCAGGTGATGTGCCCAAATATGACATAATATTTGTTAATG TGAGGACCCCATATAAATACCATCACTATCAGCAGTGTGAAGACC ATGCCATTAAGCTTAGCATGTTGACCAAGAAAGCTTGTCTGCATC TGAATCCCGGCGGAACCTGTGTCAGCATAGGTTATGGTTACGCTG ACAGGGCCAGCGAAAGCATCATTGGTGCTATAGCGCGGCAGTTCA AGTTTTCCCGGGTATGCAAACCGAAATCCTCACTTGAAGAGACGG AAGTTCTGTTTGTATTCATTGGGTACGATCGCAAGGCCCGTACGC ACAATCCTTACAAGCTTTCATCAACCTTGACCAACATTTATACAG GTTCCAGACTCCACGAAGCCGGATGTGCACCCTCATATCATGTGG TGCGAGGGGATATTGCCACGGCCACCGAAGGAGTGATTATAAATG CTGCTAACAGCAAAGGACAACCTGGCGGAGGGGTGTGCGGAGCGC TGTATAAGAAATTCCCGGAAAGCTTCGATTTACAGCCGATCGAAG TAGGAAAAGCGCGACTGGTCAAAGGTGCAGCTAAACATATCATTC ATGCCGTAGGACCAAACTTCAACAAAGTTTCGGAGGTTGAAGGTG ACAAACAGTTGGCAGAGGCTTATGAGTCCATCGCTAAGATTGTCA ACGATAACAATTACAAGTCAGTAGCGATTCCACTGTTGTCCACCG GCATCTTTTCCGGGAACAAAGATCGACTAACCCAATCATTGAACC ATTTGCTGACAGCTTTAGACACCACTGATGCAGATGTAGCCATAT ACTGCAGGGACAAGAAATGGGAAATGACTCTCAAGGAAGCAGTGG CTAGGAGAGAAGCAGTGGAGGAGATATGCATATCCGACGACTCTT CAGTGACAGAACCTGATGCAGAGCTGGTGAGGGTGCATCCGAAGA GTTCTTTGGCTGGAAGGAAGGGCTACAGCACAAGCGATGGCAAAA CTTTCTCATATTTGGAAGGGACCAAGTTTCACCAGGCGGCCAAGG ATATAGCAGAAATTAATGCCATGTGGCCCGTTGCAACGGAGGCCA ATGAGCAGGTATGCATGTATATCCTCGGAGAAAGCATGAGCAGTA TTAGGTCGAAATGCCCCGTCGAAGAGTCGGAAGCCTCCACACCAC CTAGCACGCTGCCTTGCTTGTGCATCCATGCCATGACTCCAGAAA GAGTACAGCGCCTAAAAGCCTCACGTCCAGAACAAATTACTGTGT GCTCATCCTTTCCATTGCCGAAGTATAGAATCACTGGTGTGCAGA AGATCCAATGCTCCCAGCCTATATTGTTCTCACCGAAAGTGCCTG CGTATATTCATCCAAGGAAGTATCTCGTGGAAACACCACCGGTAG ACGAGACTCCGGAGCCATCGGCAGAGAACCAATCCACAGAGGGGA CACCTGAACAACCACCACTTATAACCGAGGATGAGACCAGGACTA GAACGCCTGAGCCGATCATCATCGAAGAGGAAGAAGAGGATAGCA TAAGTTTGCTGTCAGATGGCCCGACCCACCAGGTGCTGCAAGTCG AGGCAGACATTCACGGGCCGCCCTCTGTATCTAGCTCATCCTGGT CCATTCCTCATGCATCCGACTTTGATGTGGACAGTTTATCCATAC TTGACACCCTGGAGGGAGCTAGCGTGACCAGCGGGGCAACGTCAG CCGAGACTAACTCTTACTTCGCAAAGAGTATGGAGTTTCTGGCGC GACCGGTGCCTGCGCCTCGAACAGTATTCAGGAACCCTCCACATC CCGCTCCGCGCACAAGAACACCGTCACTTGCACCCAGCAGGGCCT GCTCGAGAACCAGCCTAGTTTCCACCCCGCCAGGCGTGAATAGGG TGATCACTAGAGAGGAGCTCGAGGCGCTTACCCCGTCACGCACTC CTAGCAGGTCGGTCTCGAGAACCAGCCTGGTCTCCAACCCGCCAG GCGTAAATAGGGTGATTACAAGAGAGGAGTTTGAGGCGTTCGTAG CACAACAACAATGACGGTTTGATGCGGGTGCATACATCTTTTCCT CCGACACCGGTCAAGGGCATTTACAACAAAAATCAGTAAGGCAAA CGGTGCTATCCGAAGTGGTGTTGGAGAGGACCGAATTGGAGATTT CGTATGCCCCGCGCCTCGACCAAGAAAAAGAAGAATTACTACGCA AGAAATTACAGTTAAATCCCACACCTGCTAACAGAAGCAGATACC AGTCCAGGAAGGTGGAGAACATGAAAGCCATAACAGCTAGACGTA TTCTGCAAGGCCTAGGGCATTATTTGAAGGCAGAAGGAAAAGTGG AGTGCTACCGAACCCTGCATCCTGTTCCTTTGTATTCATCTAGTG TGAACCGTGCCTTTTCAAGCCCCAAGGTCGCAGTGGAAGCCTGTA ACGCCATGTTGAAAGAGAACTTTCCGACTGTGGCTTCTTACTGTA TTATTCCAGAGTACGATGCCTATTTGGACATGGTTGACGGAGCTT CATGCTGCTTAGACACTGCCAGTTTTTGCCCTGCAAAGCTGCGCA GCTTTCCAAAGAAACACTCCTATTTGGAACCCACAATACGATCGG CAGTGCCTTCAGCGATCCAGAACACGCTCCAGAACGTCCTGGCAG CTGCCACAAAAAGAAATTGCAATGTCACGCAAATGAGAGAATTGC CCGTATTGGATTCGGCGGCCTTTAATGTGGAATGCTTCAAGAAAT ATGCGTGTAATAATGAATATTGGGAAACGTTTAAAGAAAACCCCA TCAGGCTTACTGAAGAAAACGTGGTAAATTACATTACCAAATTAA AAGGACCAAAAGCTGCTGCTCTTTTTGCGAAGACACATAATTTGA ATATGTTGCAGGACATACCAATGGACAGGTTTGTAATGGACTTAA AGAGAGACGTGAAAGTGACTCCAGGAACAAAACATACTGAAGAAC GGCCCAAGGTACAGGTGATCCAGGCTGCCGATCCGCTAGCAACAG CGTATCTGTGCGGAATCCACCGAGAGCTGGTTAGGAGATTAAATG CGGTCCTGCTTCCGAACATTCATACACTGTTTGATATGTCGGCTG AAGACTTTGACGCTATTATAGCCGAGCACTTCCAGCCTGGGGATT GTGTTCTGGAAACTGACATCGCGTCGTTTGATAAAAGTGAGGACG ACGCCATGGCTCTGACCGCGTTAATGATTCTGGAAGACTTAGGTG TGGACGCAGAGCTGTTGACGCTGATTGAGGCGGCTTTCGGCGAAA TTTCATCAATACATTTGCCCACTAAAACTAAATTTAAATTCGGAG CCATGATGAAATCTGGAATGTTCCTCACACTGTTTGTGAACACAG TCATTAACATTGTAATCGCAAGCAGAGTGTTGAGAGAACGGCTAA CCGGATCACCATGTGCAGCATTCATTGGAGATGACAATATCGTGA AAGGAGTCAAATCGGACAAATTAATGGCAGACAGGTGCGCCACCT GGTTGAATATGGAAGTCAAGATTATAGATGCTGTGGTGGGCGAGA AAGCGCCTTATTTCTGTGGAGGGTTTATTTTGTGTGACTCCGTGA CCGGCACAGCGTGCCGTGTGGCAGACCCCCTAAAAAGGCTGTTTA AGCTTGGCAAACCTCTGGCAGCAGACGATGAACATGATGATGACA GGAGAAGGGCATTGCATGAAGAGTCAACACGCTGGAACCGAGTGG GTATTCTTTCAGAGCTGTGCAAGGCAGTAGAATCAAGGTATGAAA CCGTAGGAACTTCCATCATAGTTATGGCCATGACTACTCTAGCTA GCAGTGTTAAATCATTCAGCTACCTGAGAGGGGCCCCTATAACTC TCTACGGCTAACCTGAATGGACTACGACATAGTCTAGTCCGCCAA GATGTTCCCGTTCCAGCCAATGTATCCGATGCAGCCAATGCCCTA TCGCAACCCGTTCGCGGCCCCGCGCAGGCCCTGGTTCCCCAGAAC CGACCCTTTTCTGGCGATGCAGGTGCAGGAATTAACCCGCTCGAT GGCTAACCTGACGTTCAAGCAACGCCGGGACGCGCCACCTGAGGG GCCATCCGCTAAGAAACCGAAGAAGGAGGCCTCGCAAAAACAGAA AGGGGGAGGCCAAGGGAAGAAGAAGAAGAACCAAGGGAAGAAGAA GGCTAAGACAGGGCCGCCTAATCCGAAGGCACAGAATGGAAACAA GAAGAAGACCAACAAGAAACCAGGCAAGAGACAGCGCATGGTCAT GAAATTGGAATCTGACAAGACGTTCCCAATCATGTTGGAAGGGAA GATAAACGGCTACGCTTGTGTGGTCGGAGGGAAGTTATTCAGGCC GATGCATGTGGAAGGCAAGATCGACAACGACGTTCTGGCCGCGCT TAAGACGAAGAAAGCATCCAAATACGATCTTGAGTATGCAGATGT GCCACAGAACATGCGGGCCGATACATTCAAATACACCCATGAGAA ACCCCAAGGCTATTACAGCTGGCATCATGGAGCAGTCCAATATGA AAATGGGCGTTTCACGGTGCCGAAAGGAGTTGGGGCCAAGGGAGA CAGCGGACGACCCATTCTGGATAACCAGGGACGGGTGGTCGCTAT TGTGCTGGGAGGTGTGAATGAAGGATCTAGGACAGCCCTTTCAGT CGTCATGTGGAACGAGAAGGGAGTTACCGTGAAGTATACTCCGGA GAACTGCGAGCAATGGTCACTAGTGACCACCATGTGTCTGCTCGC CAATGTGACGTTCCCATGTGCTCAACCACCAATTTGCTACGACAG AAAACCAGCAGAGACTTTGGCCATGCTCAGCGTTAACGTTGACAA CCCGGGCTACGATGAGCTGCTGGAAGCAGCTGTTAAGTGCCCCGG AAGGAAAAGGAGATCCACCGAGGAGCTGTTTAATGAGTATAAGCT AACGCGCCCTTACATGGCCAGATGCATCAGATGTGCAGTTGGGAG CTGCCATAGTCCAATAGCAATCGAGGCAGTAAAGAGCGACGGGCA CGACGGTTATGTTAGACTTCAGACTTCCTCGCAGTATGGCCTGGA TTCCTCCGGCAACTTAAAGGGCAGGACCATGCGGTATGACATGCA CGGGACCATTAAAGAGATACCACTACATCAAGTGTCACTCTATAC ATCTCGCCCGTGTCACATTGTGGATGGGCACGGTTATTTCCTGCT TGCCAGGTGCCCGGCAGGGGACTCCATCACCATGGAATTTAAGAA AGATTCCGTCAGACACTCCTGCTCGGTGCCGTATGAAGTGAAATT TAATCCTGTAGGCAGAGAACTCTATACTCATCCCCCAGAACACGG AGTAGAGCAAGCGTGCCAAGTCTACGCACATGATGCACAGAACAG AGGAGCTTATGTCGAGATGCACCTCCCGGGCTCAGAAGTGGACAG CAGTTTGGTTTCCTTGAGCGGCAGTTCAGTCACCGTGACACCTCC TGATGGGACTAGCGCCCTGGTGGAATGCGAGTGTGGCGGCACAAA GATCTCCGAGACCATCAACAAGACAAAACAGTTCAGCCAGTGCAC AAAGAAGGAGCAGTGCAGAGCATATCGGCTGCAGAACGATAAGTG GGTGTATAATTCTGACAAACTGCCCAAAGCAGCGGGAGCCACCTT AAAAGGAAAACTGCATGTCCCATTCTTGCTGGCAGACGGCAAATG CACCGTGCCTCTAGCACCAGAACCTATGATAACCTTCGGTTTCAG ATCAGTGTCACTGAAACTGCACCCTAAGAATCCCACATATCTAAT CACCCGCCAACTTGCTGATGAGCCTCACTACACGCACGAGCTCAT ATCTGAACCAGCTGTTAGGAATTTTACCGTCACCGAAAAAGGGTG GGAGTTTGTATGGGGAAACCACCCGCCGAAAAGGTTTTGGGCACA GGAAACAGCACCCGGAAATCCACATGGGCTACCGCACGAGGTGAT AACTCATTATTACCACAGATACCCTATGTCCACCATCCTGGGTTT GTCAATTTGTGCCGCCATTGCAACCGTTTCCGTTGCAGCGTCTAC CTGGCTGTTTTGCAGATCTAGAGTTGCGTGCCTAACTCCTTACCG GCTAACACCTAACGCTAGGATACCATTTTGTCTGGCTGTGCTTTG CTGCGCCCGCACTGCCCGGGCCGAGACCACCTGGGAGTCCTTGGA TCACCTATGGAACAATAACCAACAGATGTTCTGGATTCAATTGCT GATCCCTCTGGCCGCCTTGATCGTAGTGACTCGCCTGCTCAGGTG CGTGTGCTGTGTCGTGCCTTTTTTAGTCATGGCCGGCGCCGCAGG CGCCGGCGCCTACGAGCACGCGACCACGATGCCGAGCCAAGCGGG AATCTCGTATAACACTATAGTCAACAGAGCAGGCTACGCACCACT CCCTATCAGCATAACACCAACAAAGATCAAGCTGATACCTACAGT GAACTTGGAGTACGTCACCTGCCACTACAAAACAGGAATGGATTC ACCAGCCATCAAATGCTGCGGATCTCAGGAATGCACTCCAACTTA CAGGCCTGATGAACAGTGCAAAGTCTTCACAGGGGTTTACCCGTT CATGTGGGGTGGTGCATATTGCTTTTGCGACACTGAGAACACCCA AGTCAGCAAGGCCTACGTAATGAAATCTGACGACTGCCTTGCGGA TCATGCTGAAGCATATAAAGCGCACACAGCCTCAGTGCAGGCGTT CCTCAACATCACAGTGGGAGAACACTCTATTGTGACTACCGTGTA TGTGAATGGAGAAACTCCTGTGAATTTCAATGGGGTCAAAATAAC TGCAGGTCCGCTTTCCACAGCTTGGACACCCTTTGATCGCAAAAT CGTGCAGTATGCCGGGGAGATCTATAATTATGATTTTCCTGAGTA TGGGGCAGGACAACCAGGAGCATTTGGAGATATACAATCCAGAAC AGTCTCAAGCTCTGATCTGTATGCCAATACCAACCTAGTGCTGCA GAGACCCAAAGCAGGAGCGATCCACGTGCCATACACTCAGGCACC TTCGGGTTTTGAGCAATGGAAGAAAGATAAAGCTCCATCATTGAA ATTTACCGCCCCTTTCGGATGCGAAATATATACAAACCCCATTCG CGCCGAAAACTGTGCTGTAGGGTCAATTCCATTAGCCTTTGACAT TCCCGACGCCTTGTTCACCAGGGTGTCAGAAACACCGACACTTTC AGCGGCCGAATGCACTCTTAACGAGTGCGTGTATTCTTCCGACTT TGGTGGGATCGCCACGGTCAAGTACTCGGCCAGCAAGTCAGGCAA GTGCGCAGTCCATGTGCCATCAGGGACTGCTACCCTAAAAGAAGC AGCAGTCGAGCTAACCGAGCAAGGGTCGGCGACTATCCATTTCTC GACCGCAAATATCCACCCGGAGTTCAGGCTCCAAATATGCACATC ATATGTTACGTGCAAAGGTGATTGTCACCCCCCGAAAGACCATAT TGTGACACACCCTCAGTATCACGCCCAAACATTTACAGCCGCGGT GTCAAAAACCGCGTGGACGTGGTTAACATCCCTGCTGGGAGGATC AGCCGTAATTATTATAATTGGCTTGGTGCTGGCTACTATTGTGGC CATGTACGTGCTGACCAACCAGAAACATAATTGAATACAGCAGCA ATTGGCAAGCTGCTTACATAGAACTCGCGGCGATTGGCATGCCGC CTTAAAATTTTTATTTTATTTTTCTTTTCTTTTCCGAATCGGATT TTGTTTTTAATATTTC VEEProductionVector(SEQIDNO:8);VEE genomewithnucleotides7544-11175deleted, plus5T7-promoter,plus3restriction sites TAATACGACTCACTATAGGATGggcggcgcatgagagaagcccag accaattacctacccaaaATGGagaaagttcacgttgacatcgag gaagacagcccattcctcagagctttgcagcggagcttcccgcag tttgaggtagaagccaagcaggtcactgataatgaccatgctaat gccagagcgttttcgcatctggcttcaaaactgatcgaaacggag gtggacccatccgacacgatccttgacattggaagtgcgcccgcc cgcagaatgtattctaagcacaagtatcattgtatctgtccgatg agatgtgcggaagatccggacagattgtataagtatgcaactaag ctgaagaaaaactgtaaggaaataactgataaggaattggacaag aaaatgaaggagctcgccgccgtcatgagcgaccctgacctggaa actgagactatgtgcctccacgacgacgagtcgtgtcgctacgaa gggcaagtcgctgtttaccaggatgtatacgcggttgacggaccg acaagtctctatcaccaagccaataagggagttagagtcgcctac tggataggctttgacaccaccccttttatgtttaagaacttggct ggagcatatccatcatactctaccaactgggccgacgaaaccgtg ttaacggctcgtaacataggcctatgcagctctgacgttatggag cggtcacgtagagggatgtccattcttagaaagaagtatttgaaa ccatccaacaatgttctattctctgttggctcgaccatctaccac gagaagagggacttactgaggagctggcacctgccgtctgtattt cacttacgtggcaagcaaaattacacatgtcggtgtgagactata gttagttgcgacgggtacgtcgttaaaagaatagctatcagtcca ggcctgtatgggaagccttcaggctatgctgctacgatgcaccgc gagggattcttgtgctgcaaagtgacagacacattgaacggggag agggtctcttttcccgtgtgcacgtatgtgccagctacattgtgt gaccaaatgactggcatactggcaacagatgtcagtgcggacgac gcgcaaaaactgctggttgggctcaaccagcgtatagtcgtcaac ggtcgcacccagagaaacaccaataccatgaaaaattaccttttg cccgtagtggcccaggcatttgctaggtgggcaaaggaatataag gaagatcaagaagatgaaaggccactaggactacgagatagacag ttagtcatggggtgttgttgggcttttagaaggcacaagataaca tctatttataagcgcccggatacccaaaccatcatcaaagtgaac agcgatttccactcattcgtgctgcccaggataggcagtaacaca ttggagatcgggctgagaacaagaatcaggaaaatgttagaggag cacaaggagccgtcacctctcattaccgccgaggacgtacaagaa gctaagtgcgcagccgatgaggctaaggaggtgcgtgaagccgag gagttgcgcgcagctctaccacctttggcagctgatgttgaggag cccactctggaagccgatgtcgacttgatgttacaagaggctggg gccggctcagtggagacacctcgtggcttgataaaggttaccagc tacgctggcgaggacaagatcggctcttacgctgtgctttctccg caggctgtactcaagagtgaaaaattatcttgcatccaccctctc gctgaacaagtcatagtgataacacactctggccgaaaagggcgt tatgccgtggaaccataccatggtaaagtagtggtgccagaggga catgcaatacccgtccaggactttcaagctctgagtgaaagtgcc accattgtgtacaacgaacgtgagttcgtaaacaggtacctgcac catattgccacacatggaggagcgctgaacactgatgaagaatat tacaaaactgtcaagcccagcgagcacgacggcgaatacctgtac gacatcgacaggaaacagtgcgtcaagaaagaactagtcactggg ctagggctcacaggcgagctggtggatcctcccttccatgaattc gcctacgagagtctgagaacacgaccagccgctccttaccaagta ccaaccataggggtgtatggcgtgccaggatcaggcaagtctggc atcattaaaagcgcagtcaccaaaaaagatctagtggtgagcgcc aagaaagaaaactgtgcagaaattataagggacgtcaagaaaatg aaagggctggacgtcaatgccagaactgtggactcagtgctcttg aatggatgcaaacaccccgtagagaccctgtatattgacgaagct tttgcttgtcatgcaggtactctcagagcgctcatagccattata agacctaaaaaggcagtgctctgcggggatcccaaacagtgcggt ttttttaacatgatgtgcctgaaagtgcattttaaccacgagatt tgcacacaagtcttccacaaaagcatctctcgccgttgcactaaa tctgtgacttcggtcgtctcaaccttgttttacgacaaaaaaatg agaacgacgaatccgaaagagactaagattgtgattgacactacc ggcagtaccaaacctaagcaggacgatctcattctcacttgtttc agaggggggtgaagcagttgcaaatagattacaaaggcaacgaaa taatgacggcagctgcctctcaagggctgacccgtaaaggtgtgt atgccgttcggtacaaggtgaatgaaaatcctctgtacgcaccca cctcagaacatgtgaacgtcctactgacccgcacggaggaccgca tcgtgtggaaaacactagccggcgacccatggataaaaacactga ctgccaagtaccctgggaatttcactgccacgatagaggagtggc aagcagagcatgatgccatcatgaggcacatcttggagagaccgg accctaccgacgtcttccagaataaggcaaacgtgtgttgggcca aggctttagtgccggtgctgaagaccgctggcatagacatgacca ctgaacaatggaacactgtggattattttgaaacggacaaagctc actcagcagagatagtattgaaccaactatgcgtgaggttctttg gactcgatctggactccggtctattttctgcacccactgttccgt tatccattaggaataatcactgggataactccccgtcgcctaaca tgtacgggctgaataaagaagtggtccgtcagctctctcgcaggt acccacaactgcctcgggcagttgccactggaagagtctatgaca tgaacactggtacactgcgcaattatgatccgcgcataaacctag tacctgtaaacagaagactgcctcatgctttagtcctccaccata atgaacacccacagagtgacttttcttcattcgtcagcaaattga agggcagaactgtcctggtggtcggggaaaagttgtccgtcccag gcaaaatggttgactggttgtcagaccggcctgaggctaccttca gagctcggctggatttaggcatcccaggtgatgtgcccaaatatg acataatatttgttaatgtgaggaccccatataaataccatcact atcagcagtgtgaagaccatgccattaagcttagcatgttgacca agaaagcttgtctgcatctgaatcccggcggaacctgtgtcagca taggttatggttacgctgacagggccagcgaaagcatcattggtg ctatagcgcggcagttcaagttttcccgggtatgcaaaccgaaat cctcacttgaagagacggaagttctgtttgtattcattgggtacg atcgcaaggcccgtacgcacaatccttacaagctttcatcaacct tgaccaacatttatacaggttccagactccacgaagccggatgtg caccctcatatcatgtggtgcgaggggatattgccacggccaccg aaggagtgattataaatgctgctaacagcaaaggacaacctggcg gaggggtgtgcggagcgctgtataagaaattcccggaaagcttcg atttacagccgatcgaagtaggaaaagcgcgactggtcaaaggtg cagctaaacatatcattcatgccgtaggaccaaacttcaacaaag tttcggaggttgaaggtgacaaacagttggcagaggcttatgag tccatcgctaagattgtcaacgataacaattacaagtcagtagcg attccactgttgtccaccggcatcttttccgggaacaaagatcga ctaacccaatcattgaaccatttgctgacagctttagacaccact gatgcagatgtagccatatactgcagggacaagaaatgggaaatg actctcaaggaagcagtggctaggagagaagcagtggaggagata tgcatatccgacgactcttcagtgacagaacctgatgcagagctg gtgagggtgcatccgaagagttctttggctggaaggaagggctac agcacaagcgatggcaaaactttctcatatttggaagggaccaag tttcaccaggggccaaggatatagcagaaattaatgccatgtggc ccgttgcaacggaggccaatgagcaggtatgcatgtatatcctcg gagaaagcatgagcagtattaggtcgaaatgccccgtcgaagagt cggaagcctccacaccacctagcacgctgccttgcttgtgcatcc atgccatgactccagaaagagtacagcgcctaaaagcctcacgtc cagaacaaattactgtgtgctcatcctttccattgccgaagtata gaatcactggtgtgcagaagatccaatgctcccagcctatattgt tctcaccgaaagtgcctgcgtatattcatccaaggaagtatctcg tggaaacaccaccggtagacgagactccggagccatcggcagaga accaatccacagaggggacacctgaacaaccaccacttataaccg aggatgagaccaggactagaacgcctgagccgatcatcatcgaag aggaagaagaggatagcataagtttgctgtcagatggcccgaccc accaggtgctgcaagtcgaggcagacattcacgggccgccctctg tatctagctcatcctggtccattcctcatgcatccgactttgatg tggacagtttatccatacttgacaccctggagggagctagcgtga ccagcggggcaacgtcagccgagactaactcttacttcgcaaaga gtatggagtttctggcgcgaccggtgcctgcgcctcgaacagtat tcaggaaccctccacatcccgctccgcgcacaagaacaccgtcac ttgcacccagcagggcctgctcgagaaccagcctagtttccaccc cgccaggcgtgaatagggtgatcactagagaggagctcgaggcgc ttaccccgtcacgcactcctagcaggtcggtctcgagaaccagcc tggtctccaacccgccaggcgtaaatagggtgattacaagagagg agtttgaggcgttcgtagcacaacaacaatgacggtttgatgcgg gtgcatacatcttttcctccgacaccggtcaagggcatttacaac aaaaatcagtaaggcaaacggtgctatccgaagtggtgttggaga ggaccgaattggagatttcgtatgccccgcgcctcgaccaagaaa aagaagaattactacgcaagaaattacagttaaatcccacacctg ctaacagaagcagataccagtccaggaaggtggagaacatgaaag ccataacagctagacgtattctgcaaggcctagggcattatttga aggcagaaggaaaagtggagtgctaccgaaccctgcatcctgttc ctttgtattcatctagtgtgaaccgtgccttttcaagccccaagg tcgcagtggaagcctgtaacgccatgttgaaagagaactttccga ctgtggcttcttactgtattattccagagtacgatgcctatttgg acatggttgacggagcttcatgctgcttagacactgccagttttt gccctgcaaagctgcgcagctttccaaagaaacactcctatttgg aacccacaatacgatcggcagtgccttcagcgatccagaacacgc tccagaacgtcctggcagctgccacaaaaagaaattgcaatgtca cgcaaatgagagaattgcccgtattggattcggcggcctttaatg tggaatgcttcaagaaatatgcgtgtaataatgaatattgggaaa cgtttaaagaaaaccccatcaggcttactgaagaaaacgtggtaa attacattaccaaattaaaaggaccaaaagctgctgctctttttg cgaagacacataatttgaatatgttgcaggacataccaatggaca ggtttgtaatggacttaaagagagacgtgaaagtgactccaggaa caaaacatactgaagaacggcccaaggtacaggtgatccaggctg ccgatccgctagcaacagcgtatctgtgcggaatccaccgagagc tggttaggagattaaatgcggtcctgcttccgaacattcatacac tgtttgatatgtcggctgaagactttgacgctattatagccgagc acttccagcctggggattgtgttctggaaactgacatcgcgtcgt ttgataaaagtgaggacgacgccatggctctgaccgcgttaatga ttctggaagacttaggtgtggacgcagagctgttgacgctgattg aggcggctttcggcgaaatttcatcaatacatttgcccactaaaa ctaaatttaaattcggagccatgatgaaatctggaatgttcctca cactgtttgtgaacacagtcattaacattgtaatcgcaagcagag tgttgagagaacggctaaccggatcaccatgtgcagcattcattg gagatgacaatatcgtgaaaggagtcaaatcggacaaattaatgg cagacaggtgcgccacctggttgaatatggaagtcaagattatag atgctgtggtgggcgagaaagcgccttatttctgtggagggttta ttttgtgtgactccgtgaccggcacagcgtgccgtgtggcagacc ccctaaaaaggctgtttaagcttggcaaacctctggcagcagacg atgaacatgatgatgacaggagaagggcattgcatgaagagtcaa cacgctggaaccgagtgggtattctttcagagctgtgcaaggcag tagaatcaaggtatgaaaccgtaggaacttccatcatagttatgg ccatgactactctagctagcagtgttaaatcattcagctacctga gaggggcccctataactctctacggcTAAcctgaatggactacga cgtatcacgcccaaacatttacagccgcggtgtcaaaaaccgcgt ggacgtggttaacatccctgctgggaggatcagccgtaattatta taattggcttggtgctggctactattgtggccatgtacgtgctga ccaaccagaaacataattgaatacagcagcaattggcaagctgct tacatagaactcgcggcgattggcatgccgccttaaaatttttat tttattttttcttttcttttccgaatcggattttgtttttaatat ttcAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA TC-83ProductionVector(SEQIDNO:9); TC-83genomewithnucleotides7544-11175 deleted,plus5T7-promoter, plus3restrictionsites ATAGGCGGCGCATGAGAGAAGCCCAGACCAATTACCTACCCAAAA TGGAGAAAGTTCACGTTGACATCGAGGAAGACAGCCCATTCCTCA GAGCTTTGCAGCGGAGCTTCCCGCAGTTTGAGGTAGAAGCCAAGC AGGTCACTGATAATGACCATGCTAATGCCAGAGCGTTTTCGCATC TGGCTTCAAAACTGATCGAAACGGAGGTGGACCCATCCGACACGA TCCTTGACATTGGAAGTGCGCCCGCCCGCAGAATGTATTCTAAGC ACAAGTATCATTGTATCTGTCCGATGAGATGTGCGGAAGATCCGG ACAGATTGTATAAGTATGCAACTAAGCTGAAGAAAAACTGTAAGG AAATAACTGATAAGGAATTGGACAAGAAAATGAAGGAGCTCGCCG CCGTCATGAGCGACCCTGACCTGGAAACTGAGACTATGTGCCTCC ACGACGACGAGTCGTGTCGCTACGAAGGGCAAGTCGCTGTTTACC AGGATGTATACGCGGTTGACGGACCGACAAGTCTCTATCACCAAG CCAATAAGGGAGTTAGAGTCGCCTACTGGATAGGCTTTGACACCA CCCCTTTTATGTTTAAGAACTTGGCTGGAGCATATCCATCATACT CTACCAACTGGGCCGACGAAACCGTGTTAACGGCTCGTAACATAG GCCTATGCAGCTCTGACGTTATGGAGCGGTCACGTAGAGGGATGT CCATTCTTAGAAAGAAGTATTTGAAACCATCCAACAATGTTCTAT TCTCTGTTGGCTCGACCATCTACCACGAGAAGAGGGACTTACTGA GGAGCTGGCACCTGCCGTCTGTATTTCACTTACGTGGCAAGCAAA ATTACACATGTCGGTGTGAGACTATAGTTAGTTGCGACGGGTACG TCGTTAAAAGAATAGCTATCAGTCCAGGCCTGTATGGGAAGCCTT CAGGCTATGCTGCTACGATGCACCGCGAGGGATTCTTGTGCTGCA AAGTGACAGACACATTGAACGGGGAGAGGGTCTCTTTTCCCGTGT GCACGTATGTGCCAGCTACATTGTGTGACCAAATGACTGGCATAC TGGCAACAGATGTCAGTGCGGACGACGCGCAAAAACTGCTGGTTG GGCTCAACCAGCGTATAGTCGTCAACGGTCGCACCCAGAGAAACA CCAATACCATGAAAAATTACCTTTTGCCCGTAGTGGCCCAGGCAT TTGCTAGGTGGGCAAAGGAATATAAGGAAGATCAAGAAGATGAAA GGCCACTAGGACTACGAGATAGACAGTTAGTCATGGGGTGTTGTT GGGCTTTTAGAAGGCACAAGATAACATCTATTTATAAGCGCCCGG ATACCCAAACCATCATCAAAGTGAACAGCGATTTCCACTCATTCG TGCTGCCCAGGATAGGCAGTAACACATTGGAGATCGGGCTGAGAA CAAGAATCAGGAAAATGTTAGAGGAGCACAAGGAGCCGTCACCTC TCATTACCGCCGAGGACGTACAAGAAGCTAAGTGCGCAGCCGATG AGGCTAAGGAGGTGCGTGAAGCCGAGGAGTTGCGCGCAGCTCTAC CACCTTTGGCAGCTGATGTTGAGGAGCCCACTCTGGAAGCCGATG TCGACTTGATGTTACAAGAGGCTGGGGCCGGCTCAGTGGAGACAC CTCGTGGCTTGATAAAGGTTACCAGCTACGATGGCGAGGACAAGA TCGGCTCTTACGCTGTGCTTTCTCCGCAGGCTGTACTCAAGAGTG AAAAATTATCTTGCATCCACCCTCTCGCTGAACAAGTCATAGTGA TAACACACTCTGGCCGAAAAGGGCGTTATGCCGTGGAACCATACC ATGGTAAAGTAGTGGTGCCAGAGGGACATGCAATACCCGTCCAGG ACTTTCAAGCTCTGAGTGAAAGTGCCACCATTGTGTACAACGAAC GTGAGTTCGTAAACAGGTACCTGCACCATATTGCCACACATGGAG GAGCGCTGAACACTGATGAAGAATATTACAAAACTGTCAAGCCCA GCGAGCACGACGGCGAATACCTGTACGACATCGACAGGAAACAGT GCGTCAAGAAAGAACTAGTCACTGGGCTAGGGCTCACAGGCGAGC TGGTGGATCCTCCCTTCCATGAATTCGCCTACGAGAGTCTGAGAA CACGACCAGCCGCTCCTTACCAAGTACCAACCATAGGGGTGTATG GCGTGCCAGGATCAGGCAAGTCTGGCATCATTAAAAGCGCAGTCA CCAAAAAAGATCTAGTGGTGAGCGCCAAGAAAGAAAACTGTGCAG AAATTATAAGGGACGTCAAGAAAATGAAAGGGCTGGACGTCAATG CCAGAACTGTGGACTCAGTGCTCTTGAATGGATGCAAACACCCCG TAGAGACCCTGTATATTGACGAAGCTTTTGCTTGTCATGCAGGTA CTCTCAGAGCGCTCATAGCCATTATAAGACCTAAAAAGGCAGTGC TCTGCGGGGATCCCAAACAGTGCGGTTTTTTTAACATGATGTGCC TGAAAGTGCATTTTAACCACGAGATTTGCACACAAGTCTTCCACA AAAGCATCTCTCGCCGTTGCACTAAATCTGTGACTTCGGTCGTCT CAACCTTGTTTTACGACAAAAAAATGAGAACGACGAATCCGAAAG AGACTAAGATTGTGATTGACACTACCGGCAGTACCAAACCTAAGC AGGACGATCTCATTCTCACTTGTTTCAGAGGGTGGGTGAAGCAGT TGCAAATAGATTACAAAGGCAACGAAATAATGACGGCAGCTGCCT CTCAAGGGCTGACCCGTAAAGGTGTGTATGCCGTTCGGTACAAGG TGAATGAAAATCCTCTGTACGCACCCACCTCAGAACATGTGAACG TCCTACTGACCCGCACGGAGGACCGCATCGTGTGGAAAACACTAG CCGGCGACCCATGGATAAAAACACTGACTGCCAAGTACCCTGGGA ATTTCACTGCCACGATAGAGGAGTGGCAAGCAGAGCATGATGCCA TCATGAGGCACATCTTGGAGAGACCGGACCCTACCGACGTCTTCC AGAATAAGGCAAACGTGTGTTGGGCCAAGGCTTTAGTGCCGGTGC TGAAGACCGCTGGCATAGACATGACCACTGAACAATGGAACACTG TGGATTATTTTGAAACGGACAAAGCTCACTCAGCAGAGATAGTAT TGAACCAACTATGCGTGAGGTTCTTTGGACTCGATCTGGACTCCG GTCTATTTTCTGCACCCACTGTTCCGTTATCCATTAGGAATAATC ACTGGGATAACTCCCCGTCGCCTAACATGTACGGGCTGAATAAAG AAGTGGTCCGTCAGCTCTCTCGCAGGTACCCACAACTGCCTCGGG CAGTTGCCACTGGAAGAGTCTATGACATGAACACTGGTACACTGC GCAATTATGATCCGCGCATAAACCTAGTACCTGTAAACAGAAGAC TGCCTCATGCTTTAGTCCTCCACCATAATGAACACCCACAGAGTG ACTTTTCTTCATTCGTCAGCAAATTGAAGGGCAGAACTGTCCTGG TGGTCGGGGAAAAGTTGTCCGTCCCAGGCAAAATGGTTGACTGGT TGTCAGACCGGCCTGAGGCTACCTTCAGAGCTCGGCTGGATTTAG GCATCCCAGGTGATGTGCCCAAATATGACATAATATTTGTTAATG TGAGGACCCCATATAAATACCATCACTATCAGCAGTGTGAAGACC ATGCCATTAAGCTTAGCATGTTGACCAAGAAAGCTTGTCTGCATC TGAATCCCGGCGGAACCTGTGTCAGCATAGGTTATGGTTACGCTG ACAGGGCCAGCGAAAGCATCATTGGTGCTATAGCGCGGCAGTTCA AGTTTTCCCGGGTATGCAAACCGAAATCCTCACTTGAAGAGACGG AAGTTCTGTTTGTATTCATTGGGTACGATCGCAAGGCCCGTACGC ACAATCCTTACAAGCTTTCATCAACCTTGACCAACATTTATACAG GTTCCAGACTCCACGAAGCCGGATGTGCACCCTCATATCATGTGG TGCGAGGGGATATTGCCACGGCCACCGAAGGAGTGATTATAAATG CTGCTAACAGCAAAGGACAACCTGGCGGAGGGGTGTGCGGAGCGC TGTATAAGAAATTCCCGGAAAGCTTCGATTTACAGCCGATCGAAG TAGGAAAAGCGCGACTGGTCAAAGGTGCAGCTAAACATATCATTC ATGCCGTAGGACCAAACTTCAACAAAGTTTCGGAGGTTGAAGGTG ACAAACAGTTGGCAGAGGCTTATGAGTCCATCGCTAAGATTGTCA ACGATAACAATTACAAGTCAGTAGCGATTCCACTGTTGTCCACCG GCATCTTTTCCGGGAACAAAGATCGACTAACCCAATCATTGAACC ATTTGCTGACAGCTTTAGACACCACTGATGCAGATGTAGCCATAT ACTGCAGGGACAAGAAATGGGAAATGACTCTCAAGGAAGCAGTGG CTAGGAGAGAAGCAGTGGAGGAGATATGCATATCCGACGACTCTT CAGTGACAGAACCTGATGCAGAGCTGGTGAGGGTGCATCCGAAGA GTTCTTTGGCTGGAAGGAAGGGCTACAGCACAAGCGATGGCAAAA CTTTCTCATATTTGGAAGGGACCAAGTTTCACCAGGCGGCCAAGG ATATAGCAGAAATTAATGCCATGTGGCCCGTTGCAACGGAGGCCA ATGAGCAGGTATGCATGTATATCCTCGGAGAAAGCATGAGCAGTA TTAGGTCGAAATGCCCCGTCGAAGAGTCGGAAGCCTCCACACCAC CTAGCACGCTGCCTTGCTTGTGCATCCATGCCATGACTCCAGAAA GAGTACAGCGCCTAAAAGCCTCACGTCCAGAACAAATTACTGTGT GCTCATCCTTTCCATTGCCGAAGTATAGAATCACTGGTGTGCAGA AGATCCAATGCTCCCAGCCTATATTGTTCTCACCGAAAGTGCCTG CGTATATTCATCCAAGGAAGTATCTCGTGGAAACACCACCGGTAG ACGAGACTCCGGAGCCATCGGCAGAGAACCAATCCACAGAGGGGA CACCTGAACAACCACCACTTATAACCGAGGATGAGACCAGGACTA GAACGCCTGAGCCGATCATCATCGAAGAGGAAGAAGAGGATAGCA TAAGTTTGCTGTCAGATGGCCCGACCCACCAGGTGCTGCAAGTCG AGGCAGACATTCACGGGCCGCCCTCTGTATCTAGCTCATCCTGGT CCATTCCTCATGCATCCGACTTTGATGTGGACAGTTTATCCATAC TTGACACCCTGGAGGGAGCTAGCGTGACCAGCGGGGCAACGTCAG CCGAGACTAACTCTTACTTCGCAAAGAGTATGGAGTTTCTGGCGC GACCGGTGCCTGCGCCTCGAACAGTATTCAGGAACCCTCCACATC CCGCTCCGCGCACAAGAACACCGTCACTTGCACCCAGCAGGGCCT GCTCGAGAACCAGCCTAGTTTCCACCCCGCCAGGCGTGAATAGGG TGATCACTAGAGAGGAGCTCGAGGCGCTTACCCCGTCACGCACTC CTAGCAGGTCGGTCTCGAGAACCAGCCTGGTCTCCAACCCGCCAG GCGTAAATAGGGTGATTACAAGAGAGGAGTTTGAGGCGTTCGTAG CACAACAACAATGACGGTTTGATGCGGGTGCATACATCTTTTCCT CCGACACCGGTCAAGGGCATTTACAACAAAAATCAGTAAGGCAAA CGGTGCTATCCGAAGTGGTGTTGGAGAGGACCGAATTGGAGATTT CGTATGCCCCGCGCCTCGACCAAGAAAAAGAAGAATTACTACGCA AGAAATTACAGTTAAATCCCACACCTGCTAACAGAAGCAGATACC AGTCCAGGAAGGTGGAGAACATGAAAGCCATAACAGCTAGACGTA TTCTGCAAGGCCTAGGGCATTATTTGAAGGCAGAAGGAAAAGTGG AGTGCTACCGAACCCTGCATCCTGTTCCTTTGTATTCATCTAGTG TGAACCGTGCCTTTTCAAGCCCCAAGGTCGCAGTGGAAGCCTGTA ACGCCATGTTGAAAGAGAACTTTCCGACTGTGGCTTCTTACTGTA TTATTCCAGAGTACGATGCCTATTTGGACATGGTTGACGGAGCTT CATGCTGCTTAGACACTGCCAGTTTTTGCCCTGCAAAGCTGCGCA GCTTTCCAAAGAAACACTCCTATTTGGAACCCACAATACGATCGG CAGTGCCTTCAGCGATCCAGAACACGCTCCAGAACGTCCTGGCAG CTGCCACAAAAAGAAATTGCAATGTCACGCAAATGAGAGAATTGC CCGTATTGGATTCGGCGGCCTTTAATGTGGAATGCTTCAAGAAAT ATGCGTGTAATAATGAATATTGGGAAACGTTTAAAGAAAACCCCA TCAGGCTTACTGAAGAAAACGTGGTAAATTACATTACCAAATTAA AAGGACCAAAAGCTGCTGCTCTTTTTGCGAAGACACATAATTTGA ATATGTTGCAGGACATACCAATGGACAGGTTTGTAATGGACTTAA AGAGAGACGTGAAAGTGACTCCAGGAACAAAACATACTGAAGAAC GGCCCAAGGTACAGGTGATCCAGGCTGCCGATCCGCTAGCAACAG CGTATCTGTGCGGAATCCACCGAGAGCTGGTTAGGAGATTAAATG CGGTCCTGCTTCCGAACATTCATACACTGTTTGATATGTCGGCTG AAGACTTTGACGCTATTATAGCCGAGCACTTCCAGCCTGGGGATT GTGTTCTGGAAACTGACATCGCGTCGTTTGATAAAAGTGAGGACG ACGCCATGGCTCTGACCGCGTTAATGATTCTGGAAGACTTAGGTG TGGACGCAGAGCTGTTGACGCTGATTGAGGCGGCTTTCGGCGAAA TTTCATCAATACATTTGCCCACTAAAACTAAATTTAAATTCGGAG CCATGATGAAATCTGGAATGTTCCTCACACTGTTTGTGAACACAG TCATTAACATTGTAATCGCAAGCAGAGTGTTGAGAGAACGGCTAA CCGGATCACCATGTGCAGCATTCATTGGAGATGACAATATCGTGA AAGGAGTCAAATCGGACAAATTAATGGCAGACAGGTGCGCCACCT GGTTGAATATGGAAGTCAAGATTATAGATGCTGTGGTGGGCGAGA AAGCGCCTTATTTCTGTGGAGGGTTTATTTTGTGTGACTCCGTGA CCGGCACAGCGTGCCGTGTGGCAGACCCCCTAAAAAGGCTGTTTA AGCTTGGCAAACCTCTGGCAGCAGACGATGAACATGATGATGACA GGAGAAGGGCATTGCATGAAGAGTCAACACGCTGGAACCGAGTGG GTATTCTTTCAGAGCTGTGCAAGGCAGTAGAATCAAGGTATGAAA CCGTAGGAACTTCCATCATAGTTATGGCCATGACTACTCTAGCTA GCAGTGTTAAATCATTCAGCTACCTGAGAGGGGCCCCTATAACTC TCTACGGCTAACCTGAATGGACTACGACGTATCACGCCCAAACAT TTACAGCCGCGGTGTCAAAAACCGCGTGGACGTGGTTAACATCCC TGCTGGGAGGATCAGCCGTAATTATTATAATTGGCTTGGTGCTGG CTACTATTGTGGCCATGTACGTGCTGACCAACCAGAAACATAATT GAATACAGCAGCAATTGGCAAGCTGCTTACATAGAACTCGCGGCG ATTGGCATGCCGCCTTAAAATTTTTATTTTATTTTTCTTTTCTTT TCCGAATCGGATTTTGTTTTTAATATTTCAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAA VEE-UbAAY(SEQIDNO:14);VEEdeliveryvector withMHCclassImousetumorepitopes SIINFEKLandAH1-A5inserted VEE-Luciferase(SEQIDNO:15); VEEdeliveryvectorwithluciferasegene insertedat7545 ubiquitin(SEQIDNO:38)>UbG760-228 UbiquitinA76(SEQIDNO:39)>UbA760-228 HLA-A2(MHCclassI)signalpeptide (SEQIDNO:40)>MHCSignalPep0-78 HLA-A2(MHCclassI)TransMembrane domain(SEQIDNO:41)>HLAA2TMDomain0-201 IgKLeaderSeq(SEQIDNO:42)>IgKLeaderSeq0-60 HumanDC-Lamp(SEQIDNO:43)>HumanDCLAMP0-3178 MouseLAMP1(SEQIDNO:44)>MouseLamp10-1858 HumanLamp1cDNA(SEQIDNO:45)>HumanLamp10-2339 Tetanustoxoidnulceicacidsequence(SEQIDNO:46) Tetanustoxoidaminoacidsequence(SEQIDNO:47) PADREnulceotidesequence(SEQIDNO:48) PADREaminoacidsequence(SEQIDNO:49) WPRE(SEQIDNO:50)>WPRE0-593 IRES(SEQIDNO:51)>eGFP_IRES_SEAP_Insert1746-2335 GFP(SEQIDNO:52) SEAP(SEQIDNO:53) FireflyLuciferase(SEQIDNO:54) FMDV2A(SEQIDNO:55) GPGPGlinker(SEQIDNO:56) 1X(20x1)CassetteNucleotideSequence (SEQIDNO:69) ATGGCTGGCATGACCGAGTACAAACTTGTGGTGGTTGGTGCTGGA GACGTGGGGAAAAGCGCCCTGACAATTCAGCTTATTCAGGAAACT TGCTTATTAGACATATTAGATACTGCCGGAAAAGAAGAGTATTCT GCTATGAGAGATCAGTACATGCGGATGTGCAACAGCAGCTGCATG GGCGGCATGAACCGCATGCCCATCTTGACTATTATCACCCTGGAG GATTCCTCCAGTGGAATACATTCGGGAGCCACCACCACTGCTCCT CCCCTGTCAGGTAAGGGAAATCCTGAAGAAGAAGATGTTAGCGGC ATTCATTCCGGTGCTACGACAACTGCACCATTTCTGTCTGGTAAA GGTAATCCAGAGGAGGAGGATGTGGAAATTCTGGATGAGGCCTAC GTCATGGCCTATGTGATGGCTGGCGTTGGAAGCCCATACGTGAGT AGACTGCTGATGACAGAATATAAATTAGTGGTAGTAGGAGCAGAT GGGGTAGGAAAGAGTGCCTTAACAATCCAACTCATTCAGGAGACC TGTTTGTTGGATATTCTGGATACAGCTGGCCGGGAAGAGTATTCG GCAATGAGGGACCAATATATGCGATCTTACCTCGACAGCGGAATC CACTCCGGTGCCACTGCAACAGCGCCGAGCCTGAGTGGTAAGGGG AACCCTGAGAAGTCAGTAACGTGTACATACAGCCCTGCTTTAAAC AACATGTTTTGCCAACTTGCAAAAACATGTCCTGTACAGATGACA GAGTATAAACTTGTAGTGGTGGGGGCAGCTGGTGTAGGTAAAAGT GCACTTACCATCCAGCTGATTCAAGAGACATGTCTGTTAGACATC TTGGACACAGCCGGGCTCGAGGAATATAGCGCCATGAGAGACCAG TACATGCGACTGCGCGTGGAGTATCTGGATGACAGGAACACCTTC CTGCATTCTGTTGTGGTGCCCTATGAGCCCCCGGAGGTGGATGGA CAGATCACAGTGGGCCAGAGAATTGGCAGCGTGTCCTTCGGGACT GTGTACAAGGGCAAGTGGCACGGAATGACGGAATATAAGCTGGTG GTGGTAGGAGCAGTAGGTGTCGGTAAATCAGCCCTCACCATTCAG CTTATACAGGAGACTTGTTTGCTGGACATCCTAGACACTGCTGGC CATGAGGAGTACTCCGCCATGCGCGATCAATACATGAGGTGGCAG CAGCAGAGCTACCTGGACTCAGGGATCCACTTTGGAGCTACCACA ACTGCGCCATCACTAAGTGGGAAACACAGCGGCACCGCCAAATCT GTCACGTGTACTTACTACCCAGCCTTGAACAAGATGTTCTGTCAA TTAGCAAAGAAAAGTGTCACCTGCACATATTCACCGGCACTGAAT GAGATGTTCTGCCAGCTGGCTAAGACCTGTCCTGTGCAGATGACT GAGTACAAACTGGTCGTTGTGGGGGCCTGTGGGGTTGGGAAGAGC GCTCTGACCATCCAGCTCATCCAGGGACCCGGACCAGGCGCCAAA TTTGTTGCTGCTTGGACACTGAAAGCTGCTGCTGGGCCCGGACCA GGCCAGTACATCAAGGCCAACTCTAAGTTTATCGGCATCACCGAA TTGGGACCTGGACCCGGCTAGTAGTGA KRAS2X(8x2)CassetteNucleotideSequence (SEQIDNO:70) ATGGCTGGCATGACTGAATACAAATTAGTTGTCGTCGGTGCATGC GGGGTAGGCAAGTCGGCCTTAACGATACAACTTATTCAAGAGACA TGTCTACTGGATATCCTTGACACTGCCGGTCACGAAGAATATAGT GCAATGAGGGACCAGTACATGCGTATGACGGAATATAAGTTAGTA GTAGTTGGCGCAGGCGACGTAGGGAAATCCGCTCTAACTATCCAA CTAATTCAAGAAACGTGCCTACTAGATATATTAGACACAGCGGGA CGTGAGGAGTATAGCGCCATGCGTGACCAGTATATGCGGATGACC GAGTATAAGCTAGTCGTAGTCGGCGCGGATGGGGTTGGTAAGAGC GCCTTGACCATCCAGCTCATACAAGAAACTTGCCTTCTGGACATC CTAGACACCGCGGGTCTCGAAGAGTACAGTGCGATGAGAGATCAG TACATGAGGATGACAGAATACAAGCTCGTTGTTGTTGGTGCGGTC GGTGTTGGAAAGAGTGCGCTAACCATTCAGCTTATCCAGGAAACC TGTCTGTTAGACATCTTAGATACCGCAGGTAAAGAGGAATATTCG GCCATGAGGGATCAATATATGCGAATGACAGAGTATAAATTGGTA GTGGTAGGGGCTTGCGGAGTGGGGAAAAGCGCATTGACTATACAA TTGATTCAGGAAACATGCCTATTGGACATACTCGACACGGCCGGG AAAGAAGAGTATTCCGCGATGCGAGATCAATACATGCGCATGACC GAATATAAACTTGTCGTTGTCGGAGCGGGTGATGTAGGTAAATCG GCGCTCACAATCCAATTAATCCAAGAGACGTGCTTGCTAGACATT CTGGATACAGCTGGGCACGAGGAGTACTCAGCTATGCGCGATCAG TATATGAGGATGACTGAGTACAAGTTGGTCGTCGTAGGAGCGGTT GGTGTCGGAAAATCTGCGTTGACAATTCAACTGATACAAGAGACT TGTTTGTTAGATATTCTCGATACTGCGGGTCGGGAAGAATACTCG GCTATGAGAGACCAATATATGAGAATGACGGAGTACAAACTCGTA GTTGTAGGTGCGGACGGTGTAGGAAAGTCTGCGCTTACGATTCAG TTGATACAGGAGACCTGTTTGCTCGATATCTTGGATACGGCGGGT TTGGAGGAATACAGCGCAATGCGGGACCAATACATGAGAGGACCC GGACCAGGCGCCAAATTTGTTGCTGCTTGGACACTGAAAGCTGCT GCTGGGCCCGGACCAGGCCAGTACATCAAGGCCAACTCTAAGTTT ATCGGCATCACCGAATTGGGACCTGGACCCGGCTAG KRAS4X(4x4)CassetteNucleotideSequence (SEQIDNO:71) ATGGCTGGCATGACCGAGTATAAACTAGTAGTTGTGGGAGCGTGT GGTGTAGGCAAGTCGGCACTTACAATTCAGTTGATACAAATGACG GAATATAAGCTCGTAGTAGTCGGAGCAGACGGCGTGGGGAAATCA GCGTTGACTATCCAGTTAATACAGGAAACTTGCCTATTAGACATC TTGGATACGGCAGGTCATGAGGAATATTCCGCTATGAGAGATCAG TATATGCGCATGACGGAGTATAAGCTTGTGGTTGTCGGGGCCGAC GGGGTAGGTAAGTCAGCGCTCACGATACAATTAATTCAAATGACC GAATACAAGTTGGTCGTGGTGGGGGCAGTTGGGGTCGGTAAATCC GCGTTAACGATCCAACTTATCCAAATGACAGAATATAAACTCGTT GTTGTAGGTGCATGTGGCGTAGGAAAAAGCGCATTGACCATCCAG CTAATTCAGGAGACGTGTCTCCTTGATATCCTAGACACGGCGGGG CACGAAGAATACTCGGCTATGCGCGACCAGTACATGAGAATGACG GAATACAAACTTGTTGTCGTGGGTGCGGATGGAGTAGGGAAAAGT GCTCTAACAATACAACTCATTCAGATGACAGAGTACAAATTGGTA GTCGTCGGTGCGGTAGGAGTTGGGAAGTCTGCACTAACTATTCAG CTCATACAGATGACCGAGTACAAGCTGGTGGTGGTAGGCGCTTGC GGTGTGGGTAAGAGTGCATTAACCATACAGCTTATACAAGAGACA TGTCTGCTAGATATATTAGATACCGCCGGGCATGAAGAGTACTCT GCCATGCGAGACCAATACATGCGTATGACAGAGTATAAATTAGTA GTGGTTGGGGCGGACGGTGTTGGCAAGAGCGCCTTAACTATACAG TTGATCCAGATGACGGAGTACAAACTGGTCGTCGTTGGTGCAGTG GGAGTGGGAAAATCTGCGCTGACGATTCAACTAATCCAAGAAACA TGTTTACTTGACATCCTCGACACTGCGGGTCACGAGGAGTATTCG GCGATGCGTGATCAATATATGAGGATGACTGAGTATAAGTTAGTC GTAGTTGGAGCGGTCGGTGTCGGAAAGTCCGCGCTAACCATTCAA TTGATTCAAATGACTGAATACAAGCTAGTGGTAGTAGGAGCATGC GGCGTCGGCAAATCGGCTTTAACAATCCAACTGATACAGGGACCC GGACCAGGCGCCAAATTTGTTGCTGCTTGGACACTGAAAGCTGCT GCTGGGCCCGGACCAGGCCAGTACATCAAGGCCAACTCTAAGTTT ATCGGCATCACCGAATTGGGACCTGGACCCGGCTAG KRAS4x1CassetteNucleotideSequence (SEQIDNO:72) ATGGCTGGCATGACCGAGTATAAACTAGTAGTTGTGGGAGCGTGT GGTGTAGGCAAGTCGGCACTTACAATTCAGTTGATACAAATGACG GAATATAAGCTCGTAGTAGTCGGAGCAGACGGCGTGGGGAAATCA GCGTTGACTATCCAGTTAATACAGGAAACTTGCCTATTAGACATC TTGGATACGGCAGGTCATGAGGAATATTCCGCTATGAGAGATCAG TATATGCGCATGACCGAATACAAGTTGGTCGTGGTGGGGGCAGTT GGGGTCGGTAAATCCGCGTTAACGATCCAACTTATCCAAGGACCC GGACCAGGCGCCAAATTTGTTGCTGCTTGGACACTGAAAGCTGCT GCTGGGCCCGGACCAGGCCAGTACATCAAGGCCAACTCTAAGTTT ATCGGCATCACCGAATTGGGACCTGGACCCGGCTAG KRAS4x1+R213LCassetteNucleotideSequence (SEQIDNO:73) ATGGCTGGCATGACCGAGTATAAACTAGTAGTTGTGGGAGCGTGT GGTGTAGGCAAGTCGGCACTTACAATTCAGTTGATACAAATGACG GAATATAAGCTCGTAGTAGTCGGAGCAGACGGCGTGGGGAAATCA GCGTTGACTATCCAGTTAATACAGGAAACTTGCCTATTAGACATC TTGGATACGGCAGGTCATGAGGAATATTCCGCTATGAGAGATCAG TATATGCGCATGACCGAATACAAGTTGGTCGTGGTGGGGGCAGTT GGGGTCGGTAAATCCGCGTTAACGATCCAACTTATCCAACTGCGC GTGGAGTATCTGGATGACAGGAACACCTTCCTGCATTCTGTTGTG GTGCCCTATGAGCCCCCGGAGGTGGGACCCGGACCAGGCGCCAAA TTTGTTGCTGCTTGGACACTGAAAGCTGCTGCTGGGCCCGGACCA GGCCAGTACATCAAGGCCAACTCTAAGTTTATCGGCATCACCGAA TTGGGACCTGGACCCGGCTAG KRAS4x1+S127YCassetteNucleotide Sequence(SEQIDNO:74) ATGGCTGGCATGACCGAGTATAAACTAGTAGTTGTGGGAGCGTGT GGTGTAGGCAAGTCGGCACTTACAATTCAGTTGATACAAATGACG GAATATAAGCTCGTAGTAGTCGGAGCAGACGGCGTGGGGAAATCA GCGTTGACTATCCAGTTAATACAGGAAACTTGCCTATTAGACATC TTGGATACGGCAGGTCATGAGGAATATTCCGCTATGAGAGATCAG TATATGCGCATGACCGAATACAAGTTGGTCGTGGTGGGGGCAGTT GGGGTCGGTAAATCCGCGTTAACGATCCAACTTATCCAACACAGC GGCACCGCCAAATCTGTCACGTGTACTTACTACCCAGCCTTGAAC AAGATGTTCTGTCAATTAGCAAAGGGACCCGGACCAGGCGCCAAA TTTGTTGCTGCTTGGACACTGAAAGCTGCTGCTGGGCCCGGACCA GGCCAGTACATCAAGGCCAACTCTAAGTTTATCGGCATCACCGAA TTGGGACCTGGACCCGGCTAG KRASG12CNeoepitope(SEQIDNO:75) VVVGACGVGK KRASG12CNeoepitope(SEQIDNO:76) KLVVVGACGV KRASG12DNeoepitope(SEQIDNO:77) VVGADGVGK KRASG12DNeoepitope(SEQIDNO:78) VVVGADGVGK KRASG12VNeoepitope(SEQIDNO:79) VVGAVGVGK KRASG12VNeoepitope(SEQIDNO:80) AVGVGKSAL KRASG12VNeoepitope(SEQIDNO:81) VVVGAVGVGK KRASQ61HNeoepitope(SEQIDNO:82) ILDTAGHEEY ChAdV68-Empty-E4deleted(SEQIDNO:83) CATCTTCAATAATATACCTCAAACTTTTTGTGCGCGTTAATATGC AAATGAGGCGTTTGAATTTGGGGAGGAAGGGCGGTGATTGGTCGA GGGATGAGCGACCGTTAGGGGCGGGGCGAGTGACGTTTTGATGAC GTGGTTGCGAGGAGGAGCCAGTTTGCAAGTTCTCGTGGGAAAAGT GACGTCAAACGAGGTGTGGTTTGAACACGGAAATACTCAATTTTC CCGCGCTCTCTGACAGGAAATGAGGTGTTTCTGGGCGGATGCAAG TGAAAACGGGCCATTTTCGCGCGAAAACTGAATGAGGAAGTGAAA ATCTGAGTAATTTCGCGTTTATGGCAGGGAGGAGTATTTGCCGAG GGCCGAGTAGACTTTGACCGATTACGTGGGGGTTTCGATTACCGT GTTTTTCACCTAAATTTCCGCGTACGGTGTCAAAGTCCGGTGTTT TTACGTAGGTGTCAGCTGATCGCCAGGGTATTTAAACCTGCGCTC TCCAGTCAAGAGGCCACTCTTGAGTGCCAGCGAGAAGAGTTTTCT CCTCCGCGCCGCGAGTCAGATCTACACTTTGAAAGTAGGGataaG GTAGCGAGTGAGTAGTGTTCTGGGGCGGGGGAGGACCTGCATGAG GGCCAGAATAACTGAAATCTGTGCTTTTCTGTGTGTTGCAGCAGC ATGAGCGGAAGCGGCTCCTTTGAGGGAGGGGTATTCAGCCCTTAT CTGACGGGGCGTCTCCCCTCCTGGGCGGGAGTGCGTCAGAATGTG ATGGGATCCACGGTGGACGGCCGGCCCGTGCAGCCCGCGAACTCT TCAACCCTGACCTATGCAACCCTGAGCTCTTCGTCGTTGGACGCA GCTGCCGCCGCAGCTGCTGCATCTGCCGCCAGCGCCGTGCGCGGA ATGGCCATGGGCGCCGGCTACTACGGCACTCTGGTGGCCAACTCG AGTTCCACCAATAATCCCGCCAGCCTGAACGAGGAGAAGCTGTTG CTGCTGATGGCCCAGCTCGAGGCCTTGACCCAGCGCCTGGGCGAG CTGACCCAGCAGGTGGCTCAGCTGCAGGAGCAGACGCGGGCCGCG GTTGCCACGGTGAAATCCAAATAAAAAATGAATCAATAAATAAAC GGAGACGGTTGTTGATTTTAACACAGAGTCTGAATCTTTATTTGA TTTTTCGCGCGCGGTAGGCCCTGGACCACCGGTCTCGATCATTGA GCACCCGGTGGATCTTTTCCAGGACCCGGTAGAGGTGGGCTTGGA TGTTGAGGTACATGGGCATGAGCCCGTCCCGGGGGTGGAGGTAGC TCCATTGCAGGGCCTCGTGCTCGGGGGTGGTGTTGTAAATCACCC AGTCATAGCAGGGGCGCAGGGCATGGTGTTGCACAATATCTTTGA GGAGGAGACTGATGGCCACGGGCAGCCCTTTGGTGTAGGTGTTTA CAAATCTGTTGAGCTGGGAGGGATGCATGCGGGGGGAGATGAGGT GCATCTTGGCCTGGATCTTGAGATTGGCGATGTTACCGCCCAGAT CCCGCCTGGGGTTCATGTTGTGCAGGACCACCAGCACGGTGTATC CGGTGCACTTGGGGAATTTATCATGCAACTTGGAAGGGAAGGCGT GAAAGAATTTGGCGACGCCTTTGTGCCCGCCCAGGTTTTCCATGC ACTCATCCATGATGATGGCGATGGGCCCGTGGGCGGCGGCCTGGG CAAAGACGTTTCGGGGGTCGGACACATCATAGTTGTGGTCCTGGG TGAGGTCATCATAGGCCATTTTAATGAATTTGGGGCGGAGGGTGC CGGACTGGGGGACAAAGGTACCCTCGATCCCGGGGGCGTAGTTCC CCTCACAGATCTGCATCTCCCAGGCTTTGAGCTCGGAGGGGGGGA TCATGTCCACCTGCGGGGCGATAAAGAACACGGTTTCCGGGGCGG GGGAGATGAGCTGGGCCGAAAGCAAGTTCCGGAGCAGCTGGGACT TGCCGCAGCCGGTGGGGCCGTAGATGACCCCGATGACCGGCTGCA GGTGGTAGTTGAGGGAGAGACAGCTGCCGTCCTCCCGGAGGAGGG GGGCCACCTCGTTCATCATCTCGCGCACGTGCATGTTCTCGCGCA CCAGTTCCGCCAGGAGGCGCTCTCCCCCCAGGGATAGGAGCTCCT GGAGCGAGGCGAAGTTTTTCAGCGGCTTGAGTCCGTCGGCCATGG GCATTTTGGAGAGGGTTTGTTGCAAGAGTTCCAGGCGGTCCCAGA GCTCGGTGATGTGCTCTACGGCATCTCGATCCAGCAGACCTCCTC GTTTCGCGGGTTGGGACGGCTGCGGGAGTAGGGCACCAGACGATG GGCGTCCAGCGCAGCCAGGGTCCGGTCCTTCCAGGGTCGCAGCGT CCGCGTCAGGGTGGTCTCCGTCACGGTGAAGGGGTGCGCGCCGGG CTGGGCGCTTGCGAGGGTGCGCTTCAGGCTCATCCGGCTGGTCGA AAACCGCTCCCGATCGGCGCCCTGCGCGTCGGCCAGGTAGCAATT GACCATGAGTTCGTAGTTGAGCGCCTCGGCCGCGTGGCCTTTGGC GCGGAGCTTACCTTTGGAAGTCTGCCCGCAGGCGGGACAGAGGAG GGACTTGAGGGCGTAGAGCTTGGGGGCGAGGAAGACGGACTCGGG GGCGTAGGCGTCCGCGCCGCAGTGGGCGCAGACGGTCTCGCACTC CACGAGCCAGGTGAGGTCGGGCTGGTCGGGGTCAAAAACCAGTTT CCCGCCGTTCTTTTTGATGCGTTTCTTACCTTTGGTCTCCATGAG CTCGTGTCCCCGCTGGGTGACAAAGAGGCTGTCCGTGTCCCCGTA GACCGACTTTATGGGCCGGTCCTCGAGCGGTGTGCCGCGGTCCTC CTCGTAGAGGAACCCCGCCCACTCCGAGACGAAAGCCCGGGTCCA GGCCAGCACGAAGGAGGCCACGTGGGACGGGTAGCGGTCGTTGTC CACCAGCGGGTCCACCTTTTCCAGGGTATGCAAACACATGTCCCC CTCGTCCACATCCAGGAAGGTGATTGGCTTGTAAGTGTAGGCCAC GTGACCGGGGGTCCCGGCCGGGGGGGTATAAAAGGGTGCGGGTCC CTGCTCGTCCTCACTGTCTTCCGGATCGCTGTCCAGGAGCGCCAG CTGTTGGGGTAGGTATTCCCTCTCGAAGGCGGGCATGACCTCGGC ACTCAGGTTGTCAGTTTCTAGAAACGAGGAGGATTTGATATTGAC GGTGCCGGCGGAGATGCCTTTCAAGAGCCCCTCGTCCATCTGGTC AGAAAAGACGATCTTTTTGTTGTCGAGCTTGGTGGCGAAGGAGCC GTAGAGGGCGTTGGAGAGGAGCTTGGCGATGGAGCGCATGGTCTG GTTTTTTTCCTTGTCGGCGCGCTCCTTGGCGGCGATGTTGAGCTG CACGTACTCGCGCGCCACGCACTTCCATTCGGGGAAGACGGTGGT CAGCTCGTCGGGCACGATTCTGACCTGCCAGCCCCGATTATGCAG GGTGATGAGGTCCACACTGGTGGCCACCTCGCCGCGCAGGGGCTC ATTAGTCCAGCAGAGGCGTCCGCCCTTGCGCGAGCAGAAGGGGGG CAGGGGGTCCAGCATGACCTCGTCGGGGGGGTCGGCATCGATGGT GAAGATGCCGGGCAGGAGGTCGGGGTCAAAGTAGCTGATGGAAGT GGCCAGATCGTCCAGGGCAGCTTGCCATTCGCGCACGGCCAGCGC GCGCTCGTAGGGACTGAGGGGCGTGCCCCAGGGCATGGGATGGGT AAGCGCGGAGGCGTACATGCCGCAGATGTCGTAGACGTAGAGGGG CTCCTCGAGGATGCCGATGTAGGTGGGGTAGCAGCGCCCCCCGCG GATGCTGGCGCGCACGTAGTCATACAGCTCGTGCGAGGGGGCGAG GAGCCCCGGGCCCAGGTTGGTGCGACTGGGCTTTTCGGCGCGGTA GACGATCTGGCGGAAAATGGCATGCGAGTTGGAGGAGATGGTGGG CCTTTGGAAGATGTTGAAGTGGGCGTGGGGCAGTCCGACCGAGTC GCGGATGAAGTGGGCGTAGGAGTCTTGCAGCTTGGCGACGAGCTC GGCGGTGACTAGGACGTCCAGAGCGCAGTAGTCGAGGGTCTCCTG GATGATGTCATACTTGAGCTGTCCCTTTTGTTTCCACAGCTCGCG GTTGAGAAGGAACTCTTCGCGGTCCTTCCAGTACTCTTCGAGGGG GAACCCGTCCTGATCTGCACGGTAAGAGCCTAGCATGTAGAACTG GTTGACGGCCTTGTAGGCGCAGCAGCCCTTCTCCACGGGGAGGGC GTAGGCCTGGGCGGCCTTGCGCAGGGAGGTGTGCGTGAGGGCGAA AGTGTCCCTGACCATGACCTTGAGGAACTGGTGCTTGAAGTCGAT ATCGTCGCAGCCCCCCTGCTCCCAGAGCTGGAAGTCCGTGCGCTT CTTGTAGGCGGGGTTGGGCAAAGCGAAAGTAACATCGTTGAAGAG GATCTTGCCCGCGCGGGGCATAAAGTTGCGAGTGATGCGGAAAGG TTGGGGCACCTCGGCCCGGTTGTTGATGACCTGGGCGGCGAGCAC GATCTCGTCGAAGCCGTTGATGTTGTGGCCCACGATGTAGAGTTC CACGAATCGCGGACGGCCCTTGACGTGGGGCAGTTTCTTGAGCTC CTCGTAGGTGAGCTCGTCGGGGTCGCTGAGCCCGTGCTGCTCGAG CGCCCAGTCGGCGAGATGGGGGTTGGCGCGGAGGAAGGAAGTCCA GAGATCCACGGCCAGGGCGGTTTGCAGACGGTCCCGGTACTGACG GAACTGCTGCCCGACGGCCATTTTTTCGGGGGTGACGCAGTAGAA GGTGCGGGGGTCCCCGTGCCAGCGATCCCATTTGAGCTGGAGGGC GAGATCGAGGGCGAGCTCGACGAGCCGGTCGTCCCCGGAGAGTTT CATGACCAGCATGAAGGGGACGAGCTGCTTGCCGAAGGACCCCAT CCAGGTGTAGGTTTCCACATCGTAGGTGAGGAAGAGCCTTTCGGT GCGAGGATGCGAGCCGATGGGGAAGAACTGGATCTCCTGCCACCA ATTGGAGGAATGGCTGTTGATGTGATGGAAGTAGAAATGCCGACG GCGCGCCGAACACTCGTGCTTGTGTTTATACAAGCGGCCACAGTG CTCGCAACGCTGCACGGGATGCACGTGCTGCACGAGCTGTACCTG AGTTCCTTTGACGAGGAATTTCAGTGGGAAGTGGAGTCGTGGCGC CTGCATCTCGTGCTGTACTACGTCGTGGTGGTCGGCCTGGCCCTC TTCTGCCTCGATGGTGGTCATGCTGACGAGCCCGCGCGGGAGGCA GGTCCAGACCTCGGCGCGAGCGGGTCGGAGAGCGAGGACGAGGGC GCGCAGGCCGGAGCTGTCCAGGGTCCTGAGACGCTGCGGAGTCAG GTCAGTGGGCAGCGGCGGCGCGCGGTTGACTTGCAGGAGTTTTTC CAGGGCGCGCGGGAGGTCCAGATGGTACTTGATCTCCACCGCGCC ATTGGTGGCGACGTCGATGGCTTGCAGGGTCCCGTGCCCCTGGGG TGTGACCACCGTCCCCCGTTTCTTCTTGGGCGGCTGGGGCGACGG GGGCGGTGCCTCTTCCATGGTTAGAAGCGGCGGCGAGGACGCGCG CCGGGCGGCAGGGGCGGCTCGGGGCCCGGAGGCAGGGGCGGCAGG GGCACGTCGGCGCCGCGCGCGGGTAGGTTCTGGTACTGCGCCCGG AGAAGACTGGCGTGAGCGACGACGCGACGGTTGACGTCCTGGATC TGACGCCTCTGGGTGAAGGCCACGGGACCCGTGAGTTTGAACCTG AAAGAGAGTTCGACAGAATCAATCTCGGTATCGTTGACGGCGGCC TGCCGCAGGATCTCTTGCACGTCGCCCGAGTTGTCCTGGTAGGCG ATCTCGGTCATGAACTGCTCGATCTCCTCCTCTTGAAGGTCTCCG CGGCCGGCGCGCTCCACGGTGGCCGCGAGGTCGTTGGAGATGCGG CCCATGAGCTGCGAGAAGGCGTTCATGCCCGCCTCGTTCCAGACG CGGCTGTAGACCACGACGCCCTCGGGATCGCgGGCGCGCATGACC ACCTGGGCGAGGTTGAGCTCCACGTGGCGCGTGAAGACCGCGTAG TTGCAGAGGCGCTGGTAGAGGTAGTTGAGCGTGGTGGCGATGTGC TCGGTGACGAAGAAATACATGATCCAGCGGCGGAGCGGCATCTCG CTGACGTCGCCCAGCGCCTCCAAACGTTCCATGGCCTCGTAAAAG TCCACGGCGAAGTTGAAAAACTGGGAGTTGCGCGCCGAGACGGTC AACTCCTCCTCCAGAAGACGGATGAGCTCGGCGATGGTGGCGCGC ACCTCGCGCTCGAAGGCCCCCGGGAGTTCCTCCACTTCCTCTTCT TCCTCCTCCACTAACATCTCTTCTACTTCCTCCTCAGGCGGCAGT GGTGGCGGGGGAGGGGGCCTGCGTCGCCGGCGGCGCACGGGCAGA CGGTCGATGAAGCGCTCGATGGTCTCGCCGCGCCGGCGTCGCATG GTCTCGGTGACGGCGCGCCCGTCCTCGCGGGGCCGCAGCGTGAAG ACGCCGCCGCGCATCTCCAGGTGGCCGGGGGGGTCCCCGTTGGGC AGGGAGAGGGCGCTGACGATGCATCTTATCAATTGCCCCGTAGGG ACTCCGCGCAAGGACCTGAGCGTCTCGAGATCCACGGGATCTGAA AACCGCTGAACGAAGGCTTCGAGCCAGTCGCAGTCGCAAGGTAGG CTGAGCACGGTTTCTTCTGGCGGGTCATGTTGGTTGGGAGCGGGG GGGGCGATGCTGCTGGTGATGAAGTTGAAATAGGCGGTTCTGAGA CGGCGGATGGTGGCGAGGAGCACCAGGTCTTTGGGCCCGGCTTGC TGGATGCGCAGACGGTCGGCCATGCCCCAGGCGTGGTCCTGACAC CTGGCCAGGTCCTTGTAGTAGTCCTGCATGAGCCGCTCCACGGGC ACCTCCTCCTCGCCCGCGCGGCCGTGCATGCGCGTGAGCCCGAAG CCGCGCTGGGGCTGGACGAGCGCCAGGTCGGCGACGACGCGCTCG GCGAGGATGGCTTGCTGGATCTGGGTGAGGGTGGTCTGGAAGTCA TCAAAGTCGACGAAGCGGTGGTAGGCTCCGGTGTTGATGGTGTAG GAGCAGTTGGCCATGACGGACCAGTTGACGGTCTGGTGGCCCGGA CGCACGAGCTCGTGGTACTTGAGGCGCGAGTAGGCGCGCGTGTCG AAGATGTAGTCGTTGCAGGTGCGCACCAGGTACTGGTAGCCGATG AGGAAGTGCGGCGGCGGCTGGCGGTAGAGCGGCCATCGCTCGGTG GCGGGGGCGCCGGGCGCGAGGTCCTCGAGCATGGTGCGGTGGTAG CCGTAGATGTACCTGGACATCCAGGTGATGCCGGCGGCGGTGGTG GAGGCGCGCGGGAACTCGCGGACGCGGTTCCAGATGTTGCGCAGC GGCAGGAAGTAGTTCATGGTGGGCACGGTCTGGCCCGTGAGGCGC GCGCAGTCGTGGATGCTCTATACGGGCAAAAACGAAAGCGGTCAG CGGCTCGACTCCGTGGCCTGGAGGCTAAGCGAACGGGTTGGGCTG CGCGTGTACCCCGGTTCGAATCTCGAATCAGGCTGGAGCCGCAGC TAACGTGGTATTGGCACTCCCGTCTCGACCCAAGCCTGCACCAAC CCTCCAGGATACGGAGGCGGGTCGTTTTGCAACTTTTTTTTGGAG GCCGGATGAGACTAGTAAGCGCGGAAAGCGGCCGACCGCGATGGC TCGCTGCCGTAGTCTGGAGAAGAATCGCCAGGGTTGCGTTGCGGT GTGCCCCGGTTCGAGGCCGGCCGGATTCCGCGGCTAACGAGGGCG TGGCTGCCCCGTCGTTTCCAAGACCCCATAGCCAGCCGACTTCTC CAGTTACGGAGCGAGCCCCTCTTTTGTTTTGTTTGTTTTTGCCAG ATGCATCCCGTACTGCGGCAGATGCGCCCCCACCACCCTCCACCG CAACAACAGCCCCCTCCACAGCCGGCGCTTCTGCCCCCGCCCCAG CAGCAACTTCCAGCCACGACCGCCGCGGCCGCCGTGAGCGGGGCT GGACAGAGTTATGATCACCAGCTGGCCTTGGAAGAGGGCGAGGGG CTGGCGCGCCTGGGGGCGTCGTCGCCGGAGCGGCACCCGCGCGTG CAGATGAAAAGGGACGCTCGCGAGGCCTACGTGCCCAAGCAGAAC CTGTTCAGAGACAGGAGCGGCGAGGAGCCCGAGGAGATGCGCGCG GCCCGGTTCCACGCGGGGGGGGAGCTGCGGCGCGGCCTGGACCGA AAGAGGGTGCTGAGGGACGAGGATTTCGAGGCGGACGAGCTGACG GGGATCAGCCCCGCGCGCGCGCACGTGGCCGCGGCCAACCTGGTC ACGGCGTACGAGCAGACCGTGAAGGAGGAGAGCAACTTCCAAAAA TCCTTCAACAACCACGTGCGCACCCTGATCGCGCGCGAGGAGGTG ACCCTGGGCCTGATGCACCTGTGGGACCTGCTGGAGGCCATCGTG CAGAACCCCACCAGCAAGCCGCTGACGGCGCAGCTGTTCCTGGTG GTGCAGCATAGTCGGGACAACGAAGCGTTCAGGGAGGCGCTGCTG AATATCACCGAGCCCGAGGGCCGCTGGCTCCTGGACCTGGTGAAC ATTCTGCAGAGCATCGTGGTGCAGGAGCGCGGGCTGCCGCTGTCC GAGAAGCTGGCGGCCATCAACTTCTCGGTGCTGAGTTTGGGCAAG TACTACGCTAGGAAGATCTACAAGACCCCGTACGTGCCCATAGAC AAGGAGGTGAAGATCGACGGGTTTTACATGCGCATGACCCTGAAA GTGCTGACCCTGAGCGACGATCTGGGGGTGTACCGCAACGACAGG ATGCACCGTGCGGTGAGCGCCAGCAGGCGGCGCGAGCTGAGCGAC CAGGAGCTGATGCATAGTCTGCAGCGGGCCCTGACCGGGGCCGGG ACCGAGGGGGAGAGCTACTTTGACATGGGCGCGGACCTGCACTGG CAGCCCAGCCGCCGGGCCTTGGAGGCGGCGGCAGGACCCTACGTA GAAGAGGTGGACGATGAGGTGGACGAGGAGGGCGAGTACCTGGAA GACTGATGGCGCGACCGTATTTTTGCTAGATGCAACAACAACAGC CACCTCCTGATCCCGCGATGCGGGCGGCGCTGCAGAGCCAGCCGT CCGGCATTAACTCCTCGGACGATTGGACCCAGGCCATGCAACGCA TCATGGCGCTGACGACCCGCAACCCCGAAGCCTTTAGACAGCAGC CCCAGGCCAACCGGCTCTCGGCCATCCTGGAGGCCGTGGTGCCCT CGCGCTCCAACCCCACGCACGAGAAGGTCCTGGCCATCGTGAACG CGCTGGTGGAGAACAAGGCCATCCGCGGCGACGAGGCCGGCCTGG TGTACAACGCGCTGCTGGAGCGCGTGGCCCGCTACAACAGCACCA ACGTGCAGACCAACCTGGACCGCATGGTGACCGACGTGCGCGAGG CCGTGGCCCAGCGCGAGCGGTTCCACCGCGAGTCCAACCTGGGAT CCATGGTGGCGCTGAACGCCTTCCTCAGCACCCAGCCCGCCAACG TGCCCCGGGGCCAGGAGGACTACACCAACTTCATCAGCGCCCTGC GCCTGATGGTGACCGAGGTGCCCCAGAGCGAGGTGTACCAGTCCG GGCCGGACTACTTCTTCCAGACCAGTCGCCAGGGCTTGCAGACCG TGAACCTGAGCCAGGCTTTCAAGAACTTGCAGGGCCTGTGGGGCG TGCAGGCCCCGGTCGGGGACCGCGCGACGGTGTCGAGCCTGCTGA CGCCGAACTCGCGCCTGCTGCTGCTGCTGGTGGCCCCCTTCACGG ACAGCGGCAGCATCAACCGCAACTCGTACCTGGGCTACCTGATTA ACCTGTACCGCGAGGCCATCGGCCAGGCGCACGTGGACGAGCAGA CCTACCAGGAGATCACCCACGTGAGCCGCGCCCTGGGCCAGGACG ACCCGGGCAACCTGGAAGCCACCCTGAACTTTTTGCTGACCAACC GGTCGCAGAAGATCCCGCCCCAGTACGCGCTCAGCACCGAGGAGG AGCGCATCCTGCGTTACGTGCAGCAGAGCGTGGGCCTGTTCCTGA TGCAGGAGGGGGCCACCCCCAGCGCCGCGCTCGACATGACCGCGC GCAACATGGAGCCCAGCATGTACGCCAGCAACCGCCCGTTCATCA ATAAACTGATGGACTACTTGCATCGGGCGGCCGCCATGAACTCTG ACTATTTCACCAACGCCATCCTGAATCCCCACTGGCTCCCGCCGC CGGGGTTCTACACGGGCGAGTACGACATGCCCGACCCCAATGACG GGTTCCTGTGGGACGATGTGGACAGCAGCGTGTTCTCCCCCCGAC CGGGTGCTAACGAGCGCCCCTTGTGGAAGAAGGAAGGCAGCGACC GACGCCCGTCCTCGGCGCTGTCCGGCCGCGAGGGTGCTGCCGCGG CGGTGCCCGAGGCCGCCAGTCCTTTCCCGAGCTTGCCCTTCTCGC TGAACAGTATCCGCAGCAGCGAGCTGGGCAGGATCACGCGCCCGC GCTTGCTGGGCGAAGAGGAGTACTTGAATGACTCGCTGTTGAGAC CCGAGCGGGAGAAGAACTTCCCCAATAACGGGATAGAAAGCCTGG TGGACAAGATGAGCCGCTGGAAGACGTATGCGCAGGAGCACAGGG ACGATCCCCGGGCGTCGCAGGGGGCCACGAGCCGGGGCAGCGCCG CCCGTAAACGCCGGTGGCACGACAGGCAGCGGGGACAGATGTGGG ACGATGAGGACTCCGCCGACGACAGCAGCGTGTTGGACTTGGGTG GGAGTGGTAACCCGTTCGCTCACCTGCGCCCCCGTATCGGGCGCA TGATGTAAGAGAAACCGAAAATAAATGATACTCACCAAGGCCATG GCGACCAGCGTGCGTTCGTTTCTTCTCTGTTGTTGTTGTATCTAG TATGATGAGGCGTGCGTACCCGGAGGGTCCTCCTCCCTCGTACGA GAGCGTGATGCAGCAGGCGATGGCGGCGGCGGCGATGCAGCCCCC GCTGGAGGCTCCTTACGTGCCCCCGCGGTACCTGGCGCCTACGGA GGGGCGGAACAGCATTCGTTACTCGGAGCTGGCACCCTTGTACGA TACCACCCGGTTGTACCTGGTGGACAACAAGTCGGCGGACATCGC CTCGCTGAACTACCAGAACGACCACAGCAACTTCCTGACCACCGT GGTGCAGAACAATGACTTCACCCCCACGGAGGCCAGCACCCAGAC CATCAACTTTGACGAGCGCTCGCGGTGGGGCGGCCAGCTGAAAAC CATCATGCACACCAACATGCCCAACGTGAACGAGTTCATGTACAG CAACAAGTTCAAGGCGCGGGTGATGGTCTCCCGCAAGACCCCCAA TGGGGTGACAGTGACAGAGGATTATGATGGTAGTCAGGATGAGCT GAAGTATGAATGGGTGGAATTTGAGCTGCCCGAAGGCAACTTCTC GGTGACCATGACCATCGACCTGATGAACAACGCCATCATCGACAA TTACTTGGCGGTGGGGCGGCAGAACGGGGTGCTGGAGAGCGACAT CGGCGTGAAGTTCGACACTAGGAACTTCAGGCTGGGCTGGGACCC CGTGACCGAGCTGGTCATGCCCGGGGTGTACACCAACGAGGCTTT CCATCCCGATATTGTCTTGCTGCCCGGCTGCGGGGTGGACTTCAC CGAGAGCCGCCTCAGCAACCTGCTGGGCATTCGCAAGAGGCAGCC CTTCCAGGAAGGCTTCCAGATCATGTACGAGGATCTGGAGGGGGG CAACATCCCCGCGCTCCTGGATGTCGACGCCTATGAGAAAAGCAA GGAGGATGCAGCAGCTGAAGCAACTGCAGCCGTAGCTACCGCCTC TACCGAGGTCAGGGGCGATAATTTTGCAAGCGCCGCAGCAGTGGC AGCGGCCGAGGCGGCTGAAACCGAAAGTAAGATAGTCATTCAGCC GGTGGAGAAGGATAGCAAGAACAGGAGCTACAACGTACTACCGGA CAAGATAAACACCGCCTACCGCAGCTGGTACCTAGCCTACAACTA TGGCGACCCCGAGAAGGGCGTGCGCTCCTGGACGCTGCTCACCAC CTCGGACGTCACCTGCGGCGTGGAGCAAGTCTACTGGTCGCTGCC CGACATGATGCAAGACCCGGTCACCTTCCGCTCCACGCGTCAAGT TAGCAACTACCCGGTGGTGGGCGCCGAGCTCCTGCCCGTCTACTC CAAGAGCTTCTTCAACGAGCAGGCCGTCTACTCGCAGCAGCTGCG CGCCTTCACCTCGCTTACGCACGTCTTCAACCGCTTCCCCGAGAA CCAGATCCTCGTCCGCCCGCCCGCGCCCACCATTACCACCGTCAG TGAAAACGTTCCTGCTCTCACAGATCACGGGACCCTGCCGCTGCG CAGCAGTATCCGGGGAGTCCAGCGCGTGACCGTTACTGACGCCAG ACGCCGCACCTGCCCCTACGTCTACAAGGCCCTGGGCATAGTCGC GCCGCGCGTCCTCTCGAGCCGCACCTTCTAAATGTCCATTCTCAT CTCGCCCAGTAATAACACCGGTTGGGGCCTGCGCGCGCCCAGCAA GATGTACGGAGGCGCTCGCCAACGCTCCACGCAACACCCCGTGCG CGTGCGCGGGCACTTCCGCGCTCCCTGGGGCGCCCTCAAGGGCCG CGTGCGGTCGCGCACCACCGTCGACGACGTGATCGACCAGGTGGT GGCCGACGCGCGCAACTACACCCCCGCCGCCGCGCCCGTCTCCAC CGTGGACGCCGTCATCGACAGCGTGGTGGCcGACGCGCGCCGGTA CGCCCGCGCCAAGAGCCGGCGGCGGCGCATCGCCCGGCGGCACCG GAGCACCCCCGCCATGCGCGCGGCGCGAGCCTTGCTGCGCAGGGC CAGGCGCACGGGACGCAGGGCCATGCTCAGGGCGGCCAGACGCGC GGCTTCAGGCGCCAGCGCCGGCAGGACCCGGAGACGCGCGGCCAC GGCGGCGGCAGCGGCCATCGCCAGCATGTCCCGCCCGCGGCGAGG GAACGTGTACTGGGTGCGCGACGCCGCCACCGGTGTGCGCGTGCC CGTGCGCACCCGCCCCCCTCGCACTTGAAGATGTTCACTTCGCGA TGTTGATGTGTCCCAGCGGCGAGGAGGATGTCCAAGCGCAAATTC AAGGAAGAGATGCTCCAGGTCATCGCGCCTGAGATCTACGGCCCT GCGGTGGTGAAGGAGGAAAGAAAGCCCCGCAAAATCAAGCGGGTC AAAAAGGACAAAAAGGAAGAAGAAAGTGATGTGGACGGATTGGTG GAGTTTGTGCGCGAGTTCGCCCCCCGGCGGCGCGTGCAGTGGCGC GGGCGGAAGGTGCAACCGGTGCTGAGACCCGGCACCACCGTGGTC TTCACGCCCGGCGAGCGCTCCGGCACCGCTTCCAAGCGCTCCTAC GACGAGGTGTACGGGGATGATGATATTCTGGAGCAGGCGGCCGAG CGCCTGGGCGAGTTTGCTTACGGCAAGCGCAGCCGTTCCGCACCG AAGGAAGAGGCGGTGTCCATCCCGCTGGACCACGGCAACCCCACG CCGAGCCTCAAGCCCGTGACCTTGCAGCAGGTGCTGCCGACCGCG GCGCCGCGCCGGGGGTTCAAGCGCGAGGGCGAGGATCTGTACCCC ACCATGCAGCTGATGGTGCCCAAGCGCCAGAAGCTGGAAGACGTG CTGGAGACCATGAAGGTGGACCCGGACGTGCAGCCCGAGGTCAAG GTGCGGCCCATCAAGCAGGTGGCCCCGGGCCTGGGCGTGCAGACC GTGGACATCAAGATTCCCACGGAGCCCATGGAAACGCAGACCGAG CCCATGATCAAGCCCAGCACCAGCACCATGGAGGTGCAGACGGAT CCCTGGATGCCATCGGCTCCTAGTCGAAGACCCCGGCGCAAGTAC GGCGCGGCCAGCCTGCTGATGCCCAACTACGCGCTGCATCCTTCC ATCATCCCCACGCCGGGCTACCGCGGCACGCGCTTCTACCGCGGT CATACCAGCAGCCGCCGCCGCAAGACCACCACTCGCCGCCGCCGT CGCCGCACCGCCGCTGCAACCACCCCTGCCGCCCTGGTGCGGAGA GTGTACCGCCGCGGCCGCGCACCTCTGACCCTGCCGCGCGCGCGC TACCACCCGAGCATCGCCATTTAAACTTTCGCCtGCTTTGCAGAT CAATGGCCCTCACATGCCGCCTTCGCGTTCCCATTACGGGCTACC GAGGAAGAAAACCGCGCCGTAGAAGGCTGGCGGGGAACGGGATGC GTCGCCACCACCACCGGCGGCGGCGCGCCATCAGCAAGCGGTTGG GGGGAGGCTTCCTGCCCGCGCTGATCCCCATCATCGCCGCGGCGA TCGGGGCGATCCCCGGCATTGCTTCCGTGGCGGTGCAGGCCTCTC AGCGCCACTGAGACACACTTGGAAACATCTTGTAATAAACCaATG GACTCTGACGCTCCTGGTCCTGTGATGTGTTTTCGTAGACAGATG GAAGACATCAATTTTTCGTCCCTGGCTCCGCGACACGGCACGCGG CCGTTCATGGGCACCTGGAGCGACATCGGCACCAGCCAACTGAAC GGGGGCGCCTTCAATTGGAGCAGTCTCTGGAGCGGGCTTAAGAAT TTCGGGTCCACGCTTAAAACCTATGGCAGCAAGGCGTGGAACAGC ACCACAGGGCAGGCGCTGAGGGATAAGCTGAAAGAGCAGAACTTC CAGCAGAAGGTGGTCGATGGGCTCGCCTCGGGCATCAACGGGGTG GTGGACCTGGCCAACCAGGCCGTGCAGCGGCAGATCAACAGCCGC CTGGACCCGGTGCCGCCCGCCGGCTCCGTGGAGATGCCGCAGGTG GAGGAGGAGCTGCCTCCCCTGGACAAGCGGGGCGAGAAGCGACCC CGCCCCGATGCGGAGGAGACGCTGCTGACGCACACGGACGAGCCG CCCCCGTACGAGGAGGCGGTGAAACTGGGTCTGCCCACCACGCGG CCCATCGCGCCCCTGGCCACCGGGGTGCTGAAACCCGAAAAGCCC GCGACCCTGGACTTGCCTCCTCCCCAGCCTTCCCGCCCCTCTACA GTGGCTAAGCCCCTGCCGCCGGTGGCCGTGGCCCGCGCGCGACCC GGGGGCACCGCCCGCCCTCATGCGAACTGGCAGAGCACTCTGAAC AGCATCGTGGGTCTGGGAGTGCAGAGTGTGAAGCGCCGCCGCTGC TATTAAACCTACCGTAGCGCTTAACTTGCTTGTCTGTGTGTGTAT GTATTATGTCGCCGCCGCCGCTGTCCACCAGAAGGAGGAGTGAAG AGGCGCGTCGCCGAGTTGCAAGATGGCCACCCCATCGATGCTGCC CCAGTGGGCGTACATGCACATCGCCGGACAGGACGCTTCGGAGTA CCTGAGTCCGGGTCTGGTGCAGTTTGCCCGCGCCACAGACACCTA CTTCAGTCTGGGGAACAAGTTTAGGAACCCCACGGTGGCGCCCAC GCACGATGTGACCACCGACCGCAGCCAGCGGCTGACGCTGCGCTT CGTGCCCGTGGACCGCGAGGACAACACCTACTCGTACAAAGTGCG CTACACGCTGGCCGTGGGCGACAACCGCGTGCTGGACATGGCCAG CACCTACTTTGACATCCGCGGCGTGCTGGATCGGGGCCCTAGCTT CAAACCCTACTCCGGCACCGCCTACAACAGTCTGGCCCCCAAGGG AGCACCCAACACTTGTCAGTGGACATATAAAGCCGATGGTGAAAC TGCCACAGAAAAAACCTATACATATGGAAATGCACCCGTGCAGGG CATTAACATCACAAAAGATGGTATTCAACTTGGAACTGACACCGA TGATCAGCCAATCTACGCAGATAAAACCTATCAGCCTGAACCTCA AGTGGGTGATGCTGAATGGCATGACATCACTGGTACTGATGAAAA GTATGGAGGCAGAGCTCTTAAGCCTGATACCAAAATGAAGCCTTG TTATGGTTCTTTTGCCAAGCCTACTAATAAAGAAGGAGGTCAGGC AAATGTGAAAACAGGAACAGGCACTACTAAAGAATATGACATAGA CATGGCTTTCTTTGACAACAGAAGTGCGGCTGCTGCTGGCCTAGC TCCAGAAATTGTTTTGTATACTGAAAATGTGGATTTGGAAACTCC AGATACCCATATTGTATACAAAGCAGGCACAGATGACAGCAGCTC TTCTATTAATTTGGGTCAGCAAGCCATGCCCAACAGACCTAACTA CATTGGTTTCAGAGACAACTTTATCGGGCTCATGTACTACAACAG CACTGGCAATATGGGGGTGCTGGCCGGTCAGGCTTCTCAGCTGAA TGCTGTGGTTGACTTGCAAGACAGAAACACCGAGCTGTCCTACCA GCTCTTGCTTGACTCTCTGGGTGACAGAACCCGGTATTTCAGTAT GTGGAATCAGGCGGTGGACAGCTATGATCCTGATGTGCGCATTAT TGAAAATCATGGTGTGGAGGATGAACTTCCCAACTATTGTTTCCC TCTGGATGCTGTTGGCAGAACAGATACTTATCAGGGAATTAAGGC TAATGGAACTGATCAAACCACATGGACCAAAGATGACAGTGTCAA TGATGCTAATGAGATAGGCAAGGGTAATCCATTCGCCATGGAAAT CAACATCCAAGCCAACCTGTGGAGGAACTTCCTCTACGCCAACGT GGCCCTGTACCTGCCCGACTCTTACAAGTACACGCCGGCCAATGT TACCCTGCCCACCAACACCAACACCTACGATTACATGAACGGCCG GGTGGTGGCGCCCTCGCTGGTGGACTCCTACATCAACATCGGGGC GCGCTGGTCGCTGGATCCCATGGACAACGTGAACCCCTTCAACCA CCACCGCAATGCGGGGCTGCGCTACCGCTCCATGCTCCTGGGCAA CGGGCGCTACGTGCCCTTCCACATCCAGGTGCCCCAGAAATTTTT CGCCATCAAGAGCCTCCTGCTCCTGCCCGGGTCCTACACCTACGA GTGGAACTTCCGCAAGGACGTCAACATGATCCTGCAGAGCTCCCT CGGCAACGACCTGCGCACGGACGGGGCCTCCATCTCCTTCACCAG CATCAACCTCTACGCCACCTTCTTCCCCATGGCGCACAACACGGC CTCCACGCTCGAGGCCATGCTGCGCAACGACACCAACGACCAGTC CTTCAACGACTACCTCTCGGCGGCCAACATGCTCTACCCCATCCC GGCCAACGCCACCAACGTGCCCATCTCCATCCCCTCGCGCAACTG GGCCGCCTTCCGCGGCTGGTCCTTCACGCGTCTCAAGACCAAGGA GACGCCCTCGCTGGGCTCCGGGTTCGACCCCTACTTCGTCTACTC GGGCTCCATCCCCTACCTCGACGGCACCTTCTACCTCAACCACAC CTTCAAGAAGGTCTCCATCACCTTCGACTCCTCCGTCAGCTGGCC CGGCAACGACCGGCTCCTGACGCCCAACGAGTTCGAAATCAAGCG CACCGTCGACGGCGAGGGCTACAACGTGGCCCAGTGCAACATGAC CAAGGACTGGTTCCTGGTCCAGATGCTGGCCCACTACAACATCGG CTACCAGGGCTTCTACGTGCCCGAGGGCTACAAGGACCGCATGTA CTCCTTCTTCCGCAACTTCCAGCCCATGAGCCGCCAGGTGGTGGA CGAGGTCAACTACAAGGACTACCAGGCCGTCACCCTGGCCTACCA GCACAACAACTCGGGCTTCGTCGGCTACCTCGCGCCCACCATGCG CCAGGGCCAGCCCTACCCCGCCAACTACCCCTACCCGCTCATCGG CAAGAGCGCCGTCACCAGCGTCACCCAGAAAAAGTTCCTCTGCGA CAGGGTCATGTGGCGCATCCCCTTCTCCAGCAACTTCATGTCCAT GGGCGCGCTCACCGACCTCGGCCAGAACATGCTCTATGCCAACTC CGCCCACGCGCTAGACATGAATTTCGAAGTCGACCCCATGGATGA GTCCACCCTTCTCTATGTTGTCTTCGAAGTCTTCGACGTCGTCCG AGTGCACCAGCCCCACCGCGGCGTCATCGAGGCCGTCTACCTGCG CACCCCCTTCTCGGCCGGTAACGCCACCACCTAAGCTCTTGCTTC TTGCAAGCCATGGCCGCGGGCTCCGGCGAGCAGGAGCTCAGGGCC ATCATCCGCGACCTGGGCTGCGGGCCCTACTTCCTGGGCACCTTC GATAAGCGCTTCCCGGGATTCATGGCCCCGCACAAGCTGGCCTGC GCCATCGTCAACACGGCCGGCCGCGAGACCGGGGGCGAGCACTGG CTGGCCTTCGCCTGGAACCCGCGCTCGAACACCTGCTACCTCTTC GACCCCTTCGGGTTCTCGGACGAGCGCCTCAAGCAGATCTACCAG TTCGAGTACGAGGGCCTGCTGCGCCGCAGCGCCCTGGCCACCGAG GACCGCTGCGTCACCCTGGAAAAGTCCACCCAGACCGTGCAGGGT CCGCGCTCGGCCGCCTGCGGGCTCTTCTGCTGCATGTTCCTGCAC GCCTTCGTGCACTGGCCCGACCGCCCCATGGACAAGAACCCCACC ATGAACTTGCTGACGGGGGTGCCCAACGGCATGCTCCAGTCGCCC CAGGTGGAACCCACCCTGCGCCGCAACCAGGAGGCGCTCTACCGC TTCCTCAACTCCCACTCCGCCTACTTTCGCTCCCACCGCGCGCGC ATCGAGAAGGCCACCGCCTTCGACCGCATGAATCAAGACATGTAA ACCGTGTGTGTATGTTAAATGTCTTTAATAAACAGCACTTTCATG TTACACATGCATCTGAGATGATTTATTTAGAAATCGAAAGGGTTC TGCCGGGTCTCGGCATGGCCCGCGGGCAGGGACACGTTGCGGAAC TGGTACTTGGCCAGCCACTTGAACTCGGGGATCAGCAGTTTGGGC AGCGGGGTGTCGGGGAAGGAGTCGGTCCACAGCTTCCGCGTCAGT TGCAGGGCGCCCAGCAGGTCGGGCGCGGAGATCTTGAAATCGCAG TTGGGACCCGCGTTCTGCGCGCGGGAGTTGCGGTACACGGGGTTG CAGCACTGGAACACCATCAGGGCCGGGTGCTTCACGCTCGCCAGC ACCGTCGCGTCGGTGATGCTCTCCACGTCGAGGTCCTCGGCGTTG GCCATCCCGAAGGGGGTCATCTTGCAGGTCTGCCTTCCCATGGTG GGCACGCACCCGGGCTTGTGGTTGCAATCGCAGTGCAGGGGGATC AGCATCATCTGGGCCTGGTCGGCGTTCATCCCCGGGTACATGGCC TTCATGAAAGCCTCCAATTGCCTGAACGCCTGCTGGGCCTTGGCT CCCTCGGTGAAGAAGACCCCGCAGGACTTGCTAGAGAACTGGTTG GTGGCGCACCCGGCGTCGTGCACGCAGCAGCGCGCGTCGTTGTTG GCCAGCTGCACCACGCTGCGCCCCCAGCGGTTCTGGGTGATCTTG GCCCGGTCGGGGTTCTCCTTCAGCGCGCGCTGCCCGTTCTCGCTC GCCACATCCATCTCGATCATGTGCTCCTTCTGGATCATGGTGGTC CCGTGCAGGCACCGCAGCTTGCCCTCGGCCTCGGTGCACCCGTGC AGCCACAGCGCGCACCCGGTGCACTCCCAGTTCTTGTGGGCGATC TGGGAATGCGCGTGCACGAAGCCCTGCAGGAAGCGGCCCATCATG GTGGTCAGGGTCTTGTTGCTAGTGAAGGTCAGCGGAATGCCGCGG TGCTCCTCGTTGATGTACAGGTGGCAGATGCGGCGGTACACCTCG CCCTGCTCGGGCATCAGCTGGAAGTTGGCTTTCAGGTCGGTCTCC ACGCGGTAGCGGTCCATCAGCATAGTCATGATTTCCATACCCTTC TCCCAGGCCGAGACGATGGGCAGGCTCATAGGGTTCTTCACCATC ATCTTAGCGCTAGCAGCCGCGGCCAGGGGGTCGCTCTCGTCCAGG GTCTCAAAGCTCCGCTTGCCGTCCTTCTCGGTGATCCGCACCGGG GGGTAGCTGAAGCCCACGGCCGCCAGCTCCTCCTCGGCCTGTCTT TCGTCCTCGCTGTCCTGGCTGACGTCCTGCAGGACCACATGCTTG GTCTTGCGGGGTTTCTTCTTGGGCGGCAGCGGCGGCGGAGATGTT GGAGATGGCGAGGGGGAGCGCGAGTTCTCGCTCACCACTACTATC TCTTCCTCTTCTTGGTCCGAGGCCACGCGGCGGTAGGTATGTCTC TTCGGGGGCAGAGGCGGAGGCGACGGGCTCTCGCCGCCGCGACTT GGCGGATGGCTGGCAGAGCCCCTTCCGCGTTCGGGGGTGCGCTCC CGGCGGCGCTCTGACTGACTTCCTCCGCGGCCGGCCATTGTGTTC TCCTAGGGAGGAACAACAAGCATGGAGACTCAGCCATCGCCAACC TCGCCATCTGCCCCCACCGCCGACGAGAAGCAGCAGCAGCAGAAT GAAAGCTTAACCGCCCCGCCGCCCAGCCCCGCCACCTCCGACGCG GCCGTCCCAGACATGCAAGAGATGGAGGAATCCATCGAGATTGAC CTGGGCTATGTGACGCCCGCGGAGCACGAGGAGGAGCTGGCAGTG CGCTTTTCACAAGAAGAGATACACCAAGAACAGCCAGAGCAGGAA GCAGAGAATGAGCAGAGTCAGGCTGGGCTCGAGCATGACGGCGAC TACCTCCACCTGAGCGGGGGGGAGGACGCGCTCATCAAGCATCTG GCCCGGCAGGCCACCATCGTCAAGGATGCGCTGCTCGACCGCACC GAGGTGCCCCTCAGCGTGGAGGAGCTCAGCCGCGCCTACGAGTTG AACCTCTTCTCGCCGCGCGTGCCCCCCAAGCGCCAGCCCAATGGC ACCTGCGAGCCCAACCCGCGCCTCAACTTCTACCCGGTCTTCGCG GTGCCCGAGGCCCTGGCCACCTACCACATCTTTTTCAAGAACCAA AAGATCCCCGTCTCCTGCCGCGCCAACCGCACCCGCGCCGACGCC CTTTTCAACCTGGGTCCCGGCGCCCGCCTACCTGATATCGCCTCC TTGGAAGAGGTTCCCAAGATCTTCGAGGGTCTGGGCAGCGACGAG ACTCGGGCCGCGAACGCTCTGCAAGGAGAAGGAGGAGAGCATGAG CACCACAGCGCCCTGGTCGAGTTGGAAGGCGACAACGCGCGGCTG GCGGTGCTCAAACGCACGGTCGAGCTGACCCATTTCGCCTACCCG GCTCTGAACCTGCCCCCCAAAGTCATGAGCGCGGTCATGGACCAG GTGCTCATCAAGCGCGCGTCGCCCATCTCCGAGGACGAGGGCATG CAAGACTCCGAGGAGGGCAAGCCCGTGGTCAGCGACGAGCAGCTG GCCCGGTGGCTGGGTCCTAATGCTAGTCCCCAGAGTTTGGAAGAG CGGCGCAAACTCATGATGGCCGTGGTCCTGGTGACCGTGGAGCTG GAGTGCCTGCGCCGCTTCTTCGCCGACGCGGAGACCCTGCGCAAG GTCGAGGAGAACCTGCACTACCTCTTCAGGCACGGGTTCGTGCGC CAGGCCTGCAAGATCTCCAACGTGGAGCTGACCAACCTGGTCTCC TACATGGGCATCTTGCACGAGAACCGCCTGGGGCAGAACGTGCTG CACACCACCCTGCGCGGGGAGGCCCGGCGCGACTACATCCGCGAC TGCGTCTACCTCTACCTCTGCCACACCTGGCAGACGGGCATGGGC GTGTGGCAGCAGTGTCTGGAGGAGCAGAACCTGAAAGAGCTCTGC AAGCTCCTGCAGAAGAACCTCAAGGGTCTGTGGACCGGGTTCGAC GAGCGCACCACCGCCTCGGACCTGGCCGACCTCATTTTCCCCGAG CGCCTCAGGCTGACGCTGCGCAACGGCCTGCCCGACTTTATGAGC CAAAGCATGTTGCAAAACTTTCGCTCTTTCATCCTCGAACGCTCC GGAATCCTGCCCGCCACCTGCTCCGCGCTGCCCTCGGACTTCGTG CCGCTGACCTTCCGCGAGTGCCCCCCGCCGCTGTGGAGCCACTGC TACCTGCTGCGCCTGGCCAACTACCTGGCCTACCACTCGGACGTG ATCGAGGACGTCAGCGGCGAGGGCCTGCTCGAGTGCCACTGCCGC TGCAACCTCTGCACGCCGCACCGCTCCCTGGCCTGCAACCCCCAG CTGCTGAGCGAGACCCAGATCATCGGCACCTTCGAGTTGCAAGGG CCCAGCGAAGGCGAGGGTTCAGCCGCCAAGGGGGGTCTGAAACTC ACCCCGGGGCTGTGGACCTCGGCCTACTTGCGCAAGTTCGTGCCC GAGGACTACCATCCCTTCGAGATCAGGTTCTACGAGGACCAATCC CATCCGCCCAAGGCCGAGCTGTCGGCCTGCGTCATCACCCAGGGG GCGATCCTGGCCCAATTGCAAGCCATCCAGAAATCCCGCCAAGAA TTCTTGCTGAAAAAGGGCCGCGGGGTCTACCTCGACCCCCAGACC GGTGAGGAGCTCAACCCCGGCTTCCCCCAGGATGCCCCGAGGAAA CAAGAAGCTGAAAGTGGAGCTGCCGCCCGTGGAGGATTTGGAGGA AGACTGGGAGAACAGCAGTCAGGCAGAGGAGGAGGAGATGGAGGA AGACTGGGACAGCACTCAGGCAGAGGAGGACAGCCTGCAAGACAG TCTGGAGGAAGACGAGGAGGAGGCAGAGGAGGAGGTGGAAGAAGC AGCCGCCGCCAGACCGTCGTCCTCGGCGGGGGAGAAAGCAAGCAG CACGGATACCATCTCCGCTCCGGGTCGGGGTCCCGCTCGACCACA CAGTAGATGGGACGAGACCGGACGATTCCCGAACCCCACCACCCA GACCGGTAAGAAGGAGCGGCAGGGATACAAGTCCTGGCGGGGGCA CAAAAACGCCATCGTCTCCTGCTTGCAGGCCTGCGGGGGCAACAT CTCCTTCACCCGGCGCTACCTGCTCTTCCACCGCGGGGTGAACTT TCCCCGCAACATCTTGCATTACTACCGTCACCTCCACAGCCCCTA CTACTTCCAAGAAGAGGCAGCAGCAGCAGAAAAAGACCAGCAGAA AACCAGCAGCTAGAAAATCCACAGCGGCGGCAGCAGGTGGACTGA GGATCGCGGCGAACGAGCCGGCGCAAACCCGGGAGCTGAGGAACC GGATCTTTCCCACCCTCTATGCCATCTTCCAGCAGAGTCGGGGGC AGGAGCAGGAACTGAAAGTCAAGAACCGTTCTCTGCGCTCGCTCA CCCGCAGTTGTCTGTATCACAAGAGCGAAGACCAACTTCAGCGCA CTCTCGAGGACGCCGAGGCTCTCTTCAACAAGTACTGCGCGCTCA CTCTTAAAGAGTAGCCCGCGCCCGCCCAGTCGCAGAAAAAGGCGG GAATTACGTCACCTGTGCCCTTCGCCCTAGCCGCCTCCACCCATC ATCATGAGCAAAGAGATTCCCACGCCTTACATGTGGAGCTACCAG CCCCAGATGGGCCTGGCCGCCGGTGCCGCCCAGGACTACTCCACC CGCATGAATTGGCTCAGCGCCGGGCCCGCGATGATCTCACGGGTG AATGACATCCGCGCCCACCGAAACCAGATACTCCTAGAACAGTCA GCGCTCACCGCCACGCCCCGCAATCACCTCAATCCGCGTAATTGG CCCGCCGCCCTGGTGTACCAGGAAATTCCCCAGCCCACGACCGTA CTACTTCCGCGAGACGCCCAGGCCGAAGTCCAGCTGACTAACTCA GGTGTCCAGCTGGCGGGCGGCGCCACCCTGTGTCGTCACCGCCCC GCTCAGGGTATAAAGCGGCTGGTGATCCGGGGCAGAGGCACACAG CTCAACGACGAGGTGGTGAGCTCTTCGCTGGGTCTGCGACCTGAC GGAGTCTTCCAACTCGCCGGATCGGGGAGATCTTCCTTCACGCCT CGTCAGGCCGTCCTGACTTTGGAGAGTTCGTCCTCGCAGCCCCGC TCGGGTGGCATCGGCACTCTCCAGTTCGTGGAGGAGTTCACTCCC TCGGTCTACTTCAACCCCTTCTCCGGCTCCCCCGGCCACTACCCG GACGAGTTCATCCCGAACTTCGACGCCATCAGCGAGTCGGTGGAC GGCTACGATTGAAACTAATCACCCCCTTATCCAGTGAAATAAAGA TCATATTGATGATGATTTTACAGAAATAAAAAATAATCATTTGAT TTGAAATAAAGATACAATCATATTGATGATTTGAGTTTAACAAAA AAATAAAGAATCACTTACTTGAAATCTGATACCAGGTCTCTGTCC ATGTTTTCTGCCAACACCACTTCACTCCCCTCTTCCCAGCTCTGG TACTGCAGGCCCCGGCGGGCTGCAAACTTCCTCCACACGCTGAAG GGGATGTCAAATTCCTCCTGTCCCTCAATCTTCATTTTATCTTCT ATCAGATGTCCAAAAAGCGCGTCCGGGTGGATGATGACTTCGACC CCGTCTACCCCTACGATGCAGACAACGCACCGACCGTGCCCTTCA TCAACCCCCCCTTCGTCTCTTCAGATGGATTCCAAGAGAAGCCCC TGGGGGTGTTGTCCCTGCGACTGGCCGACCCCGTCACCACCAAGA ACGGGGAAATCACCCTCAAGCTGGGAGAGGGGGTGGACCTCGATT CCTCGGGAAAACTCATCTCCAACACGGCCACCAAGGCCGCCGCCC CTCTCAGTTTTTCCAACAACACCATTTCCCTTAACATGGATCACC CCTTTTACACTAAAGATGGAAAATTATCCTTACAAGTTTCTCCAC CATTAAATATACTGAGAACAAGCATTCTAAACACACTAGCTTTAG GTTTTGGATCAGGTTTAGGACTCCGTGGCTCTGCCTTGGCAGTAC AGTTAGTCTCTCCACTTACATTTGATACTGATGGAAACATAAAGC TTACCTTAGACAGAGGTTTGCATGTTACAACAGGAGATGCAATTG AAAGCAACATAAGCTGGGCTAAAGGTTTAAAATTTGAAGATGGAG CCATAGCAACCAACATTGGAAATGGGTTAGAGTTTGGAAGCAGTA GTACAGAAACAGGTGTTGATGATGCTTACCCAATCCAAGTTAAAC TTGGATCTGGCCTTAGCTTTGACAGTACAGGAGCCATAATGGCTG GTAACAAAGAAGACGATAAACTCACTTTGTGGACAACACCTGATC CATCACCAAACTGTCAAATACTCGCAGAAAATGATGCAAAACTAA CACTTTGCTTGACTAAATGTGGTAGTCAAATACTGGCCACTGTGT CAGTCTTAGTTGTAGGAAGTGGAAACCTAAACCCCATTACTGGCA CCGTAAGCAGTGCTCAGGTGTTTCTACGTTTTGATGCAAACGGTG TTCTTTTAACAGAACATTCTACACTAAAAAAATACTGGGGGTATA GGCAGGGAGATAGCATAGATGGCACTCCATATACCAATGCTGTAG GATTCATGCCCAATTTAAAAGCTTATCCAAAGTCACAAAGTTCTA CTACTAAAAATAATATAGTAGGGCAAGTATACATGAATGGAGATG TTTCAAAACCTATGCTTCTCACTATAACCCTCAATGGTACTGATG ACAGCAACAGTACATATTCAATGTCATTTTCATACACCTGGACTA ATGGAAGCTATGTTGGAGCAACATTTGGGGCTAACTCTTATACCT TCTCATACATCGCCCAAGAATGAACACTGTATCCCACCCTGCATG CCAACCCTTCCCACCCCACTCTGTGGAACAAACTCTGAAACACAA AATAAAATAAAGTTCAAGTGTTTTATTGATTCAACAGTTTTACAG GATTCGAGCAGTTATTTTTCCTCCACCCTCCCAGGACATGGAATA CACCACCCTCTCCCCCCGCACAGCCTTGAACATCTGAATGCCATT GGTGATGGACATGCTTTTGGTCTCCACGTTCCACACAGTTTCAGA GCGAGCCAGTCTCGGGTCGGTCAGGGAGATGAAACCCTCCGGGCA CTCCCGCATCTGCACCTCACAGCTCAACAGCTGAGGATTGTCCTC GGTGGTCGGGATCACGGTTATCTGGAAGAAGCAGAAGAGCGGCGG TGGGAATCATAGTCCGCGAACGGGATCGGCCGGTGGTGTCGCATC AGGCCCCGCAGCAGTCGCTGCCGCCGCCGCTCCGTCAAGCTGCTG CTCAGGGGGTCCGGGTCCAGGGACTCCCTCAGCATGATGCCCACG GCCCTCAGCATCAGTCGTCTGGTGCGGCGGGCGCAGCAGCGCATG CGGATCTCGCTCAGGTCGCTGCAGTACGTGCAACACAGAACCACC AGGTTGTTCAACAGTCCATAGTTCAACACGCTCCAGCCGAAACTC ATCGCGGGAAGGATGCTACCCACGTGGCCGTCGTACCAGATCCTC AGGTAAATCAAGTGGTGCCCCCTCCAGAACACGCTGCCCACGTAC ATGATCTCCTTGGGCATGTGGCGGTTCACCACCTCCCGGTACCAC ATCACCCTCTGGTTGAACATGCAGCCCCGGATGATCCTGCGGAAC CACAGGGCCAGCACCGCCCCGCCCGCCATGCAGCGAAGAGACCCC GGGTCCCGGCAATGGCAATGGAGGACCCACCGCTCGTACCCGTGG ATCATCTGGGAGCTGAACAAGTCTATGTTGGCACAGCACAGGCAT ATGCTCATGCATCTCTTCAGCACTCTCAACTCCTCGGGGGTCAAA ACCATATCCCAGGGCACGGGGAACTCTTGCAGGACAGCGAACCCC GCAGAACAGGGCAATCCTCGCACAGAACTTACATTGTGCATGGAC AGGGTATCGCAATCAGGCAGCACCGGGTGATCCTCCACCAGAGAA GCGCGGGTCTCGGTCTCCTCACAGCGTGGTAAGGGGGCCGGCCGA TACGGGTGATGGCGGGACGCGGCTGATCGTGTTCGCGACCGTGTC ATGATGCAGTTGCTTTCGGACATTTTCGTACTTGCTGTAGCAGAA CCTGGTCCGGGCGCTGCACACCGATCGCCGGCGGCGGTCTCGGCG CTTGGAACGCTCGGTGTTGAAATTGTAAAACAGCCACTCTCTCAG ACCGTGCAGCAGATCTAGGGCCTCAGGAGTGATGAAGATCCCATC ATGCCTGATGGCTCTGATCACATCGACCACCGTGGAATGGGCCAG ACCCAGCCAGATGATGCAATTTTGTTGGGTTTCGGTGACGGCGAG CCTCGGGAACAACGATGAAGTAAATGCAAGCGGTGCGTTCCAGCA TGGTTAGTTAGCTGATCTGTAGAAAAAACAAAAATGAACATTAAA CCATGCTAGCCTGGCGAACAGGTGGGTAAATCGTTCTCTCCAGCA CCAGGCAGGCCACGGGGTCTCCGGCGCGACCCTCGTAAAAATTGT CGCTATGATTGAAAACCATCACAGAGAGACGTTCCCGGTGGCCGG CGTGAATGATTCGACAAGATGAATACACCCCCGGAACATTGGCGT CCGCGAGTGAAAAAAAGCGCCCGAGGAAGCAATAAGGCACTACAA TGCTCAGTCTCAAGTCCAGCAAAGCGATGCCATGCGGATGAAGCA CAAAATTCTCAGGTGCGTACAAAATGTAATTACTCCCCTCCTGCA CAGGCAGCAAAGCCCCCGATCCCTCCAGGTACACATACAAAGCCT CAGCGTCCATAGCTTACCGAGCAGCAGCACACAACAGGCGCAAGA GTCAGAGAAAGGCTGAGCTCTAACCTGTCCACCCGCTCTCTGCTC AATATATAGCCCAGATCTACACTGACGTAAAGGCCAAAGTCTAAA AATACCCGCCAAATAATCACACACGCCCAGCACACGCCCAGAAAC CGGTGACACACTCAAAAAAATACGCGCACTTCCTCAAACGCCCAA AACTGCCGTCATTTCCGGGTTCCCACGCTACGTCATCAAAACACG ACTTTCAAATTCCGTCGACCGTTAAAAACGTCACCCGCCCCGCCC CTAACGGTCGCCCGTCTCTCAGCCAATCAGCGCCCCGCATCCCCA AATTCAAACACCTCATTTGCATATTAACGCGCACAAAAAGTTTGA GGTATATTATTGATGATG

    REFERENCES

    [0559] 1. Desrichard, A., Snyder, A. & Chan, T. A. Cancer Neoantigens and Applications for Immunotherapy. Clin. Cancer Res. Off J. Am. Assoc. Cancer Res. (2015). doi:10.1158/1078-0432.CCR-14-3175 [0560] 2. Schumacher, T. N. & Schreiber, R. D. Neoantigens in cancer immunotherapy. Science 348, 69-74 (2015). [0561] 3. Gubin, M. M., Artyomov, M. N., Mardis, E. R. & Schreiber, R. D. Tumor neoantigens: building a framework for personalized cancer immunotherapy. J. Clin. Invest. 125, 3413-3421 (2015). [0562] 4. Rizvi, N. A. et al. Cancer immunology. Mutational landscape determines sensitivity to PD-1 blockade in non-small cell lung cancer. Science 348, 124-128 (2015). [0563] 5. Snyder, A. et al. Genetic basis for clinical response to CTLA-4 blockade in melanoma. N. Engl. J. Med. 371, 2189-2199 (2014). [0564] 6. Carreno, B. M. et al. Cancer immunotherapy. A dendritic cell vaccine increases the breadth and diversity of melanoma neoantigen-specific T cells. Science 348, 803-808 (2015). [0565] 7. Tran, E. et al. Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer. Science 344, 641-645 (2014). [0566] 8. Hacohen, N. & Wu, C. J.-Y. United States Patent Application: 20110293637COMPOSITIONS AND METHODS OF IDENTIFYING TUMOR SPECIFIC NEOANTIGENS. (A1). at <http://appft1.uspto.gov/netacgi/nph-Parser?Sect1=PTO1&Sect2=HITOFF&d=PG01&p=1&u=/netahtml/PTO/srchnum.html&r=1&f=G&l=50&s1=20110293637.PGNR.> [0567] 9. Lundegaard, C., Hoof, I., Lund, O. & Nielsen, M. State of the art and challenges in sequence based T-cell epitope prediction. Immunome Res. 6 Suppl 2, S3 (2010). [0568] 10. Yadav, M. et al. Predicting immunogenic tumour mutations by combining mass spectrometry and exome sequencing. Nature 515, 572-576 (2014). [0569] 11. Bassani-Sternberg, M., Pletscher-Frankild, S., Jensen, L. J. & Mann, M. Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation. Mol. Cell. Proteomics MCP 14, 658-673 (2015). [0570] 12. Van Allen, E. M. et al. Genomic correlates of response to CTLA-4 blockade in metastatic melanoma. Science 350, 207-211 (2015). [0571] 13. Yoshida, K. & Ogawa, S. Splicing factor mutations and cancer. Wiley Interdiscip. Rev. RNA 5, 445-459 (2014). [0572] 14. Cancer Genome Atlas Research Network. Comprehensive molecular profiling of lung adenocarcinoma. Nature 511, 543-550 (2014). [0573] 15. Rajasagi, M. et al. Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia. Blood 124, 453-462 (2014). [0574] 16. Downing, S. R. et al. U.S. patent application Ser. No. 01/202,08706OPTIMIZATION OF MULTIGENE ANALYSIS OF TUMOR SAMPLES. (A1). at <http://appft1.uspto.gov/netacgi/nph-Parser?Sect1=PTO1&Sect2=HITOFF&d=PG01&p=1&u=/netahtml/PTO/srchnum.html&r=1&f=G&l=50&s1=20120208706.PGNR.> [0575] 17. Target Capture for NextGen SequencingIDT. at <http://www.idtdna.com/pages/products/nextgen/target-capture> [0576] 18. Shukla, S. A. et al. Comprehensive analysis of cancer-associated somatic mutations in class I HLA genes. Nat. Biotechnol. 33, 1152-1158 (2015). [0577] 19. Cieslik, M. et al. The use of exome capture RNA-seq for highly degraded RNA with application to clinical cancer sequencing. Genome Res. 25, 1372-1381 (2015). [0578] 20. Bodini, M. et al. The hidden genomic landscape of acute myeloid leukemia: subclonal structure revealed by undetected mutations. Blood 125, 600-605 (2015). [0579] 21. Saunders, C. T. et al. Strelka: accurate somatic small-variant calling from sequenced tumor-normal sample pairs. Bioinforma. Oxf Engl. 28, 1811-1817 (2012). [0580] 22. Cibulskis, K. et al. Sensitive detection of somatic point mutations in impure and heterogeneous cancer samples. Nat. Biotechnol. 31, 213-219 (2013). [0581] 23. Wilkerson, M. D. et al. Integrated RNA and DNA sequencing improves mutation detection in low purity tumors. Nucleic Acids Res. 42, e107 (2014). [0582] 24. Mose, L. E., Wilkerson, M. D., Hayes, D. N., Perou, C. M. & Parker, J. S. ABRA: improved coding indel detection via assembly-based realignment. Bioinforma. Oxf Engl. 30, 2813-2815 (2014). [0583] 25. Ye, K., Schulz, M. H., Long, Q., Apweiler, R. & Ning, Z. Pindel: a pattern growth approach to detect break points of large deletions and medium sized insertions from paired-end short reads. Bioinforma. Oxf Engl. 25, 2865-2871 (2009). [0584] 26. Lam, H. Y. K. et al. Nucleotide-resolution analysis of structural variants using BreakSeq and a breakpoint library. Nat. Biotechnol. 28, 47-55 (2010). [0585] 27. Frampton, G. M. et al. Development and validation of a clinical cancer genomic profiling test based on massively parallel DNA sequencing. Nat. Biotechnol. 31, 1023-1031 (2013). [0586] 28. Boegel, S. et al. HLA typing from RNA-Seq sequence reads. Genome Med. 4, 102 (2012). [0587] 29. Liu, C. et al. ATHLATES: accurate typing of human leukocyte antigen through exome sequencing. Nucleic Acids Res. 41, e142 (2013). [0588] 30. Mayor, N. P. et al. HLA Typing for the Next Generation. PloS One 10, e0127153 (2015). [0589] 31. Roy, C. K., Olson, S., Graveley, B. R., Zamore, P. D. & Moore, M. J. Assessing long-distance RNA sequence connectivity via RNA-templated DNA-DNA ligation. eLife 4, (2015). [0590] 32. Song, L. & Florea, L. CLASS: constrained transcript assembly of RNA-seq reads. BMC Bioinformatics 14 Suppl 5, S14 (2013). [0591] 33. Maretty, L., Sibbesen, J. A. & Krogh, A. Bayesian transcriptome assembly. Genome Biol. 15, 501 (2014). [0592] 34. Pertea, M. et al. StringTie enables improved reconstruction of a transcriptome from RNA-seq reads. Nat. Biotechnol. 33, 290-295 (2015). [0593] 35. Roberts, A., Pimentel, H., Trapnell, C. & Pachter, L. Identification of novel transcripts in annotated genomes using RNA-Seq. Bioinforma. Oxf Engl. (2011). doi:10.1093/bioinformatics/btr355 [0594] 36. Vitting-Seerup, K., Porse, B. T., Sandelin, A. & Waage, J. splice R: an R package for classification of alternative splicing and prediction of coding potential from RNA-seq data. BMC Bioinformatics 15, 81 (2014). [0595] 37. Rivas, M. A. et al. Human genomics. Effect of predicted protein-truncating genetic variants on the human transcriptome. Science 348, 666-669 (2015). [0596] 38. Skelly, D. A., Johansson, M., Madeoy, J., Wakefield, J. & Akey, J. M. A powerful and flexible statistical framework for testing hypotheses of allele-specific gene expression from RNA-seq data. Genome Res. 21, 1728-1737 (2011). [0597] 39. Anders, S., Pyl, P. T. & Huber, W. HTSeqa Python framework to work with high-throughput sequencing data. Bioinforma. Oxf Engl. 31, 166-169 (2015). [0598] 40. Furney, S. J. et al. SF3B1 mutations are associated with alternative splicing in uveal melanoma. Cancer Discov. (2013). doi:10.1158/2159-8290.CD-13-0330 [0599] 41. Zhou, Q. et al. A chemical genetics approach for the functional assessment of novel cancer genes. Cancer Res. (2015). doi:10.1158/0008-5472.CAN-14-2930 [0600] 42. Maguire, S. L. et al. SF3B1 mutations constitute a novel therapeutic target in breast cancer. J. Pathol. 235, 571-580 (2015). [0601] 43. Carithers, L. J. et al. A Novel Approach to High-Quality Postmortem Tissue Procurement: The GTEx Project. Biopreservation Biobanking 13, 311-319 (2015). [0602] 44. Xu, G. et al. RNA CoMPASS: a dual approach for pathogen and host transcriptome analysis of RNA-seq datasets. PloS One 9, e89445 (2014). [0603] 45. Andreatta, M. & Nielsen, M. Gapped sequence alignment using artificial neural networks: application to the MHC class I system. Bioinforma. Oxf Engl. (2015). doi:10.1093/bioinformatics/btv639 [0604] 46. J?rgensen, K. W., Rasmussen, M., Buus, S. & Nielsen, M. NetMHCstabpredicting stability of peptide-MHC-I complexes; impacts for cytotoxic T lymphocyte epitope discovery. Immunology 141, 18-26 (2014). [0605] 47. Larsen, M. V. et al. An integrative approach to CTL epitope prediction: a combined algorithm integrating MHC class I binding, TAP transport efficiency, and proteasomal cleavage predictions. Eur. J. Immunol. 35, 2295-2303 (2005). [0606] 48. Nielsen, M., Lundegaard, C., Lund, O. & Ke mir, C. The role of the proteasome in generating cytotoxic T-cell epitopes: insights obtained from improved predictions of proteasomal cleavage. Immunogenetics 57, 33-41 (2005). [0607] 49. Boisvert, F.-M. et al. A Quantitative Spatial Proteomics Analysis of Proteome Turnover in Human Cells. Mol. Cell. Proteomics 11, M111.011429-M111.011429 (2012). [0608] 50. Duan, F. et al. Genomic and bioinformatic profiling of mutational neoepitopes reveals new rules to predict anticancer immunogenicity. J. Exp. Med. 211, 2231-2248 (2014). [0609] 51. Janeway's Immunobiology: 9780815345312: Medicine & Health Science Books @Amazon.com. at <http://www.amazon.com/Janeways-Immunobiology-Kenneth-Murphy/dp/0815345313> [0610] 52. Calis, J. J. A. et al. Properties of MHC Class I Presented Peptides That Enhance Immunogenicity. PLoS Comput. Biol. 9, e1003266 (2013). [0611] 53. Zhang, J. et al. Intratumor heterogeneity in localized lung adenocarcinomas delineated by multiregion sequencing. Science 346, 256-259 (2014) [0612] 54. Walter, M. J. et al. Clonal architecture of secondary acute myeloid leukemia. N. Engl. J. Med. 366, 1090-1098 (2012). [0613] 55. Hunt D F, Henderson R A, Shabanowitz J, Sakaguchi K, Michel H, Sevilir N, Cox A L, Appella E, Engelhard V H. Characterization of peptides bound to the class I MHC molecule HLA-A2.1 by mass spectrometry. Science 1992. 255: 1261-1263. [0614] 56. Zarling A L, Polefrone J M, Evans A M, Mikesh L M, Shabanowitz J, Lewis S T, Engelhard V H, Hunt D F. Identification of class I MHC-associated phosphopeptides as targets for cancer immunotherapy. Proc Natl Acad Sci USA. 2006 Oct. 3; 103(40):14889-94. [0615] 57. Bassani-Sternberg M, Pletscher-Frankild S, Jensen L J, Mann M. Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation. Mol Cell Proteomics. 2015 March; 14(3):658-73. doi: 10.1074/mcp.M114.042812. [0616] 58. Abelin J G, Trantham P D, Penny S A, Patterson A M, Ward S T, Hildebrand W H, Cobbold M, Bai D L, Shabanowitz J, Hunt D F. Complementary IMAC enrichment methods for HLA-associated phosphopeptide identification by mass spectrometry. Nat Protoc. 2015 September; 10(9):1308-18. doi: 10.1038/nprot.2015.086. Epub 2015 Aug. 6 [0617] 59. Barnstable C J, Bodmer W F, Brown G, Galfre G, Milstein C, Williams A F, Ziegler A. Production of monoclonal antibodies to group A erythrocytes, HLA and other human cell surface antigens-new tools for genetic analysis. Cell. 1978 May; 14(1):9-20. [0618] 60. Goldman J M, Hibbin J, Kearney L, Orchard K, Th'ng K H. HLA-DR monoclonal antibodies inhibit the proliferation of normal and chronic granulocytic leukaemia myeloid progenitor cells. Br J Haematol. 1982 November; 52(3):411-20. [0619] 61. Eng J K, Jahan T A, Hoopmann M R. Comet: an open-source MS/MS sequence database search tool. Proteomics. 2013 January; 13(1):22-4. doi: 10.1002/pmic.201200439. Epub 2012 Dec. 4. [0620] 62. Eng J K, Hoopmann M R, Jahan T A, Egertson J D, Noble W S, MacCoss M J. A deeper look into Cometimplementation and features. J Am Soc Mass Spectrom. 2015 November; 26(11):1865-74. doi: 10.1007/s13361-015-1179-x. Epub 2015 Jun. 27. [0621] 63. Lukas Kall, Jesse Canterbury, Jason Weston, William Stafford Noble and Michael J. MacCoss. Semi-supervised learning for peptide identification from shotgun proteomics datasets. Nature Methods 4:923-925, November 2007 [0622] 64. Lukas Kall, John D. Storey, Michael J. MacCoss and William Stafford Noble. Assigning confidence measures to peptides identified by tandem mass spectrometry. Journal of Proteome Research, 7(1):29-34, January 2008 [0623] 65. Lukas Kall, John D. Storey and William Stafford Noble. Nonparametric estimation of posterior error probabilities associated with peptides identified by tandem mass spectrometry. Bioinformatics, 24(16):i42-i48, August 2008 [0624] 66. Kinney R M, B J Johnson, V L Brown, D W Trent. Nucleotide Sequence of the 26 S mRNA of the Virulent Trinidad Donkey Strain of Venezuelan Equine Encephalitis Virus and Deduced Sequence of the Encoded Structural Proteins. Virology 152 (2), 400-413. 1986 Jul. 30. [0625] 67. Jill E Slansky, Fr?d?rique M Rattis, Lisa F Boyd, Tarek Fahmy, Elizabeth M Jaffee, Jonathan P Schneck, David H Margulies, Drew M Pardoll. Enhanced Antigen-Specific Antitumor Immunity with Altered Peptide Ligands that Stabilize the MHC-Peptide-TCR Complex. Immunity, Volume 13, Issue 4, 1 Oct. 2000, Pages 529-538. [0626] 68. A Y Huang, P H Gulden, A S Woods, M C Thomas, C D Tong, W Wang, V H Engelhard, G Pasternack, R Cotter, D Hunt, D M Pardoll, and E M Jaffee. The immunodominant major histocompatibility complex class I-restricted antigen of a murine colon tumor derives from an endogenous retroviral gene product. Proc Natl Acad Sci USA; 93(18): 9730-9735, 1996 Sep. 3. [0627] 69. JOHNSON, BARBARA J. B., RICHARD M. KINNEY, CRYSTLE L. KOST AND DENNIS W. TRENT. Molecular Determinants of Alphavirus Neurovirulence: Nucleotide and Deduced Protein Sequence Changes during Attenuation of Venezuelan Equine Encephalitis Virus. J Gen Virol 67:1951-1960, 1986. [0628] 70. Aarnoudse, C. A., Kr?se, M., Konopitzky, R., Brouwenstijn, N., and Schrier, P. I. (2002). TCR reconstitution in Jurkat reporter cells facilitates the identification of novel tumor antigens by cDNA expression cloning. Int J Cancer 99, 7-13. [0629] 71. Alexander, J., Sidney, J., Southwood, S., Ruppert, J., Oseroff, C., Maewal, A., Snoke, K., Serra, H. M., Kubo, R. T., and Sette, A. (1994). Development of high potency universal DR-restricted helper epitopes by modification of high affinity DR-blocking peptides. Immunity 1, 751-761. [0630] 72. Banu, N., Chia, A., Ho, Z. Z., Garcia, A. T., Paravasivam, K., Grotenbreg, G. M., Bertoletti, A., and Gehring, A. J. (2014). Building and optimizing a virus-specific T cell receptor library for targeted immunotherapy in viral infections. Scientific Reports 4, 4166. [0631] 73. Comet, S., Miconnet, I., Menez, J., Lemonnier, F., and Kosmatopoulos, K. (2006). Optimal organization of a polypeptide-based candidate cancer vaccine composed of cryptic tumor peptides with enhanced immunogenicity. Vaccine 24, 2102-2109. [0632] 74. Depla, E., van der Aa, A., Livingston, B. D., Crimi, C., Allosery, K., de Brabandere, V., Krakover, J., Murthy, S., Huang, M., Power, S., et al. (2008). Rational design of a multiepitope vaccine encoding T-lymphocyte epitopes for treatment of chronic hepatitis B virus infections. Journal of Virology 82, 435-450. [0633] 75. Ishioka, G. Y., Fikes, J., Hermanson, G., Livingston, B., Crimi, C., Qin, M., del Guercio, M. F., Oseroff, C., Dahlberg, C., Alexander, J., et al. (1999). Utilization of MHC class I transgenic mice for development of minigene DNA vaccines encoding multiple HLA-restricted CTL epitopes. J Immunol 162, 3915-3925. [0634] 76. Janetzki, S., Price, L., Schroeder, H., Britten, C. M., Welters, M. J. P., and Hoos, A. (2015). Guidelines for the automated evaluation of Elispot assays. Nat Protoc 10, 1098-1115. [0635] 77. Lyons, G. E., Moore, T., Brasic, N., Li, M., Roszkowski, J. J., and Nishimura, M. I. (2006). Influence of human CD8 on antigen recognition by T-cell receptor-transduced cells. Cancer Res 66, 11455-11461. [0636] 78. Nagai, K., Ochi, T., Fujiwara, H., An, J., Shirakata, T., Mineno, J., Kuzushima, K., Shiku, H., Melenhorst, J. J., Gostick, E., et al. (2012). Aurora kinase A-specific T-cell receptor gene transfer redirects T lymphocytes to display effective antileukemia reactivity. Blood 119, 368-376. [0637] 79. Panina-Bordignon, P., Tan, A., Termijtelen, A., Demotz, S., Corradin, G., and Lanzavecchia, A. (1989). Universally immunogenic T cell epitopes: promiscuous binding to human MHC class II and promiscuous recognition by T cells. Eur J Immunol 19, 2237-2242. [0638] 80. Vitiello, A., Marchesini, D., Furze, J., Sherman, L. A., and Chesnut, R. W. (1991). Analysis of the HLA-restricted influenza-specific cytotoxic T lymphocyte response in transgenic mice carrying a chimeric human-mouse class I major histocompatibility complex. J Exp Med 173, 1007-1015. [0639] 81. Yachi, P. P., Ampudia, J., Zal, T., and Gascoigne, N. R. J. (2006). Altered peptide ligands induce delayed CD8-T cell receptor interactiona role for CD8 in distinguishing antigen quality. Immunity 25, 203-211. [0640] 82. Pushko P, Parker M, Ludwig G V, Davis N L, Johnston R E, Smith J F. Replicon-helper systems from attenuated Venezuelan equine encephalitis virus: expression of heterologous genes in vitro and immunization against heterologous pathogens in vivo. Virology. 1997 Dec. 22; 239(2):389-401. [0641] 83. Strauss, J H and E G Strauss. The alphaviruses: gene expression, replication, and evolution. Microbiol Rev. 1994 September; 58(3): 491-562. [0642] 84. Rh?me C, Ehrengruber M U, Grandgirard D. Alphaviral cytotoxicity and its implication in vector development. Exp Physiol. 2005 January; 90(1):45-52. Epub 2004 Nov. 12. [0643] 85. Riley, Michael K. II, and Wilfred Vermerris. Recent Advances in Nanomaterials for Gene DeliveryA Review. Nanomaterials 2017, 7(5), 94. [0644] 86. Frolov I, Hardy R, Rice C M. Cis-acting RNA elements at the 5 end of Sindbis virus genome RNA regulate minus- and plus-strand RNA synthesis. RNA. 2001 November; 7(11):1638-51. [0645] 87. Jose J, Snyder J E, Kuhn R J. A structural and functional perspective of alphavirus replication and assembly. Future Microbiol. 2009 September; 4(7):837-56. [0646] 88. Bo Li and C. olin N. Dewey. RSEM: accurate transcript quantification from RNA-Seq data with or without a referenfe genome. BMC Bioinformatics, 12:323, August 2011 [0647] 89. Hillary Pearson, Tariq Daouda, Diana Paola Granados, Chantal Durette, Eric Bonneil, Mathieu Courcelles, Anja Rodenbrock, Jean-Philippe Laverdure, Caroline C?t?, Sylvie Mader, S?bastien Lemieux, Pierre Thibault, and Claude Perreault. MHC class I-associated peptides derive from selective regions of the human genome. The Journal of Clinical Investigation, 2016, [0648] 90. Juliane Liepe, Fabio Marino, John Sidney, Anita Jeko, Daniel E. Bunting, Alessandro Sette, Peter M. Kloetzel, Michael P. H. Stumpf, Albert J. R. Heck, Michele Mishto. A large fraction of HLA class I ligands are proteasome-generated spliced peptides. Science, 21, October 2016. [0649] 91. Mommen G P., Marino, F., Meiring H D., Poelen, M C., van Gaans-van den Brink, J A., Mohammed S., Heck A J., and van Els C A. Sampling From the Proteome to the Human Leukocyte Antigen-DR (HLA-DR) Ligandome Proceeds Via High Specificity. Mol Cell Proteomics 15(4): 1412-1423, April 2016. [0650] 92. Sebastian Kreiter, Mathias Vormehr, Niels van de Roemer, Mustafa Diken, Martin L?wer, Jan Diekmann, Sebastian Boegel, Barbara Schr?rs, Fulvia Vascotto, John C. Castle, Arbel D. Tadmor, Stephen P. Schoenberger, Christoph Huber, ?zlem T?reci, and Ugur Sahin. Mutant MHC class II epitopes drive therapeutic immune responses to caner. Nature 520, 692-696, April 2015. [0651] 93. Tran E., Turcotte S., Gros A., Robbins P. F., Lu Y. C., Dudley M. E., Wunderlich J. R., Somerville R. P., Hogan K., Hinrichs C. S., Parkhurst M. R., Yang J. C., Rosenberg S. A. Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer. Science 344(6184) 641-645, May 2014. [0652] 94. Andreatta M., Karosiene E., Rasmussen M., Stryhn A., Buus S., Nielsen M. Accurate pan-specific prediction of peptide-MHC class II binding affinity with improved binding core identification. Immunogenetics 67(11-12) 641-650, November 2015. [0653] 95. Nielsen, M., Lund, O. NN-align. An artificial neural network-based alignment algorithm for MHC class II peptide binding prediction. BMC Bioinformatics 10:296, September 2009. [0654] 96. Nielsen, M., Lundegaard, C., Lund, O. Prediction of MHC class II binding affinity using SMM-align, a novel stabilization matrix alignment method. BMC Bioinformatics 8:238, July 2007. [0655] 97. Zhang, J., et al. PEAKS DB: de novo sequencing assisted database search for sensitive and accurate peptide identification. Molecular & Cellular Proteomics. 11(4):1-8. Jan. 2, 2012. [0656] 98. Jensen, Kamilla Kjaergaard, et al. Improved Methods for Prediting Peptide Binding Affinity to MHC Class II Molecules. Immunology, 2018, doi:10.1111/imm.12889. [0657] 99. Carter, S. L., Cibulskis, K., Helman, E., McKenna, A., Shen, H., Zack, T., Laird, P. W., Onofrio, R. C., Winckler, W., Weir, B. A., et al. (2012). Absolute quantification of somatic DNA alterations in human cancer. Nat. Biotechnol. 30, 413-421 [0658] 100. McGranahan, N., Rosenthal, R., Hiley, C. T., Rowan, A. J., Watkins, T. B. K., Wilson, G. A., Birkbak, N. J., Veeriah, S., Van Loo, P., Herrero, J., et al. (2017). Allele-Specific HLA Loss and Immune Escape in Lung Cancer Evolution. Cell 171, 1259-1271.e11. [0659] 101. Shukla, S. A., Rooney, M. S., Rajasagi, M., Tiao, G., Dixon, P. M., Lawrence, M. S., Stevens, J., Lane, W. J., Dellagatta, J. L., Steelman, S., et al. (2015). Comprehensive analysis of cancer-associated somatic mutations in class I HLA genes. Nat. Biotechnol. 33, 1152-1158. [0660] 102. Van Loo, P., Nordgard, S. H., Lingjorde, O. C., Russnes, H. G., Rye, I. H., Sun, W., Weigman, V. J., Marynen, P., Zetterberg, A., Naume, B., et al. (2010). Allele-specific copy number analysis of tumors. Proc. Natl. Acad. Sci. U.S.A 107, 16910-16915. [0661] 103. Van Loo, P., Nordgard, S. H., Lingjorde, O. C., Russnes, H. G., Rye, I. H., Sun, W., Weigman, V. J., Marynen, P., Zetterberg, A., Naume, B., et al. (2010). Allele-specific copy number analysis of tumors. Proc. Natl. Acad. Sci. U.S.A 107, 16910-16915. [0662] 104. MacLean, B., Tomazela, D. M., Shulman, N., Chambers, M., Finney, G. L., Frewen, B., Kern, R., Tabb, D. L., Liebler, D. C., MacCoss, M. J., (2010). Skyline: an open source document editor for creating and analyzing targeted proteomics experiments. Bioinformatics 26(7), 966-8.