Methods for treating multidrug resistant breast cancer
12037361 ยท 2024-07-16
Assignee
Inventors
- Ming-Cheung Larry CHOW (Hong Kong, CN)
- Kit Ying CHOY (Hong Kong, CN)
- Chin Fung CHAN (Hong Kong, CN)
- Lai King WONG (Hong Kong, CN)
Cpc classification
A61K38/16
HUMAN NECESSITIES
C07K14/00
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K31/704
HUMAN NECESSITIES
C07K2319/10
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C07K2319/01
CHEMISTRY; METALLURGY
A61K31/475
HUMAN NECESSITIES
International classification
A61K31/475
HUMAN NECESSITIES
A61K31/704
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
The present disclosure provides methods and composition for treating multi-drug resistant cancers, in particular, breast cancers, via administration to a subject the composition including a peptide having a sequence complementary to a highly conserved motif present in substantially all integrins responsible for an integrin-mediated attachment-independent chemoresistance to one or more chemotherapeutic agents. The binding of the sequence of the peptide to the highly conserved motif will enhance accumulation of the chemotherapeutic agents in the tumor-initiating cells and in turn restores the function of the chemotherapeutic agents in the tumor-initiating cells.
Claims
1. A composition comprising a peptide, the peptide comprising a TAT peptide represented by SEQ ID NO:1 and a Shank-associated RH domain-interacting protein (SHARPIN) represented by SEQ ID NO:2; or a retro-inverso peptide thereof, wherein the TAT peptide is directly bound to the SHARPIN peptide (SP).
2. The composition of claim 1, wherein the TAT peptide and SHARPIN-derived peptide are synthesized together into a D-retro-inverso (DRI) form.
3. The composition of claim 2, wherein the SHARPIN-derived peptide is synthesized based on D-amino acids for preventing from protease digestion when the composition is administered to a subject in need thereof.
4. The composition of claim 3, wherein the DRI-TAT-SP peptide is modified at the N- and C-termini thereof.
5. The composition of claim 4, wherein the N-terminus of the DRI-TAT-SP peptide is acetylated while the C-terminus thereof is amidated.
6. The composition of claim 4, wherein the DRI-TAT-SP peptide comprises SEQ ID NO: 6.
7. The composition of claim 1, wherein the peptide comprises SEQ ID NO: 4.
8. A method for treating multi-drug resistant breast cancer comprising administering to a subject in need thereof a combination of an effective amount of the composition of claim 1 and an effective amount of one or more chemotherapeutic agents.
9. The method of claim 8, wherein the one or more chemotherapeutic agents comprise an anthracycline or DNA topoisomerase II inhibitor.
10. The method of claim 8, wherein the one or more chemotherapeutic agents comprise doxorubicin (DOX), paclitaxel (PTX) or vincristine (VCR).
11. The method of claim 8, wherein the composition is administered to the subject via one or more routes selected from the group consisting of intravenous and intraperitoneal injections.
12. The method of claim 8, wherein the composition comprises a peptide represented by SEQ ID NO: 4.
13. The method of claim 12, wherein the peptide is synthesized into a D-retro-inverso (DRI) form and represented by SEQ ID NO: 6.
14. The method of claim 8, wherein the subject is human and the multi-drug resistant breast cancer is human breast cancer.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1) The appended drawings, where like reference numerals refer to identical or functionally similar elements, contain figures of certain embodiments to further illustrate and clarify the above and other aspects, advantages and features of the present invention. It will be appreciated that these drawings depict embodiments of the invention and are not intended to limit its scope. The invention will be described and explained with additional specificity and detail through the use of the accompanying drawings in which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33) Skilled artisans will appreciate that elements in the figures are illustrated for simplicity and clarity and have not necessarily been depicted to scale.
DETAILED DESCRIPTION OF THE INVENTION
(34) It will be apparent to those skilled in the art that modifications, including additions and/or substitutions, may be made without departing from the scope and spirit of the invention. Specific details may be omitted so as not to obscure the invention; however, the disclosure is written to enable one skilled in the art to practice the teachings herein without undue experimentation.
(35) (1) Role of ITGA2 in Multidrug Resistance in CSCs
(36) The present disclosure provides methods and related composition for targeting an integrin-mediated attachment-dependent chemoresistance mechanism in cancer stem cells (CSCs) including breast cancer stem cells (BCSCs). ITGA2, a type of integrin, shows the greatest upregulation among 84 genes studied RT.sup.2 qPCR primer assay (
(37) In order to evaluate the role of ITGA2 in chemoresistance of BCSCs, a knock-out (KO) ITGA2 in vitro model is created in MCF-7 AC, named as A2KO AC, by CRISPR and its mammospheres (A2KO MS) are produced (
(38) (2) Role of Conserved Membrane Proximal KXGFFKR (SEQ ID NO: 31) Motif in DOX-Resistant CSCs
(39) A highly conserved motif, KXGFFKR (SEQ ID NO: 31), in ITGA2 has been found in all ?-integrins. To study the correlation between this conserved membrane proximal motif and drug resistance to DOX, a commonly used chemotherapeutic agent of breast cancer, ITGA2 is overexpressed in A2KO AC by transfection of different ITGA2 plasmids as shown in
(40) (3) Role of Activation of ITGB1 in DOX Resistance of CSCs Via Stimulation of Akt Pathway by KXGFFKR (SEQ ID NO: 31) Motif
(41) ITGA2, through its KXGFFKR (SEQ ID NO: 31) motif, is responsible for activation of ITGB1, which in turn stimulates different downstream pathways including Akt signaling pathway.
(42) Stimulation of Akt pathway leads to upregulation of ABC transporters and enhanced drug efflux activity to mediate drug resistance in CSCs.
(43) Activation of Akt pathway by ITGA2 is also susceptible to DOX resistance via inhibition of DOX-induced apoptosis. To verify this potential mechanism, an annexin V apoptosis assay is performed on different ITGA2 mutants. Consistent with the results obtained from DOX-induced Akt phosphorylation in
(44) (4) Role of Interaction Between KXGFFKR (SEQ ID NO: 31) Motif and Calreticulin (CRT) in ITGB1 Activation and DOX Resistance
(45) CRT is a multifunctional protein involved in various cellular activities like protein folding, phagocytosis, cell proliferation and metastasis. CRT binds to ITGA2 and helps activate ITGB1, which in turn prevents cell surface localization of CRT and mediates phagocytosis.
(46) To assess whether CRT is involved in activation of ITGB1 and ITGA2-mediated DOX-resistance, cell surface CRT localization is measured by indirect immunofluorescence staining with flow cytometry.
(47) Cytoplasmic CRT is known to promote cell survival and inhibit metastasis through activation of MAPK pathway and degradation of p53.
(48) (5) Use of SHARPIN-Derived TAT-Peptide to Reverse Chemoresistance in DOX-Resistant CSCs by Competition with CRT for KXGFFKR (SEQ ID NO: 31) Motif
(49) SHARPIN, an inhibitor of ITGB1, can interact with the highly conserved KXGFFKR (SEQ ID NO: 31) motif of ?-integrin. More specifically, a ubiquitin-like (UBL) domain of the SHARPIN interacts with that motif to inactivate ITGB1. In this regard, a SHARPIN-derived (SP) peptide (SEQ ID NO: 2) derived from the UBL domain of the SHARPIN (residues 259-281) is synthesized (
(50)
(51) (6) Pharmacokinetics of DRI-TAT-SP
(52) To achieve a better peptide stability, a D-retro inverso (DRI) peptide of TAT-SP, namely DRI-TAT-SP, is synthesized, which is shown to be effective in reversing chemoresistance in BCSCs in the presence of DOX with EC.sub.50 of 2.3?0.4 ?M (
(53) Six- to eight-week-old female Balb/c mice are administered with DRI-TAT-SP intravenously (i.v.) at 25 mg/kg, and the peptide plasma concentration is monitored from 0 to 7 hrs.
(54) (7) In Vivo Toxicity of DRI-TAT-SP
(55) Healthy Balb/c mice are administered intravenously with: (1) DOX 1.2 mg/kg, (2) DRI-TAT-SP 25 mg/kg or (3) DOX 1.2 mg/kg plus DRI-TAT-SP 25 mg/kg once every two days for a total of 10 injections. DRI-TAT-SP alone causes a small drop in body weight by 2.7?4.4% after 10 injections. However, when combined with DOX, the mice suffer from a more significant body weight loss by 10.5?3.7%, given that DOX alone does not cause significant body weight loss (+0.6?2.4%) (
(56) (8) DRI-TAT-SP Combined with DOX Significantly Inhibits Tumor Growth in MCF7 Breast Cancer Xenograft
(57) The MCF7 human breast cancer xenograft model is established in female Balb/c nude mice supplemented with 17?-estradiol to support the tumor growth. The MCF7 tumor could reach 3.3-fold increase in volume (325?84 mm.sup.3) in 20 days with a tumor doubling time of 11.8 days if only PBS was given. DRI-TAT-SP 25 mg/kg alone showed 10.1% tumor inhibition (325?135 mm.sup.3) with no statistical significances (P>0.1) while DOX 1.2 mg/kg alone could only inhibit the tumor growth by 21.5% (270?73 mm.sup.3, P<0.1) (
(58) TABLE-US-00001 TABLE 1 Summary of in vivo efficacy and toxicity of doxorubicin combined with DRI-TAT-SP in treating MCF7 breast cancer. Tumor Tumor No. of Animals doubling inhibition toxicity Treatment group (n) time (Days) (%) death PBS 10 11.8 0 0/8 Doxorubicin (1.2 mg/kg) 8 14.8 21.5 0/8 DRI-TAT-SP (25 mg/kg) 8 12.9 10.1 0/6 Doxorubicin (1.2 mg/kg) + 10 27.7 49.2 0/7 DRI-TAT-SP (25 mg/kg)
(59) Data obtained are analyzed to evaluate treatment outcomes. Tumor doubling time is calculated using tumor volumes obtained from the end of experiment versus the tumor volumes on the first day of treatment. Tumor inhibition (%) is calculated using the tumor volumes obtained from the end of experiment. Corresponding equations of determining tumor inhibition (T/C) and tumor doubling time (Td) are provided as follows:
(60)
(61) In summary, the present disclosure proposes that an attachment-independent, ITGA2 KXGFFKR (SEQ ID NO: 31) motif-mediated chemoresistance mechanism in BCSCs is a potential target to be reversed. Integrin ITGA2 coupled with ITGB1 to serve as a high affinity receptor for collagen type I and its significant upregulation in CSC and MCF-7 MS are crucial to chemoresistance in CSC and MS derived from MCF-7 AC. Silencing ITGA2 significantly reduces anticancer drug IC.sub.50 in A2KO MS, confirming the role of ITGA2 in chemoresistance. The pronounced effect of ITGA2 is mostly due to the downregulation of other integrins after ITGA2 KO. Reintroduction of full-length ITGA2, but not the motif-deficient ITGA2 or KXGFFKR (SEQ ID NO: 31) motif alone, successfully rescues corresponding mutants, suggesting that KXGFFKR (SEQ ID NO: 31) motif is required but not sufficient to induce attachment-independent chemoresistance. Upon binding to CRT at its KXGFFKR (SEQ ID NO: 31) motif, ITGA2 induces chemoresistance by activation of ITGB1, stimulating subsequent Akt pathway for (1) upregulation of MRP1/P-gp and promotion of their drug efflux activities for enhanced drug efflux; and (2) inhibition of anticancer drug-induced apoptosis. Activated ITGB1 (3) prevents cell surface localization of CRT, confining them at the cytoplasm to promote cell survival. The proposed SHARPIN-derived peptides, TAT-SP and DRI-TAT-SP, compete with CRT for KXGFFKR (SEQ ID NO: 31) motif via their UBL domain of SIRAPIN to disrupt ITGA2/CRT interaction as well as ITGB1 inactivation.
(62) The proposed SHARPIN-derived peptides, TAT-SP and DRI-TAT-SP, reverse effectively the multidrug resistance in MCF-7 breast CSCs at DOX-EC.sub.50 of 0.4?0.1 ?M and 2.3?0.4 ?M, respectively. When combined with DOX at 1.2 mg/kg in vivo, DRI-TAT-SP could suppress the tumor progression in MCF-7 xenograft model by 49.2% after 10 injections in 20 days, showing its potential to treat breast cancers. Although i.v. administration of DRI-TAT-SP at 25 mg/kg does not give a prolonged residence in systemic circulation, a rapid peptide distribution to tumor at around 10,000 ng/g tissues supports its effectiveness in DOX sensitization to kill the breast cancer cells in vivo. Despite body weight drop observed, DOX/DRI-TAT-SP combination does not cause severe organ alteration. Data provided in the present disclosure support ITGA2 as a new therapeutic target to reverse chemoresistance in breast cancer by disrupting ITGA2/CRT interaction.
(63) The following examples are intended to aid the understanding and enablement of certain embodiments in the present disclosure, which should not be considered as limiting the scope of the present invention.
Examples
(64) (A) General DNA Amplification Methods
(65) DNA amplification was conducted by PCR using Phusion polymerase (ThermoFisher Scientific). All sgRNA and cDNA expression plasmids were transformed and stored as glycerol stocks at ?80C in E coli cells. All vectors and plasmids used in mammalian cell assays were purified using endotoxin-free DNA plasmid maxiprep kit (Bioteke). Hygromycin B used for either plasmid maintenance or selection were purchased from Invitrogen.
(66) (B) General Mammalian Cell Culture Conditions:
(67) MCF-7 and derived cells were cultured in Minimal Eagles Media (MEM) containing 10% (v/v) fetal bovine serum (FBS), 100U/mL penicillin, 100 ?g/mL streptomycin and 0.01 mg/mL human recombinant insulin. CSCs were produced by sorting a CD24.sup.low/CD44.sup.high subpopulation. CSCs or MCF-7-derived MS were cultured in MAMMOCULT? Human Basal media (STEMCELL TECHNOLOGIES) containing 10% (v/v) MAMMOCULT? Proliferation Supplement (STEMCELL TECHNOLOGIES), 4 ?g/mL Heparin Solution (STEMCELL technologies) and 0.48 ?g/mL Hydrocortisone (STEMCELL TECHNOLOGIES). All cell types were incubated, maintained and cultured at 37? C. with 5% CO.sub.2.
(68) (C) Generation of ITGA2 KO Clone:
(69) Construction of an expression plasmid for sgRNAs was done as previously reported. Two oligo pairs encoding the 20-nt guide sequences of ITGA2 (Table 2) were annealed and ligated into pSpCas9(BB)-2A-GFP (PX458) plasmid. pSpCas9(BB)-2A-GFP (PX458) was a gift from Feng Zhang (Addgene plasmid #48138). Correct cloning and sequences were confirmed by Sanger sequencing. MCF-7 AC were seeded on 6-well plates and transfected at approximately 70% confluency with 2.5 ?g with sgRNAs and 10 ng GFP plasmid expression (generous gift from Dr. Ben Ko), 5 ?L Lipofectamine P3000 and 7.5 ?L Lipofectamine 3000 (Life Technologies) as per the manufacturer's instructions. Cells were cultured for 48 hours and sorted for GFP fluorescence using FACSAria III Flow Cytometer (Becton Dickenson Bioscience). GFP-positive cells were collected and cultured.
(70) TABLE-US-00002 TABLE2 PrimersusedforgeneratingsgRNAplasmidsandmammaliancellgenomic DNAamplification: SEQID Primer Sequence NO. ITGA2KOsgRNA-A 5-CACCGTGTGTTTCTAGGTTACTGGT-3 7 forward ITGA2KOSgRNA-A 5-AAACACCAGTAACCTAGAAACACAC-3 8 reverse ITGA2KOsgRNA-B 5-CACCGATCAAGCCGAGGCTCATGT-3 9 forward ITGA2KOSgRNA-B 5-AAACACATGAGCCTCGGCTTGATC-3 10 reverse ITGA2sequencing 5-AGAAAGGCAGCAGGTCAAATC-3 11 forward ITGA2sequencing 5-CCTCAGATTGGGAGGGATGGT-3 12 reverse ITGA2dm 5-CTCTggTTgCAATTTTATggAAATATgAAAAgATgA-3 13 forward ITGA2dm 5-TTggTCATCTTTTCATATTTCCATAAAATTgCAACC-3 14 reverse
(71) (D) Generation of Overexpression Clones:
(72) pCMV-ITGA2-CH cDNA plasmid was purchased from Sino Biological Inc. for overexpression full-length ITGA2. KLGFFKR (SEQ ID NO: 29) motif was removed by PCR-mediated deletion as previously described with ITGA2 dm primers and pCMV-ITGA2-CH (Sino Biological Inc.) plasmid as template listed in above Table 2. pcDNA 3.1 (+) Tac6 and pcDNA 3.1 (+) Tac?Scr plasmids were a gift from Chinten James Lim (Addgene plasmid #80019). MCF-7 and A2KO AC were seeded on 6-well plates and transfected at approximately 70% confluency with 2.5 ?g cDNA plasmid, 5 ?L Lipofectamine P3000 and 7.5 ?L Lipofectamine 3000 (Life Technologies) as per the manufacturer's instructions. Cells were selected with 50 ?g/mL hygromycin B for 3-5 days and maintained in medium with 10 ?g/mL hygromycin B (Invitrogen) for maintenance of cDNA expression.
(73) (E) Chemotherapeutic Drugs and Culture Media:
(74) Doxorubicin (DOX), Paclitaxel (PTX) and Vincristine (VCR), 3-(4,5-Dimethylthiazol-2-yl)-5-[3-(carboxymethoxy)phenyl]-2-(4-sulfo-phenyl)-2H-tetrazolium (MTS) and phenazine methosulfate (PMS) was purchased from Promega. Minimal essential Media (MEM) was purchased from Life Technologies. MAMMOCULT? Human Basal Media and its supplements were purchased from STEMCELL Technologies. 170-estradiol pellets (0.72 mg, 60-day release) was purchased from Innovative Research of America (Sarasota, FL).
(75) (F) Flow Cytometry Analysis:
(76) Cells were detached by Phosphate buffered saline (PBS) with 2.5 mM EDTA and washed with PBS. For determining CSC population, a total of 1?10.sup.6 cells were incubated with APC-CD44 (BD Biosciences) and PE-CD24 (BD Biosciences) in FACS solution (PBS with 1% BSA and 1 mM EDTA) for 30 minutes on ice. APC-IgG2 (BD Biosciences) and PE-IgG2 (BD Biosciences) were used as isotype controls. For determining apoptotic population, a total of 1?10.sup.6 cells were first treated with or without 1 ?M DOX for 24 hours, in the absence or presence of 1 ?M TAT-SP or TAT-SPScr, followed by incubation with FITC-Annexin V (BD Biosciences) and propidium iodide (PI) in binding buffer (10 mM Hepes, pH 7.4, 140 mM NaCl and 2.5 mM CaCl.sub.2) for 30 minutes on ice as per the manufacturer's instructions. For determining CRT surface localization, a total of 1?10.sup.6 cells, treated with or without 1 ?M DOX for 24 hours, were incubated with anti-CRT antibody (1:800, CST) in PBS with 3% BSA for 1 hour on ice. After washing with PBS, cells were further incubated with 2 ?g/mL goat anti-rabbit Alexa Fluor 488 (Invitrogen) for 45 minutes on ice. Fluorescence signals were analyzed by BD Accuri C6 flow cytometer (BD Biosciences).
(77) (G) Semi-Quantitative Reverse Transcription-Polymerase Chain Reaction (RT-PCR) and Quantitative Real-Time PCR (qRT-PCR) and RT.sup.2 qPCR Primer Assay:
(78) The total RNA was extracted from MCF-7 AC and derived cells using TRIzol reagent (Invitrogen) according to the manufacturer's instructions and reverse-transcribed into cDNA using High Capacity cDNA Reverse Transcription Kits (Applied Biosystems). The primer sequences were designed using Primer Blast and listed as Table 3. qRT-PCR amplification was performed using GOTAQ? qPCR Master Mix (PROMEGA) according to the manufacturer's instructions. The relative mRNA level was normalized to ?-actin and the difference in mRNA levels was estimated using the 2.sup.???Ct method. RT.sup.2 qPCR Primer Assay was performed using RT.sup.2 PROFILER? PCR array (Qiagen) containing a set of 84 human cancer stem cell-focus genes.
(79) TABLE-US-00003 TABLE3 PrimersusedforqRT-PCR: Primer Sequence SEQIDNO ITGA1 forward 5-GGTGCTTATTGGTTCTCCGTTAG-3 15 reverse 5-TTCTCCTTTACTTCTGTGACATTGG-3 16 ITGA2 forward 5-GGAACGGGACTTTCGCAT-3 17 reverse 5-GGTACTTCGGCTTTCTCATCA-3 18 ITGA10 forward 5-AGTAAAGGCAGTTGGATTCTCATAGAC-3 19 reverse 5-GAGCTGCACTCTGGAGACCAAT-3 20 ITGB1 forward 5-AATGAATGCCAAATGGGACACGGG-3 21 reverse 5-TTCAGTGTTGTGGGATTTGCACGG-3 22 MRP1 forward 5-ATGTCACGTGGAATACCAGC-3 23 reverse 5-GAAGACTGAACTCCCTTCCT-3 24 ?-actin forward 5-CTCTTCCAGCCTTCCTTCCT-3 25 reverse 5-AGCACTGTGTTGGCGTACAG-3 26
(80) (H) Peptide Synthesis:
(81) The peptides were composed of a ubiquitin-like (UBL) domain, SELGFPPAVQRWVIGRCLCVPER (SEQ ID NO: 2), with or without a cell penetrating peptide sequence (TAT), RKKRRQRRR (SEQ ID NO: 1). The DRI-TAT-SP was produced in a reversed sequence using D-amino acids and was protected by acetylation at N-terminus and amidation at C-terminus to make it more resistant to enzymatic degradation.
(82) In certain exemplary embodiments, the following peptides are used to prepare the present composition: (i) TAT-peptide (SEQ ID NO: 1): (ii) SHARPIN-derived peptide (SP): SELGFPPAVQRWVIGRCLCVPER (SEQ ID NO: 2); (iii) TAT-SP peptide: RKKRRQRRRSELGFPPAVQRWVIGRCLCVPER (SEQ ID NO: 4); (iv) DRI-TAT-SP peptide: Ac-repvclcrgivwrqvappfglesrrrqrrkkr-NH.sub.2 (SEQ ID NO: 6),
(83) where one-letter amino acid code in upper case denotes L-amino acids; one-letter amino acid code in lower case denotes D-amino acids.
(84) Other peptides such as SPScr (SEQ ID NO: 3) and TAT-SPScr (SEQ ID NO: 5) are used to synthesize comparative compositions in certain assays with the afore-mentioned exemplary compositions, in particular, to compare with the compositions comprising TAT-SP peptide (SEQ ID NO: 4) and DRI-TAT-SP peptide (SEQ ID NO: 6).
(85) (I) DOX Accumulation Assay:
(86) To assess MRP1 activity, 2?105 MCF-7 AC and derived cells, with or without 24-hour incubation of 1 ?M TAT-SP or TAT-SPScr, were treated with 5 ?M DOX at 37? C. for 2 hours. After removal of extracellular drugs, cells were divided into two equal halves. One half was lysed with lysis buffer (isopropanol with 0.75 M HCl and 0.2% Triton X-100) at room temperature for 30 minutes; the other half was incubated with 5 ?M CMFDA (Invitrogen) in darkness at room temperature for 30 minutes. The fluorescent intensities of drugs and dyes were detected with CLARIOstar (BMG LABTECH) and relative drug concentrations were normalized to CMFDA level.
(87) (J) Immunoprecipitation:
(88) Calreticulin (CRT) from MCF-7-derived cells was immunoprecipitated by anti-CRT (CST) antibody. In brief, MCF-7-derived cells, with or without 24-hour incubation of 1 ?M TAT-SP or TAT-SPScr, were collected and subsequently lysed with RIPA buffer on ice for 30 minutes. The lysate was diluted 5-fold with PBS and incubated with anti-CRT antibody overnight at 4? C. with simultaneous mixing on a rotating platform, followed by further incubation of Protein-G PLUS agarose (Santa Cruz Biotechnology) at 4? C. for at least 2 hours.
(89) After incubation, agarose beads were centrifuged and washed by PBS. Immunoprecipitated proteins were collected by treating the beads with 0.2 M glycine and subjected to Western Blotting (WB) analysis.
(90) (K) Protein Preparation and Western Blotting:
(91) Total protein was extracted with RIPA buffer supplied with protease inhibitor (Roche), resolved in 10% SDS-PAGE and transferred onto Immobilon-P PVDF membrane (Millipore). Membranes were blocked with 5% non-fat dry milk in Tris-buffered saline with 0.1% Tween (TBST) for 2 hours, then were incubated overnight with corresponding antibodies at 4? C., followed by incubation with horseradish peroxidase-conjugated goat anti-mouse IgG (Santa Cruz Biotechnology) or goat anti-rabbit IgG (Santa Cruz Biotechnology) as appropriate, for 2 hours at room temperature in TBST. Antibody binding was detected with Pierce ECL Western Blotting Substrate (Thermo Scientific) and images were visualized with Azure C600 imaging system (Azure Biosystems). The antibodies used were anti-ITGA2 (Abcam), anti-CRT (CST), anti-ILR2 (CST), anti-MRP1/ABCC1 (CST), anti-Mdr-1 (Santa Cruz Biotechnology), anti-Akt (pan) (CST), anti-pAkt (S473) (CST), anti-pAkt (T308) (CST), p53 (Santa Cruz Biotechnology) and anti-?-actin (Santa Cruz Biotechnology).
(92) (L) Determination of 50% Inhibitory Concentration (IC.sub.50) by MTS Assay:
(93) MCF-7 AC and derived cells were seeded onto 96-well plates at a density of 1?10.sup.4 cells per well and treatments of anticancer drugs or peptides were administered accordingly. Following 72-hour incubation at 37? C. with 5% CO.sub.2, cell viability was assessed using CellTiter 96 AQueous Non-Radioactive Cell Proliferation Assay (Promega). The IC.sub.50 value was estimated from the optical density at 492 nm using GraphPad.
(94) (M) Pharmacokinetic Study of SHARPIN-Derived Peptides:
(95) SHARPIN-derived peptides powder was dissolved in 1?PBS and administered intravenously at 25 mg/kg to overnight-starved Balb/c mice (n=3). At different time points (5, 15, 30, 60, 120, 240, 420 min), blood was collected via cardiac puncture and placed in a heparinized Eppendorf tube followed by centrifuged at 14,000 rpm for 5 min to obtain blood plasma. Plasma was stored at ?80? C. until analysis. Plasma concentration data were analyzed by non-compartmental model. Area under plasma concentration-time curve (AUC), distribution half-life (t.sub.1/2?) and elimination half-life (t.sub.1/2?) were calculated by PK solution2.0 (Summit Research Service, Ashland, USA).
(96) (N) DRI-TAT-SP Accumulation Assay in Tumors:
(97) DRI-TAT-SP 25 mg/kg were administered intravenously to female Balb/c nude mice bearing MCF7 xenograft. At different time points (5, 30, 60, 120 and 240 min), tumors were collected after the sacrifice of the mice. Tumors were weighed and added with 3 volumes of 1?PBS for tissue homogenization. The samples were stored at ?80? C. before analysis.
(98) (O) UPLC/QQQ-MS Analysis Protocol:
(99) Agilent 6460 Ultra Performance Liquid Chromatography-Electrospray Ionization Triple Quadrupole mass spectrometer (UPLC-QQQ-MS) was used in sample separation, peptide detection and quantification. Waters Acquity UPLC BEH Protein C4 column (1.7 ?m, 2.1?100 mm) was used for separation. SHARPIN-derived peptides were separated and eluted by a gradient of water (0.1% FA, v/v) and acetonitrile (ACN) (0.1% FA, v/v) at a constant flow rate of 0.3 mL/min. During separation, an elution protocol was used as follows. Equilibration: 0 to 1 min, 5% ACN. Elution gradient: 1 to 10 min, ACN from 5 to 99%. Regeneration: 10 to 11 min, 99% ACN, then 11 to 11.5 min, ACN from 99% to 5%. Re-equilibration: 11.5 to 13 min: 5% acetonitrile. A hundred microlitres of plasma/tumor samples were added with 300 ?L acetonitrile (1% formic acid (FA)) for protein and peptide precipitation. Supernatants were discarded after centrifugation at 14,000 rpm for 10 minutes. Then the samples were reconstituted in 50% methanol (0.1% FA, v/v), filtered through a 0.22 ?m nylon filter, and kept in the autosampler at 4? C. for analysis. Twenty microliters were injected into the MS. The MS was operated in positive electrospray ionization (ESI+) mode with supply of 300? C. gas temperature and sheath gas temperature, 8 L/min drying gas, and 11 L/min sheath gas flow and 3.5 kV capillary voltage. The signals of TAT-SP and DRI-TAT-SP were recorded at m/z 563 to 661 at collision energy (CE) of 15 eV and m/z 569 to 637 at CE of 20 eV, respectively. TAT-SP and DRI-TAT-SP were eluted at 4.05 and 3.86 minutes, respectively.
(100) (P) In Vivo Toxicity Test in Balb/c Mice:
(101) Healthy female Balb/c mice (6-8 weeks old) were randomized into 3 groups and were administered with (1) DOX 1.2 mg/kg i.v., (2) DRI-TAT-SP 25 mg/kg i.v, and (3) DOX 1.2 mg/kg+DRI-TAT-SP 25 mg/kg i.v. once every two days (q2d) for 10 injections via tail vein injection. The body weight of the mice was measured once every 2 days. Any toxicity symptoms including body weight change and behavioral changes will be monitored. Body weight drop more than 15% suggested treatment induced toxicity.
(102) (Q) In Vivo Efficacy Study of DRI-TAT-SP Combined with DOX in Treating MCF7 Breast Cancer Xenograft Model:
(103) Six- to eight-week-old female Balb/c nude mice were maintained under specific pathogen-free conditions prior to in vivo efficacy study. Each animal was implanted with a piece of 170-estradiol pellet 0.72 mg, 60-day release. (Cat No. SE-121, Innovative Research of America, Sarasota, FL). Four days later, the nude mice were inserted at the both flanks with a sesame sized (around 10 mm.sup.3) MCF-7 tumor piece originated from a tumor bulk. When the tumor reached approximately 100 mm.sup.3 (21-28 days), the mice were randomized and administered intravenously with (1) 1?PBS, (2) DOX 1.2 mg/kg, (3) DRI-TAT-SP 25 mg/kg or (4) DOX 1.2 mg/kg+DRI-TAT-SP 25 mg/kg once every 2 days for a total of 10 injections. Tumor volume was measured using digital caliper once every 4 days. Estimated tumor volume (mm.sup.3) was calculated as ??length (mm)?width (mm).sup.2. The mouse body weights were recorded once every two days. The tumor doubling time (Td) was calculated as t?log 2/log(V.sub.f/V.sub.0), where t, V.sub.f and V.sub.0 stand for interval time, percentage change of tumor volume on final day and percentage change of tumor volume on initial day.
(104) Flow cytometry data were analyzed with BD Accuri C6 software (BD Biosciences). Densitometric analysis was carried out by ImageJ software. Statistical analysis was performed using GraphPad Prism 5 and SPSS. Student t-test was employed to determine significant differences.
(105) Although the invention has been described in terms of certain embodiments, other embodiments apparent to those of ordinary skill in the art are also within the scope of this invention. Accordingly, the scope of the invention is intended to be defined only by the claims which follow.
INDUSTRIAL APPLICABILITY
(106) The proposed disruption of ITGA2/CRT interaction by two SHARPIN-derived peptides, TAT-SP and DRI-TAT-SP, is a new therapeutic target to reverse chemoresistance in breast CSCs (