P53 POST-TRANSLATIONAL MODIFICATIONS AS MARKERS IN THE DIAGNOSIS AND PROGNOSIS OF A NEURODEGENERATIVE DISEASE

20240230678 ยท 2024-07-11

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention refers to p53 sequence and post translational modifications (PTMs) and to their use as biomarkers in the diagnosis of neurodegenerative disease and cognitive decline and/or in the prognosis of Alzheimer's disease at different stages and/or of neurodegenerative disease in a biological sample. The invention also provides for a 1) diagnostic method based on a highly accurate mass spectrometry analysis for the diagnosis of neurodegenerative disease, including Mild Cognitive Impairment (MCI), Alzheimer's disease (AD), fronto-temporal dementia (FTD), Lewi's Body (LB), and vascular dementia (VD) in a subject, by evaluating the PTMs to the said p53 linear sequence protein and possible cut of its full sequence specifically in human plasma of patients; and 2) prognosis of AD in CU and MCI patients.

Claims

1. An in vitro or ex vivo method for the diagnosis or prognosis of a neurodegenerative disease, the method comprising the step of: a) analysing a biofluid sample for the presence of post-translation modifications (PTMs) in the region of amino acids 1-371 of the p53 protein (U-p53), said PTMs being: PTM-1 at the amino acid M1, PTM-2 at the amino acid K164, PTM-3 at the amino acid K370, PTM-4 at the amino acid L101, PTM-5 at the amino acid K120, PTM-6 at the amino acid K132, PTM-7 at the amino acid K139, PTM-8 at the amino acid K291, PTM-9 at the amino acid K357, PTM-10 at the amino acid S6, PTM-11 at the amino acid S33, wherein the presence of at least two PTMs selected from PTM-2, PTM-7, PTM-8, and PTM-11 is indicative of a cognitive unimpaired subject (CU), b) assessing the presence of: at least two PTMs selected from PTM-1, PTM-3, PTM-4, PTM-5, PTM-6, PTM-9, and PTM-10, and at least one PTM selected from PTM-2, PTM-7, PTM-8, and PTM-11, as indicative of the occurrence or the risk of development of a neurological disease, said neurodegenerative disease being selected from Mild Cognitive Impairment (MCI), Alzheimer's disease (AD), Fronto-temporal dementia (FTD), Lewi's Body (LB), and vascular dementia (VD), c) correlating the PTMs assessed in step b) with those identifying the corresponding neurodegenerative disease, wherein the presence of PTM-1, and PTM-10 is indicative of MCI; the presence of at least two PTMs selected from PTM-4, PTM-5, and PTM-9 is indicative of a prognosis of cognitive decline to AD of an asymptomatic subject; the presence of at least two PTMs selected from PTM-1, PTM-3, PTM-5, PTM-6, and PTM-10 is indicative of MCI with a prognosis of cognitive decline to AD; the presence of PTM-5, and PTM-9 is indicative of FTD; the presence of PTM-5, and PTM-6 is indicative of LB; the presence of PTM-4, and PTM-5 is indicative of VD, or wherein said in vitro or ex vivo method is for differentiating Alzheimer's disease, from other neurodegenerative diseases, wherein in step b) the assessment of following criteria are indicative of AD: a sequence variability in terms of length within the region of amino acids 1-271, said variability including a truncation within the same region, and the presence of at least two PTMs selected from PTM-1, PTM-3, PTM-4, PTM-5, and PTM-6, in a residual amount of untruncated sequence.

2. The in vitro or ex vivo method of claim 1, wherein: the post-translation modification PTM-1 has a group COCH3 branched to the amino acid M1 of the p53 protein; the post-translation modification PTM-2 has a group COCH3 branched to the amino acid K164 of the p53 protein; the post-translation modification PTM-3 has a group COCH3 branched to the amino acid K370 of the p53 protein; the post-translation modification PTM-4 has a ubiquitination site [GG] branched at the amino acid K101 of the p53 protein; the post-translation modification PTM-5 has a ubiquitination site [GG] branched at the amino acid K120 of the p53 protein; the post-translation modification PTM-6 has a ubiquitination site [GG] branched at the amino acid K132 of the p53 protein; the post-translation modification PTM-7 has a ubiquitination site [GG] branched at the amino acid K139 of the p53 protein; the post-translation modification PTM-8 has a ubiquitination site [GG] branched at the amino acid K291 of the p53 protein; the post-translation modification PTM-9 has a ubiquitination site [GG] branched at the amino acid K357 of the p53 protein; the post-translation modification PTM-10 has phosphorylation at the amino acid S6 of the p53 protein; the post-translation modification PTM-11 has phosphorylation at the amino acid S33 of the p53 protein.

3. The in vitro or ex vivo method of claim 1, said in vitro or ex vivo method being for differentiating Alzheimer's disease, from other neurodegenerative diseases, wherein in step b) the assessment of following criteria are indicative of AD: a sequence variability in terms of length within the region of amino acids 1-271, said variability including a truncation within the same region, and the presence of all PTM-1, PTM-3, PTM-4, PTM-5, and PTM-6.

4. The in vitro or ex vivo method of claim 1, wherein the presence of all PTM-4, PTM-5, and PTM-9 is indicative of a prognosis of cognitive decline to AD of an asymptomatic subject.

5. The in vitro or ex vivo method of claim 1, wherein the presence of all PTM-1, PTM-3, PTM-5, PTM-6, and PTM-10 is indicative of MCI with a prognosis of cognitive decline to AD.

6. The in vitro or ex vivo method of claim 1, wherein said biofluid is blood, plasma, serum, saliva, urine, neuronal cells, preferably blood, in particular, plasma.

7. The in vitro or ex vivo method of claim 1, wherein in the step a), the p53 protein is captured in a biofluid sample by performing the following sub-steps of: (i) providing a biofluid sample; (ii) performing protein immunoprecipitation by an antibody that binds a p53 protein; (iii) performing protein fragmentation by trypsin; and the step b) is performed by HPLC-mass spectrometry, Peptide Mass Fingerprint and Database Search.

8. The in vitro or ex vivo method of claim 7, wherein the immunoprecipitation of sub-step (ii) is performed with a monoclonal/polyclonal antibody that binds to a p53 peptide, where preferably, said monoclonal antibody is the antibody 2D3A8.

9. The in vitro or ex vivo method of claim 7, wherein the biological sample of step a) is subjected to protein plasma depletion by HPLC or chromatographic columns or chemical treatment, before performing the step (ii).

10. The in vitro or ex vivo method of claim 1, wherein a diagnostic kit is used for implementing the method, the kit comprising a reagent set to perform the immunoprecipitation including an antibody, the digestion of the protein, elution buffer to precipitate the protein captured by the antibody, and an injection buffer.

11. The method of claim 10, wherein the protein comprises trypsin with/without Lys C.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0012] The characteristics and the advantages of the present invention will become apparent from the following detailed description and the working examples provided for illustrative purposes, as well as the annexed Figures, wherein:

[0013] FIG. 1. Protein ubiquitination sites detected in samples of subjects affected by AD.

[0014] FIG. 2. Protein ubiquitination sites detected in control samples (CU).

[0015] FIG. 3. Protein ubiquitination sites detected in the samples of subjects affected by frontal dementia (FTD).

[0016] FIG. 4. Protein ubiquitination sites detected in the samples of subjects affected by Lewy Body's dementia (LB).

[0017] FIG. 5. Protein ubiquitination sites detected in the samples of subjects affected by vascular dementia (VD).

[0018] FIG. 6. Protein ubiquitination sites detected in the samples of subjects affected by mild cognitive disorder (MCI).

[0019] FIG. 7. Protein ubiquitination sites detected in the samples of cognitively healthy subjects (CU) who developed AD over a period of at least 18 months.

[0020] FIG. 8. Protein ubiquitination sites detected in the samples of the subjects of the AD developed MCI group.

[0021] The sequences reported in the figures correspond to the linear sequence of SEQ ID N: 1.

Definitions

[0022] With the term U-p53 it is meant to denote the region of amino acids 1-371 of the p53 protein, which involves the post translational modifications (PTMs), and in some cases also a truncation, on linear protein sequence as described below.

[0023] With term p53 it is meant the wild-type protein p53 as following the Database UniProtKB, Protein ID: P04637, amino acids: 1-393.

[0024] With the term neurodegenerative disease it is meant to denote a range of conditions that mainly affect the neurons in the human brain, also comprising forms of dementia, such as Mild Cognitive Impairment (MCI), fronto-temporal dementia (FTD), Lewi's Body (LB), and vascular dementia (VD), as well as the different stages of the said neurodegenerative diseases and cognitive decline to dementia, and Alzheimer's disease (AD) (including pre-clinical and prodromal stages).

DETAILED DESCRIPTION OF THE INVENTION

[0025] The invention therefore relates to a combination of p53 post translational modifications detected by a highly accurate mass spectrometry method that can be used as biomarkers in an in vitro o ex vivo method for the diagnosis of a neurodegenerative disease. Said method is based on the identification of specific p53 modifications compared to its linear sequence, shorty referred to as PTMs, that have been detected by mass spectrometry analysis in a biofluid sample derived from patients affected by Alzheimer's disease or patients that have symptoms that can predispose to the development of AD or to different forms of dementia.

[0026] In particular, first, p53 protein is captured by immunoprecipitation in a biofluid sample from patients at pre-clinical, prodromal clinical stages of Alzheimer's, Mild Cognitive Impairment (MCI) stable patients, and cognitive unimpaired subjects (CU), Frontotemporal Dementia (FD), Vascular Dementia (VD) and Lewy Body Dementia (LB). Then, the post translational modifications of the captured protein are identified by protein sequencing with a highly sensitive selective mass spectrometry method. After sequencing, the post translational modifications are also identified by a database searching to check ones already described in literature.

[0027] The data obtained for each sample are then compared with PTMs detected in the biofluid samples from subjects with same clinical evidence showing a correlation between PTMs and diagnosis, therefore demonstrating a strong evidence that the U-p53 PTMs can be considered as highly reliable biomarkers in the prognosis and diagnosis of a neurodegenerative disease.

[0028] Said method is advantageously fast, requires a small volume of biofluid sample and reliably identifies U-p53 PTMs in each sample analysed.

[0029] Furthermore, the method and the biomarkers identified can be used also in the diagnosis and prognosis of Alzheimer's disease in asymptomatic individuals and people suffering from MCI, thus allowing the access to the diagnostics market.

[0030] Furthermore, the method and the biomarkers identified can be used also for differentiating Alzheimer's disease, from other forms of dementia, such as LB, VD, FTD in demented patients. In fact, as it will be seen below, the U-p53 protein sequence in biofluid samples of patients affected by Alzheimer's disease shows a variability in terms of length within the region of amino acids 1-271, said variability including a truncation within the same region. It should be appreciated that said variability and truncation are peculiar of Alzheimer's disease, as the same are not detected in biofluid samples of patients affected by other forms of dementia, much less in cognitive unimpaired subjects. At the same time, a residual amount of U-p53 in the biofluid samples keeps its sequence length, whereon peculiar PTMs of Alzheimer's disease are detected. It follows that patients affected by Alzheimer's disease are unequivocally identified and distinguished from other dementia patients, insofar as the former show both a truncation in the U-p53 protein sequence and peculiar PTMs in the residual amount of untruncated U-p53 protein.

[0031] In addition, since said biomarkers can be used in the prognosis of cognitive decline to Alzheimer's Dementia in asymptomatic and MCI subjects and in the diagnosis of neurodegenerative disease as the dementia, said method advantageously allows the use of a U-p53 PTMs to select the subjects in clinical trials to enable success of the trial and to differentiate patients affected by AD from other forms of dementia as LB, VD, FTD.

[0032] The present invention thus relates to an in vitro or ex vivo method for the diagnosis or prognosis of a neurodegenerative disease, the method comprising the steps of: [0033] a) analysing a biofluid sample for the presence of post-translation modifications (PTMs) in the region of amino acids 1-371 of the p53 protein (U-p53), said PTMs being: [0034] PTM-1 at the amino acid M1, [0035] PTM-2 at the amino acid K164, [0036] PTM-3 at the amino acid K370, [0037] PTM-4 at the amino acid L101, [0038] PTM-5 at the amino acid K120, [0039] PTM-6 at the amino acid K132, [0040] PTM-7 at the amino acid K139, [0041] PTM-8 at the amino acid K291, [0042] PTM-9 at the amino acid K357, [0043] PTM-10 at the amino acid S6, [0044] PTM-11 at the amino acid S33,
wherein the presence of at least two PTMs selected from PTM-2, PTM-7, PTM-8, and PTM-11 is indicative of a cognitive unimpaired subject (CU), [0045] b) assessing the presence of: [0046] at least two PTMs selected from PTM-1, PTM-3, PTM-4, PTM-5, PTM-6, PTM-9, and PTM-10, and [0047] at least one PTM selected from PTM-2, PTM-7, PTM-8, and PTM-11,
as indicative of the occurrence or the risk of development of a neurological disease, said neurodegenerative disease being selected from Mild Cognitive Impairment (MCI), Alzheimer's disease (AD), Fronto-temporal dementia (FTD), Lewi's Body (LB), and vascular dementia (VD), [0048] c) correlating the PTMs assessed in step b) with those identifying the corresponding neurodegenerative disease.

[0049] According to the present invention, preferably in the in vitro or ex vivo method: [0050] the post-translation modification PTM-1 has a group COCH.sub.3 branched to the amino acid M1 of the p53 protein; [0051] the post-translation modification PTM-2 has a group COCH.sub.3 branched to the amino acid K164 of the p53 protein; [0052] the post-translation modification PTM-3 has a group COCH.sub.3 branched to the amino acid K370 of the p53 protein; [0053] the post-translation modification PTM-4 has a ubiquitination site [GG] branched at the amino acid K101 of the p53 protein; [0054] the post-translation modification PTM-5 has a ubiquitination site [GG] branched at the amino acid K120 of the p53 protein, where [GG] denotes a lateral chain of two residues of Glycine; [0055] the post-translation modification PTM-6 has a ubiquitination site [GG] branched at the amino acid K132 of the p53 protein; [0056] the post-translation modification PTM-7 has a ubiquitination site [GG] branched at the amino acid K139 of the p53 protein; [0057] the post-translation modification PTM-8 has a ubiquitination site [GG] branched at the amino acid K291 of the p53 protein; [0058] the post-translation modification PTM-9 has a ubiquitination site [GG] branched at the amino acid K357 of the p53 protein; [0059] the post-translation modification PTM-10 has phosphorylation at the amino acid S6 of the p53 protein; [0060] the post-translation modification PTM-11 has phosphorylation at the amino acid S33 of the p53 protein.

[0061] In a preferred embodiment, the in vitro or ex vivo method of the present invention is for differentiating Alzheimer's disease, from other forms of dementia, such as LB, VD, FTD in demented patients. In fact, as said above, the assessment of following criteria are indicative of AD: [0062] a sequence variability in terms of length within the region of amino acids 1-271, said variability including a truncation within the same region, and [0063] the presence of at least two PTMs selected from PTM-1, PTM-3, PTM-4, PTM-5, and PTM-6, in a residual amount of untruncated sequence, preferably the presence of all PTM-1, PTM-3, PTM-4, PTM-5, and PTM-6.

[0064] Said truncation, mainly due to biological reactions, does not affect the detectability of PTMs in said residual amount of untruncated sequence.

[0065] As said above, it should be appreciated that said variability and truncation are peculiar of Alzheimer's disease, as the same are not detected in biofluid samples of patients affected by other forms of dementia. At the same time, a residual amount of U-p53 in the biofluid samples keeps its sequence length, whereon peculiar PTMs of Alzheimer's disease are detected. It follows that patients affected by Alzheimer's disease are unequivocally identified and distinguished from other dementia patients, insofar as the former show both a truncation in the U-p53 protein sequence and peculiar PTMs in the residual amount of untruncated U-p53 protein.

[0066] Preferably, in the in vitro or ex vivo method of the present invention, the presence of all PTM-2, PTM-7, PTM-8, and PTM-11 is indicative of a cognitive unimpaired subject (CU).

[0067] Preferably, in the in vitro or ex vivo method of the present invention the presence of PTM-1, and PTM-10 is indicative of MCI.

[0068] Preferably, in the in vitro or ex vivo method of the present invention the presence of at least two PTMs selected from PTM-4, PTM-5, and PTM-9 is indicative of an asymptomatic subject having the prognosis of cognitive decline of Alzheimer's dementia (AD), more preferably the presence of all PTM-4, PTM-5, and PTM-9. In this regard, it should be appreciated that the method of the invention allows the cognitive unimpaired subject (CU) to be identified and distinguished from the asymptomatic subject having the prognosis of cognitive decline of Alzheimer's dementia, although both subjects are formally asymptomatic and accordingly not distinguishable from each other through conventional cognitive tests.

[0069] Preferably, in the in vitro or ex vivo method of the present invention the presence of at least two PTMs selected from PTM-1, PTM-3, PTM-5, PTM-6, and PTM-10 is indicative of MCI with a prognosis of cognitive decline of AD, more preferably the presence of all PTM-1, PTM-3, PTM-5, PTM-6, and PTM-10.

[0070] Preferably, in the in vitro or ex vivo method of the present invention the presence of PTM-5, and PTM-9 is indicative of FTD.

[0071] Preferably, in vitro or ex vivo method of the present invention the presence of PTM-5, and PTM-6 is indicative of LB.

[0072] Preferably, in the in vitro or ex vivo method of the present invention the presence of PTM-4, and PTM-5 is indicative of VD.

[0073] Preferably, said biofluid is blood, plasma, serum, saliva, urine, neuronal cells, blood cells or other types of cells.

[0074] According to a preferred embodiment, in the step a) of the in vitro or ex vivo method of the present invention, the p53 protein is captured in a biofluid sample by performing the following sub-steps of: [0075] (i) providing a biofluid sample; [0076] (ii) performing protein immunoprecipitation by an antibody that binds a p53 protein; [0077] (iii) performing protein fragmentation by trypsin;
and the step b) is performed by HPLC-mass spectrometry, Peptide Mass Fingerprint and Database Search.

[0078] In a preferred embodiment, the p53 protein in step a) is the U-p53 in a misfolded conformation.

[0079] Preferably, the antibody of sub-step (ii) is a conformationally specific antibody that binds to a p53 peptide, more preferably is a monoclonal/polyclonal antibody. In preferred embodiments, said monoclonal antibody is the antibody 2D3A8.

[0080] The amino acid sequences of the 2D3A8 antibody include the heavy chain (SEQ ID NO: 7) and light chain (SEQ ID NO: 8), heavy chain variable region (SEQ ID NO: 9) and light chain variable region (SEQ ID NO: 10), heavy chain CDRs 1, 2 and 3 (SEQ ID NOs: 11, 12 and 13, respectively) and light chain CDRs 1, 2 and 3 (SEQ ID NOs: 14, 15 and 16, respectively).

[0081] Preferably, the biological sample of step a) is subjected to protein plasma depletion by HPLC or chromatographic columns or chemical treatment, before performing step (ii). In a preferred embodiment, in the step c) of the method of the present invention, the detected PTMs are correlated with the diagnosis/prognosis of Alzheimer's disease in a patient at different stages of the diseases or cognitive decline due to dementia.

[0082] Preferably, in the step c) the detected PTMs are correlated with the prognosis of cognitive decline of Alzheimer's disease in asymptomatic individuals and subjects suffering from MCI.

[0083] In a further aspect, the present invention also relates to a diagnostic kit to be used for the implementation of the in vitro or ex vivo method above described, the kit comprising the reagent set to perform the immunoprecipitation including an antibody, the digestion of the protein (preferably trypsin with/without Lys C), elution buffer to precipitate the protein captured by the antibody, and an injection buffer.

[0084] In further aspects, the present invention also relates to a method for detecting neurodegenerative disease or development of neurodegenerative disease in a subject by identifying the type of post-translational modifications (PTMs) in the region of amino acids 1-371 of the p53 protein (U-p53) present in a sample from said subject, the method comprising the steps of: [0085] a. subjecting said sample to immunoprecipitation with an antibody that binds to an amino acid sequence defined by amino acids 282-297 of U-p53; [0086] b. subjecting said immunoprecipitated sample of step (a) to protease digestion; [0087] c. detecting the presence of post-translation modifications (PTMs) in the region of amino acids 1-371 of the p53 protein (U-p53) in said digested sample of step (b) and classifying the PTM as PTM-1, PTM-2, PTM-3, PTM-4, PTM-5, PTM-6, PTM-7, PTM-8, PTM-9, PTM-10 and PTM-11, [0088] wherein said PTM-1 is at the amino acid M1 of said U-p53, said PTM-2 is at the amino acid K164 of said U-p53, said PTM-3 is at the amino acid K370 of said U-p53, said PTM-4 is at the amino acid L101 of said U-p53, said PTM-5 is at the amino acid K120 of said U-p53, said PTM-6 is at the amino acid K132 of said U-p53, said PTM-7 is at the amino acid K139 of said U-p53, said PTM-8 is at the amino acid K291 of said U-p53, said PTM-9 is at the amino acid K357 of said U-p53, said PTM-10 is at the amino acid S6 of said U-p53, and said PTM-11 is at the amino acid S33 of said U-p53, [0089] wherein the presence of at least two PTMs selected from PTM-1, PTM-3, PTM-4, PTM-5, PTM-6, PTM-9, and PTM-10, and the presence of at least one PTM selected from PTM-2, PTM-7, PTM-8, and PTM-11 is indicative of neurogenerative disease or development of neurodegenerative disease, [0090] wherein said neurodegenerative disease is Alzheimer's disease, cognitive decline to Alzheimer's disease (AD), Mild cognitive impairment (MCI), Mild cognitive impairment (MCI) with a prognosis of cognitive decline to AD, Frontotemporal dementia (FTD), and/or Lewy Body's Dementia (LB), and vascular dementia (VD).

[0091] According to the present invention, preferably in said method said PTM-1 has a group COCH3 branched to the amino acid M1 of the p53 protein; said PTM-2 has a group COCH3 branched to the amino acid K164 of the p53 protein; said PTM-3 has a group COCH3 branched to the amino acid K370 of the p53 protein; said PTM-4 has a ubiquitination site [GG] branched at the amino acid K101 of the p53 protein; said PTM-5 has a ubiquitination site [GG] branched 10 at the amino acid K120 of the p53 protein; said PTM-6 has a ubiquitination site [GG] branched at the amino acid K132 of the p53 protein; said PTM-7 has a ubiquitination site [GG] branched at the amino acid K139 of the p53 protein; said PTM-8 has a ubiquitination site [GG] branched at the amino acid K291 of the p53 protein; said PTM-9 has a ubiquitination site [GG] branched at the amino acid K357 of the p53 protein; said PTM-10 has phosphorylation at the amino acid S6 of the p53 protein; and said PTM-11 has phosphorylation at the amino acid S33 of the p53 protein.

[0092] Preferably in said method, said at least two PTMs detected in step (c) are selected from the group consisting of PTM-1, PTM-3, PTM-4, PTM-5, and PTM-6, said detection being indicative of Alzheimer's disease (AD) or prognosis of AD.

[0093] Preferably in said method, said at least two PTMs detected in step (c) are selected from the group consisting of PTM-1, and PTM-10, said detection being indicative of MCI. Preferably in said method, said sample is from a subject who exhibits no symptoms of AD, wherein said at least two PTMs detected in step (c) are selected from the group consisting of PTM-4, PTM-5, and PTM-9, said detection being indicative of a prognosis of cognitive decline to AD.

[0094] Preferably in said method, said at least two PTMs detected in step (c) are selected from the group consisting of PTM-1, PTM-3, PTM-5, PTM-6, and PTM-10, said detection being indicative of MCI with a prognosis of cognitive decline to AD.

[0095] Preferably in said method, said at least two PTMs detected in step (c) are selected from the group consisting of PTM-5, and PTM-9, said detection being indicative of FTD.

[0096] Preferably in said method, said at least two PTMs detected in step (c) are selected from the group consisting of PTM-5, and PTM-6, said detection being indicative of LB.

[0097] Preferably in said method, said at least two PTMs detected in step (c) are selected from the group consisting of PTM-4, and PTM-5, said detection being indicative of VD.

[0098] Preferably in said method, said sample is selected from the group consisting of blood, plasma, serum, saliva, urine, neuronal cells.

[0099] Preferably in said method, said protease is trypsin.

[0100] Preferably in said method, said detection of step (c) is performed by one or more of HPLC-mass spectrometry, Peptide Mass Fingerprint and Database search.

[0101] Preferably in said method, said antibody is a monoclonal antibody, more preferably it is 2D3A8.

[0102] Preferably in said method, said sample is subjected to protein plasma depletion by HPLC or chromatographic columns or chemical treatment, prior to performing steps (a) to (c). In further aspects, the present invention also relates to a kit for detecting neurodegenerative disease or development of neurodegenerative disease in a subject, the kit comprising a reagent set to perform immunoprecipitation, said reagent set comprising an anti-human p53 antibody capable of binding to an amino acid sequence defined by amino acids 282-297 of U-p53, preferably wherein said anti-human p53 antibody being a monoclonal antibody, more preferably said monoclonal antibody being 2D3A8.

[0103] It should be also understood that all the combinations of preferred aspects of the peptides of the invention, as well as of the preparation processes, kit and methods using of the same, as above reported, are to be deemed as hereby disclosed.

[0104] All combinations of the preferred aspects of the PTMs of the invention, preparation processes, kit and methods disclosed above are to be understood as herein described. Below are working examples of the present invention provided for illustrative purposes.

Materials and Methods

Isolation and Identification of the U-p53 Protein Sequences and of its Post-Translational Modifications

[0105] The analysis relates to the identification of the U-p53 protein sequence and of its post translational modifications when extracted from plasma of cognitive unimpaired subjects (CU), of patients affected by AD, of other forms of dementia (FTD, LB and VD) and from individuals with Mild Cognitive Decline (MCI), from MCI patients with a prognosis of cognitive decline of AD (MCI to AD) and from patients with a prognosis of cognitive decline of an asymptomatic AD (CU to AD).

Sample Preparation

1. Buffers

[0106] Buffer A: Tris 25 mM, Sodium Chloride (NaCl) 0.15 mM, Tween-20 50 mM; Preparation: Tris (303 mg), Sodium Chloride (NaCl; 885 mg) and Tween-20 (5.5 g) are collected. Bidistilled water is added so to reach 100 mL final volume. Note: The solution must be fresh prepared for each analytical section. [0107] Buffer B: Glycine 0.1 M pH 2.0. Preparation: Glycine (750 mg) Glycine is treated with bidistilled water. 100 mL solution was obtained. HCl 0.1 M is added to obtain pH 3 value. Note: The solution must be fresh prepared for each analytical section. [0108] Ammonium bicarbonate (NH4HCO3) 0.4 g are solubilized in 100 mL of Bidistilled Water. Note: solution pH should be checked before to proceed with the analysis. pH must be lower than 8 to obtain a reproducible digestion.

2. Reagent Preparation

[0109] Dithiothreitol (DTT) 180 mM in 50 mM AmBic. Procedure: DTT 0.3 g are solubilized in 0.5 mL of bidistilled water. 10 mL of 50 mM ammonium bicarbonate (NH4HCO3) are added. Solubilize the mixture by using vortex. Note: The solution must be fresh prepared for each analytical section. [0110] Iodoacetamide (IAA) 400 mM in 50 mM AmBic. Procedure: Iodoacetamide (IAA) 0.7 g are solubilized in 10 mL of 50 mM ammonium bicarbonate (NH4HCO3) solution. Solubilize the mixture by using vortex. Note: The solution must be fresh prepared for each analytical section. [0111] 25 ng/?L Trypsin solution. Procedure: 20 ?g of trypsin are solubilized 800 ?L of 50 mM NH4HCO3. Solubilize the mixture by using vortex. Note: The solution must be fresh prepared for each analytical section.

3. Bead-Antibody Binding

[0112] Protein magnetic bead L 50 ?L (0.5 mg) are collected in a Vial; [0113] 150 ?L Buffer A are added. Vortex is applied; [0114] Magnetic surface is used to discard the surnatant. [0115] Buffer A 1 mL is added. Vortex is applied for 1 minute; [0116] Magnetic surface is used to discard the surnatant; [0117] Antibody solution (200 ?L, 0.05 ?g/?L corresponding to 10 ?g) is added to ProteinL magnetic bead; [0118] The solution is mixed for 2 hours; [0119] Magnetic surface is used to discard the surnatant; [0120] Buffer A 500 ?L is added; [0121] Magnetic surface is used to discard the surnatant; [0122] Wash and discard the surnatant again; [0123] Buffer A 1 mL is added. [0124] The solution is stored at room temperature.

4. Plasma Chemical Contaminants Depletion and Immune Precipitation

[0125] Samples extracted from the different categories of patients are thawed at room temperature under laminar flow cabinet for 30 min. [0126] The sample is spiked in 25 ?L aliquots. They are separately processed. [0127] The remaining material is stored at ?20? C. for retesting purpose. [0128] 5 ?L of CH3CN are added to 25 ?L of plasma. [0129] The acetonitrile spike is repeated every 1 minute since to reach a mixture volume of 50 ?L. Apply vortex for 5 minutes until when white deposit is observed. [0130] The sample centrifugation takes place at 13000 g for 10 minutes. 40 ?L of surnatant is added to the bead-antibody complex. Vortex is weakly applied. [0131] The mixture is incubated at room temperature for 1 hour and then at 4? overnight. [0132] A magnetic surface is used to remove the surnatant. [0133] Buffer A 500 ?L are added and the mixture was vortexed. [0134] A magnetic plane is used to remove the surnatant. [0135] Buffer B 45 ?L are added to the pellet. After mixing, to incubate for 10 minutes at room temperature. [0136] A magnetic surface is used to collect the eluate (40 ?L) that is is enzymatically digested.

5. Enzymatic Digestion of the Immunocaptured p53 Protein

[0137] 2,15 ?l of Dithiothreitol (DTT) 180 mM are added to 40 ?L of the eluate. [0138] The mixture is incubated for 15 min at 50? C. and at room temperature for 30 minutes; [0139] 2,15 ?l of Iodoacetamide (IAA) 400 mM are added 42.15 ?L of the mixture. [0140] The obtained mixture is incubated for 15 minutes at room temperature. [0141] 2,15 ?L of AmBic 50 mM are added 44.30 ?L of the obtained mixture. [0142] 1 ?L of trypsin (25 ng/?L) containing Lys-c (50 ng/?L) and AmBic 50 mM is added to 46.45 ?L of the obtained mixture. [0143] Incubation takes place at 37? C. for 3.5 hours followed by 57? C. for 30 minutes. [0144] 1 ?L of Formic Acid (HCOOH) is added to 47.45 ?L of the obtained mixture to stop the enzymatic digestion. pH value is checked and it has to be in the range 1-4. If it is higher than 4 progressive volume (1 ?L) of Formic Acid is added to obtain a pH value between 1 and 4. 10 ?L of the obtained sample are analysed.

6. Detection of PTMs by LC-SACI-MS

[0145] HPLC Ultimate 3000 (Thermofisher, USA) with a Phenomenex Kinetex PFP 50?4.1 mm 2.6 ?m are used to perform the chromatographic analysis. Binary gradient is used: Phase A (H.sub.2O+0.2% Formic Acid (HCOOH)) and Phase C acetonitrile (CH.sub.3CN). The gradient is reported in the table below. 10 ?L of sample are injected. [0146] LTQ Orbitrap XL is used for the data acquisition. SACI ionization source is employed. The potential surface is 47 V, Gas nebulizer pressure is 75 Psi and dry gas flow is 1.0 L/min. 350? C. of nebulizer temperature was employed together with 320? C. of dry gas one. SACI peptide adduct profile mode is employed for data acquisition (Cristoni et al. Rapid Commun Mass Spectrom. 2003; 17(17):1973-81.).

TABLE-US-00001 TABLE 1 Chromatographic gradient. Gradient Time (minute) % C Flow (mL/min) 0 2% 0.250 2.5 2% 0.250 3 80% 0.250 7 80% 0.250 8 2% 0.250

7. Data Extraction and Protein Characterization

[0147] Protein sequence and PTM data is obtained using the SANIST-prot tool operating in bottom up conditions.

Correlation Between p53 Sequence Peptide and AD Diagnosis.

[0148] The plasma samples of 7 patients affected by AD, 5 cognitive unimpaired (CU), 2 patients affected by MCI, 6 frontal dementia (FD), 1 patient with vascular dementia (VD) and 1 patient with Lewy Body dementia (LB) and 6 patients with MCI to AD and 6 patients CU to AD have been treated with the experimental protocol based on protein L to isolate protein p53 disclosed above. Said protein has been exposed to double enzymatic digestion (Lys-C+trypsin) in order to maximize the peptide recovery.

TABLE-US-00002 Sample ID* N Diagnosis 1-AD; 2-AD; 3-AD; 4-AD; 5-AD; 4-S; 7-S 7 AD 1-C; 2-C; 3-C; 4-C; 5-C 5 CU 9D-MCI; 10D-MCI 2 MCI 1-S; 2-S; 5-S; 8-S; 10-S; 13-S 6 CU to AD 3-S; 6-S; 9-S; 11-S; 12-S; 14-S 6 MCI to AD 1D-FD; 2D-FD; 3D-FD; 4D-FD; 5D-FD; 6D-FD 6 FTD 8D-FD V 1 VD 7D-FD 1 LB *Sample ID is a mere code exclusively used to label the samples and, as such, have no correlation to the subsequent diagnosis of corresponding patients

Results Obtained

[0149] 1. U-p53 Protein Immunocaptured from Subjects AD

[0150] The p53 protein extracted from AD individuals results truncated in the region of amino acid 1-248 with respect to the wt p53 protein (SEQ ID NO: 1) Database: UniProtKB, Protein ID: P04637, amino acids: 1-393). Different mistakes of enzymatic digestion have been reported that lead to the presence of variable regions, inter-subjects, between the residuals 249-371 of the truncated protein.

[0151] In Table 2 are reported the p53 linear sequences identified in AD patients and the respective molecular weight (MW).

TABLE-US-00003 TABLE2 SampleID Sequence SEQID MW(Da) 1-AD EVRVCACPGRDRRTEEENLR SEQID 11425 KKGEPHHELPPGSTKRALPN NO:2 NTSSSPQPKKKPLDGEYFTL QIRGRERFEMFRELNEALEL KDAQAGKEPGGSRAHSSHLKS 2-AD RPILTIITLEDSSGNLLGRN SEQID 13823 SFEVRVCACPGRDRRTEEEN NO:3 LRKKGEPHHELPPGSTKRAL PNNTSSSPQPKKKPLDGEYF TLQIRGRERFEMFRELNEAL ELKDAQAGKEPGGSRAHSSH LKS 3-AD SGNLLGRNSFEVRVCACPGR SEQID 12471 DRRTEEENLRKKGEPHHELP NO:4 PGSTKRALPNNTSSSPQPKK KPLDGEYFTLQIRGRERFEM FRELNEALELKDAQAGKEPG GSRAHSSHLKS 4-AD TLEDSSGNLLGRNSFEVRVC SEQID 13016 ACPGRDRRTEEENLRKKGEP NO:5 HHELPPGSTKRALPNNTSSS PQPKKKPLDGEYFTLQIRGR ERFEMFRELNEALELKDAQA GKEPGGSRAHSSHLKS 5-AD EVRVCACPGRDRRTEEENLR SEQID 11425 KKGEPHHELPPGSTKRALPN NO:2 NTSSSPQPKKKPLDGEYFTL QIRGRERFEMFRELNEALEL KDAQAGKEPGGSRAHSSHLKS 4-S EVRVCACPGRDRRTEEENLR SEQID 11425 KKGEPHHELPPGSTKRALPN NO:2 NTSSSPQPKKKPLDGEYFTL QIRGRERFEMFRELNEALEL KDAQAGKEPGGSRAHSSHLKS 7-S RPILTIITLEDSSGNLLGRN SEQID 13823 SFEVRVCACPGRDRRTEEEN NO:3 LRKKGEPHHELPPGSTKRAL PNNTSSSPQPKKKPLDGEYF TLQIRGRERFEMFRELNEAL ELKDAQAGKEPGGSRAHSSH LKS MW-average 12432
2. U-p53 Immunocaptured from Cognitive Unimpaired (CU) and Cognitive Unimpaired to AD Patients.

[0152] The linear sequence of p53 extracted from 5 Cognitive unimpaired patients and 6 Cognitive unimpaired later declined to AD correspond to the entire sequence with 1-371 amino acids (SEQ ID N. 6), with a molecular weight of 41134 Da. No residuals corresponding to the region 372-391 have been identified. Table 3 reports the linear sequences obtained from the Cognitive unimpaired and Cognitive unimpaired to AD patients.

TABLE-US-00004 TABLE3 SampleID Sequence SEQID MW(Da) 1-C; MEEPQSDPSVEPPLSQETFSDLWKLLPENNVL SEQID 41139 2-C; SPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP NO:6 3-C; RMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSS 4-C; VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSP 5-C; ALNKMFCQLAKTCPVQLWVDSTPPPGTRVRA 1-S; MAIYKQSQHMTEVVRRCPHHERCSDSDGLAP 2-S; PQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEP 5-S; PEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI 8-S; ITLEDSSGNLLGRNSFEVRVCACPGRDRRTEE 10-S; ENLRKKGEPHHELPPGSTKRALPNNTSSSPQP 13-S KKKPLDGEYFTLQIRGRERFEMFRELNEALEL KDAQAGKEPGGSRAHSSHLKS MW-average 41139
3. U-p53 Protein Immunocaptured from Subjects Affected by Fronto-Temporal Dementia, Lewy Body's Dementia, Vascular Dementia, Mild Cognitive Decline (MCI) and MCI to AD

[0153] The results obtained from 16 subjects (6 with frontotemporal dementia, 1 with vascular dementia, 1 with Lewy Body's dementia, 2 MCI subjects and 6 MCI who developed AD) report the presence of the whole protein of 1-371 residuals. Table 4 reports the linear protein sequences of the tested subjects.

TABLE-US-00005 TABLE4 SampleID Sequence SEQID MW(Da) 1D-FD; MEEPQSDPSVEPPLSQETFSDLWKLLPEN SEQID 41139 2D-FD; NVLSPLPSQAMDDLMLSPDDIEQWFTED NO:6 3D-FD; PGPDEAPRMPEAAPPVAPAPAAPTPAAPA 4D-FD; PAPSWPLSSSVPSQKTYQGSYGFRLGFLH 5D-FD; SGTAKSVTCTYSPALNKMFCQLAKTCPV 6D-FD; QLWVDSTPPPGTRVRAMAIYKQSQHMTE 7D-FD; VVRRCPHHERCSDSDGLAPPQHLIRVEGN 8D-FDV; LRVEYLDDRNTFRHSVVVPYEPPEVGSD 9D-MCI; CTTIHYNYMCNSSCMGGMNRRPILTIITL 10D-MCI; EDSSGNLLGRNSFEVRVCACPGRDRRTEE 3-S; ENLRKKGEPHHELPPGSTKRALPNNTSSS 6-S; PQPKKKPLDGEYFTLQIRGRERFEMFREL 9.S; NEALELKDAQAGKEPGGSRAHSSHLKS 11-S 12-S 14-S MW-average 41139
4. Description of the PTMs Observed from the Immunocaptured Protein

[0154] The extracted and sequenced p53 protein from the different clinical groups in addition to a different linear sequence, corresponding accordingly to different molecular weight, also showed post-transductional modifications (PTMs), mainly characterized by ubiquitination, acetylation and phosphorylation on specific amino acid residues. The samples belonging to the same clinical group also showed a highly homogeneity in the PTMs, which in combination with the same protein sequence represent an element characterizing the clinical group to which they belong.

[0155] In FIGS. 1-8 the ubiquitination sites observed are reported.

4.1. AD Subjects

[0156] Under-expressed peptide sequences belonging to the amino acid region 1-248 were detected in AD patients. Given their low abundance, they could derive from whole sequence of p53 proteins that are believed to be weakly interacting with the antibody. The protein sequence has several ubiquitination sites indicated with the notation * in FIG. 1.

4.2. Cognitive Unimpaired (CU) Subjects

[0157] The Ubiquitination Sites Detected in Cognitive Unimpaired Samples are Reported in FIG. 2.

4.3. Subjects Affected by Fronto-Temporal Dementia (FTD)

[0158] The ubiquitination sites detected in FTD samples are reported in FIG. 3.

4.4. Subjects Affected by Lewy Body's Dementia (LB)

[0159] The ubiquitination sites detected in LB samples are reported in FIG. 4.

4.5. Subjects Affected by Vascular Dementia (VD)

[0160] The ubiquitination sites detected in VD samples are reported in FIG. 5.

4.6. Subjects Affected by MCI

[0161] The ubiquitination sites detected in MCI samples are reported in FIG. 6.

4.7. Samples of Cognitive Unimpaired Subjects (CU) Who Developed AD

[0162] The protein ubiquitination sites detected in the samples of cognitively healthy subjects who developed AD over a period of 18-72 months are shown in FIG. 7.

4.8. Samples of MCI Subjects Who Developed AD

[0163] The ubiquitination sites detected in MCI subjects who developed AD are reported in FIG. 8.

[0164] From the data obtained we can observe that there were cumulatively 11 PTMs spanning the full sequence of the protein. Peptides spanning the protein up 371 residues were detected in all samples, however the peptides belonging to the region 1-248 residues AD patients seemed to be cut from the protein not as consequence of enzymatic digestion due to the analytical protocol but due to biological process of full p-53 protein. Amino acids in the region from 372 to the end of the p-53 protein was missing in all samples belonging to different clinical groups.

[0165] The PTMs observed in the different patients are disclosed in Table 5 (Y=detected; N=not detected)

TABLE-US-00006 TABLE 5 AC-M1 AC-K164 AC-K370 U- K101 U-K120 U-K132 U-K139 U-K291 U-K357 Phospho-S6 Phospho-S33 Truncation CU N Y N N N N Y Y N N Y N MCI Y N N N N N Y Y N Y Y N CU to AD N N N Y Y N N Y Y N N N MCI to AD Y N Y N Y Y Y Y N Y Y N AD Y Y Y Y Y Y N Y N N Y Y FTD N N N N Y N N Y Y N N N LB N Y N Y Y Y N Y N N N N VD N N N Y Y N N Y N N N N

REFERENCES

[0166] 1. Stanga, S. et al., 2010. Unfolded p53 in the pathogenesis of Alzheimer's disease: Is HIPK2 the link? Aging, 2(9), pp. 545-554. [0167] 2. Lanni, C. et al., 2007. Unfolded p53: A potential biomarker for Alzheimer's disease.

[0168] In Journal of Alzheimer's Disease. pp. 93-99. [0169] 3. Uberti, D. et al., 2008. Conformationally altered p53: a putative peripheral marker for Alzheimer's disease. Neuro-degenerative diseases, 5(3-4), pp. 209-11. [0170] 4. Lanni, C. et al., 2008. Conformationally altered p53: a novel Alzheimer's disease marker? Molecular psychiatry, 13(6), pp. 641-7. [0171] 5. Lanni, C., Racchi, M., et al., 2010. Unfolded p53 in blood as a predictive signature signature of the transition from mild cognitive impairment to Alzheimer's disease. Journal of Alzheimer's disease: JAD, 20(1), pp. 97-104. [0172] 6. Buizza, L. et al., 2012. Conformational altered p53 as an early marker of oxidative stress in Alzheimer's disease. PloS one, 7(1), p.e29789 [0173] 7. Arce-Varas N, et al. Comparison of extracellular and intracellular blood compartments highlights redox alterations in Alzheimer's and Mild Cognitive Impairment patients. Current Alzheimer Research 2017; 14(1): 112-122. [0174] 8. Uberti, D. et al., 2006. Identification of a mutant-like conformation of p53 in fibroblasts from sporadic Alzheimer's disease patients. Neurobiology of aging, 27(9), pp. 1193-201. [0175] 9. Lanni, C., Nardinocchi, L., et al., 2010. Homeodomain interacting protein kinase 2: a target for Alzheimer's beta amyloid leading to misfolded p53 and inappropriate cell survival. PloS one, 5(4), p.e10171. [0176] 10. Lanni, C. et al., 2008. Pharmacogenetics and Pharmagenomics, Trends in Normal and Pathological Aging Studies: Focus on p53. Current Pharmaceutical Design, 14(26), pp. 2665-2671. [0177] 11. Peptide Mass Fingerprint (PMF; Cristoni S. et al Expert Rev Proteomics. 2004 December; 1(4):469-83)

TABLE-US-00007 SEQUENCELISTING SEQIDNO:1 MetGluGluProGlnSerAspProSerValGluProProLeuSerGln 151015 GluThrPheSerAspLeuTrpLysLeuLeuProGluAsnAsnValLeu 202530 SerProLeuProSerGlnAlaMetAspAspLeuMetLeuSerProAsp 354045 AspIleGluGlnTrpPheThrGluAspProGlyProAspGluAlaPro 505560 ArgMetProGluAlaAlaProProValAlaProAlaProAlaAlaPro 65707580 ThrProAlaAlaProAlaProAlaProSerTrpProLeuSerSerSer 859095 ValProSerGlnLysThrTyrGlnGlySerTyrGlyPheArgLeuGly 100105110 PheLeuHisSerGlyThrAlaLysSerValThrCysThrTyrSerPro 115120125 AlaLeuAsnLysMetPheCysGlnLeuAlaLysThrCysProValGln 130135140 LeuTrpValAspSerThrProProProGlyThrArgValArgAlaAla 145150155160 IleTyrLysGlnSerGlnHisMetThrGluValValArgArgCysPro 165170175 HisHisGluArgCysSerAspSerAspGlyLeuAlaProProGlnHis 180185190 LeuIleArgValGluGlyAsnLeuArgValGluTyrLeuAspAspArg 195200205 AsnThrPheArgHisSerValValValProTyrGluProProGluVal 210215220 GlySerAspCysThrThrIleHisTyrAsnTyrMetCysAsnSerSer 225230235240 CysMetGlyGlyMetAsnArgArgProIleLeuThrIleIleThrLeu 245250255 GluAspSerSerGlyAsnLeuLeuGlyArgAsnSerPheGluValArg 260265270 ValCysAlaCysProGlyArgAspArgArgThrGluGluGluAsnLeu 275280285 ArgLysLysGlyGluProHisHisGluLeuProProGlySerThrLys 290295300 ArgAlaLeuProAsnAsnThrSerSerSerProGlnProLysLysLys 305310315320 ProLeuAspGlyGluTyrPheThrLeuGlnIleArgGlyArgGluArg 325330335 PheGluMetPheArgGluLeuAsnGluAlaLeuGluLeuLysAspAla 340345350 GlnAlaGlyLysGluProGlyGlySerArgAlaHisSerSerHisLeu 355360365 LysSerLysLysGlyGlnSerThrSerArgHisLysLysLeuMetPhe 370375380 LysThrGluGlyProAspSerAsp 385390 SEQIDNO:2 GluValArgValCysAlaCysProGlyArgAspArgArgThrGluGlu 151015 GluAsnLeuArgLysLysGlyGluProHisHisGluLeuProProGly 202530 SerThrLysArgAlaLeuProAsnAsnThrSerSerSerProGlnPro 354045 LysLysLysProLeuAspGlyGluTyrPheThrLeuGlnIleArgGly 505560 ArgGluArgPheGluMetPheArgGluLeuAsnGluAlaLeuGluLeu 65707580 LysAspAlaGlnAlaGlyLysGluProGlyGlySerArgAlaHisSer 859095 SerHisLeuLysSer 100 SEQIDNO:3 ArgProIleLeuThrIleIleThrLeuGluAspSerSerGlyAsnLeu 151015 LeuGlyArgAsnSerPheGluValArgValCysAlaCysProGlyArg 202530 AspArgArgThrGluGluGluAsnLeuArgLysLysGlyGluProHis 354045 HisGluLeuProProGlySerThrLysArgAlaLeuProAsnAsnThr 505560 SerSerSerProGlnProLysLysLysProLeuAspGlyGluTyrPhe 65707580 ThrLeuGlnIleArgGlyArgGluArgPheGluMetPheArgGluLeu 859095 AsnGluAlaLeuGluLeuLysAspAlaGlnAlaGlyLysGluProGly 100105110 GlySerArgAlaHisSerSerHisLeuLysSer 115120 SEQIDNO:4 SerGlyAsnLeuLeuGlyArgAsnSerPheGluValArgValCysAla 151015 CysProGlyArgAspArgArgThrGluGluGluAsnLeuArgLysLys 202530 GlyGluProHisHisGluLeuProProGlySerThrLysArgAlaLeu 354045 ProAsnAsnThrSerSerSerProGlnProLysLysLysProLeuAsp 505560 GlyGluTyrPheThrLeuGlnIleArgGlyArgGluArgPheGluMet 65707580 PheArgGluLeuAsnGluAlaLeuGluLeuLysAspAlaGlnAlaGly 859095 LysGluProGlyGlySerArgAlaHisSerSerHisLeuLysSer 100105110 SEQIDNO:5 ThrLeuGluAspSerSerGlyAsnLeuLeuGlyArgAsnSerPheGlu 151015 ValArgValCysAlaCysProGlyArgAspArgArgThrGluGluGlu 202530 AsnLeuArgLysLysGlyGluProHisHisGluLeuProProGlySer 354045 ThrLysArgAlaLeuProAsnAsnThrSerSerSerProGlnProLys 505560 LysLysProLeuAspGlyGluTyrPheThrLeuGlnIleArgGlyArg 65707580 GluArgPheGluMetPheArgGluLeuAsnGluAlaLeuGluLeuLys 859095 AspAlaGlnAlaGlyLysGluProGlyGlySerArgAlaHisSerSer 100105110 HisLeuLysSer 115 SEQIDNO:6 MetGluGluProGlnSerAspProSerValGluProProLeuSerGln 151015 GluThrPheSerAspLeuTrpLysLeuLeuProGluAsnAsnValLeu 202530 SerProLeuProSerGlnAlaMetAspAspLeuMetLeuSerProAsp 354045 AspIleGluGlnTrpPheThrGluAspProGlyProAspGluAlaPro 505560 ArgMetProGluAlaAlaProProValAlaProAlaProAlaAlaPro 65707580 ThrProAlaAlaProAlaProAlaProSerTrpProLeuSerSerSer 859095 ValProSerGlnLysThrTyrGlnGlySerTyrGlyPheArgLeuGly 100105110 PheLeuHisSerGlyThrAlaLysSerValThrCysThrTyrSerPro 115120125 AlaLeuAsnLysMetPheCysGlnLeuAlaLysThrCysProValGln 130135140 LeuTrpValAspSerThrProProProGlyThrArgValArgAlaMet 145150155160 AlaIleTyrLysGlnSerGlnHisMetThrGluValValArgArgCys 165170175 ProHisHisGluArgCysSerAspSerAspGlyLeuAlaProProGln 180185190 HisLeuIleArgValGluGlyAsnLeuArgValGluTyrLeuAspAsp 195200205 ArgAsnThrPheArgHisSerValValValProTyrGluProProGlu 210215220 ValGlySerAspCysThrThrIleHisTyrAsnTyrMetCysAsnSer 225230235240 SerCysMetGlyGlyMetAsnArgArgProIleLeuThrIleIleThr 245250255 LeuGluAspSerSerGlyAsnLeuLeuGlyArgAsnSerPheGluVal 260265270 ArgValCysAlaCysProGlyArgAspArgArgThrGluGluGluAsn 275280285 LeuArgLysLysGlyGluProHisHisGluLeuProProGlySerThr 290295300 LysArgAlaLeuProAsnAsnThrSerSerSerProGlnProLysLys 305310315320 LysProLeuAspGlyGluTyrPheThrLeuGlnIleArgGlyArgGlu 325330335 Arg SEQIDNO:7 GluValGlnLeuGlnGlnSerGlyProGluLeuValLysProGlyAla 151015 SerValLysMetSerCysLysAlaSerGlyTyrThrPheThrSerTyr 202530 ValMetHisTrpValLysGlnLysProGlyGlnGlyLeuGluTrpIle 354045 GlyTyrIleAsnProTyrAsnAspGlyThrLysTyrAsnGluLysPhe 505560 LysGlyLysAlaThrLeuThrSerAspLysSerSerSerThrAlaTyr 65707580 MetGluLeuSerSerLeuThrSerGluAspSerAlaValTyrTyrCys 859095 AlaArgGlyGlyTyrTyrAlaMetAspTyrTrpGlyGlnGlyThrSer 100105110 ValThrValSerSerGluSerGlnSerPheProAsnValPheProLeu 115120125 ValSerCysGluSerProLeuSerAspLysAsnLeuValAlaMetGly 130135140 CysLeuAlaArgAspPheLeuProSerThrIleSerPheThrTrpAsn 145150155160 TyrGlnAsnAsnThrGluValIleGlnGlyIleArgThrPheProThr 165170175 LeuArgThrGlyGlyLysTyrLeuAlaThrSerGlnValLeuLeuSer 180185190 ProLysSerIleLeuGluGlySerAspGluTyrLeuValCysLysIle 195200205 HisTyrGlyGlyLysAsnArgAspLeuHisValProIleProAlaVal 210215220 AlaGluMetAsnProAsnValAsnValPheValProProArgAspGly 225230235240 PheSerGlyProAlaProArgLysSerLysLeuIleCysGluAlaThr 245250255 AsnPheThrProLysProIleThrValSerTrpLeuLysAspGlyLys 260265270 LeuValGluSerGlyPheThrThrAspProValThrIleGluAsnLys 275280285 GlySerThrProGlnThrTyrLysValIleSerThrLeuThrIleSer 290295300 GluIleAspTrpLeuAsnLeuAsnValTyrThrCysArgValAspHis 305310315320 ArgGlyLeuThrPheLeuLysAsnValSerSerThrCysAlaAlaSer 325330335 ProSerThrAspIleLeuThrPheThrIleProProSerPheAlaAsp 340345350 IlePheLeuSerLysSerAlaAsnLeuThrCysLeuValSerAsnLeu 355360365 AlaThrTyrGluThrLeuAsnIleSerTrpAlaSerGlnSerGlyGlu 370375380 ProLeuGluThrLysIleLysIleMetGluSerHisProAsnGlyThr 385390395400 PheSerAlaLysGlyValAlaSerValCysValGluAspTrpAsnAsn 405410415 ArgLysGluPheValCysThrValThrHisArgAspLeuProSerPro 420425430 GlnLysLysPheIleSerLysProAsnGluValHisLysHisProPro 435440445 AlaValTyrLeuLeuProProAlaArgGluGlnLeuAsnLeuArgGlu 450455460 SerAlaThrValThrCysLeuValLysGlyPheSerProAlaAspIle 465470475480 SerValGlnTrpLeuGlnArgGlyGlnLeuLeuProGlnGluLysTyr 485490495 ValThrSerAlaProMetProGluProGlyAlaProGlyPheTyrPhe 500505510 ThrHisSerIleLeuThrValThrGluGluGluTrpAsnSerGlyGlu 515520525 ThrTyrThrCysValValGlyHisGluAlaLeuProHisLeuValThr 530535540 GluArgThrValAspLysSerThrGlyLysProThrLeuTyrAsnVal 545550555560 SerLeuIleMetSerAspThrGlyGlyThrCysTyr 565570 SEQIDNO:8 AspIleGlnMetThrGlnThrThrSerSerLeuSerAlaSerLeuGly 151015 AspArgValThrIleSerCysArgAlaSerGlnAspIleSerAsnTyr 202530 LeuAsnTrpTyrGlnGlnLysProAspGlyThrValLysLeuLeuIle 354045 TyrTyrThrSerArgLeuHisSerGlyValProSerArgPheSerGly 505560 SerGlySerGlyThrAspTyrSerLeuThrIleSerAsnLeuGluGln 65707580 GluAspIleAlaThrTyrPheCysGlnGlnGlyAsnThrLeuProTyr 859095 ThrPheGlyGlyGlyThrLysLeuGluIleLysArgAlaAspAlaAla 100105110 ProThrValSerIlePheProProSerSerGluGlnLeuThrSerGly 115120125 GlyAlaSerValValCysPheLeuAsnAsnPheTyrProLysAspIle 130135140 AsnValLysTrpLysIleAspGlySerGluArgGlnAsnGlyValLeu 145150155160 AsnSerTrpThrAspGlnAspSerLysAspSerThrTyrSerMetSer 165170175 SerThrLeuThrLeuThrLysAspGluTyrGluArgHisAsnSerTyr 180185190 ThrCysGluAlaThrHisLysThrSerThrSerProIleValLysSer 195200205 PheAsnArgAsnGluCys 210 SEQIDNO:9 GluValGlnLeuGlnGlnSerGlyProGluLeuValLysProGlyAla 151015 SerValLysMetSerCysLysAlaSerGlyTyrThrPheThrSerTyr 202530 ValMetHisTrpValLysGlnLysProGlyGlnGlyLeuGluTrpIle 354045 GlyTyrIleAsnProTyrAsnAspGlyThrLysTyrAsnGluLysPhe 505560 LysGlyLysAlaThrLeuThrSerAspLysSerSerSerThrAlaTyr 65707580 MetGluLeuSerSerLeuThrSerGluAspSerAlaValTyrTyrCys 859095 AlaArgGlyGlyTyrTyrAlaMetAspTyrTrpGlyGlnGlyThrSer 100105110 ValThrValSerSer 115 SEQIDNO:10 AspIleGlnMetThrGlnThrThrSerSerLeuSerAlaSerLeuGly 151015 AspArgValThrIleSerCysArgAlaSerGlnAspIleSerAsnTyr 202530 LeuAsnTrpTyrGlnGlnLysProAspGlyThrValLysLeuLeuIle 354045 TyrTyrThrSerArgLeuHisSerGlyValProSerArgPheSerGly 505560 SerGlySerGlyThrAspTyrSerLeuThrIleSerAsnLeuGluGln 65707580 GluAspIleAlaThrTyrPheCysGlnGlnGlyAsnThrLeuProTyr 859095 ThrPheGlyGlyGlyThrLysLeuGluIleLys 100105 SEQIDNO:11 SerTyrValMetHis 15 SEQIDNO:12 TyrIleAsnProTyrAsnAspGlyThrLysTyrAsnGluLysPheLys 151015 Gly SEQIDNO:13 GlyGlyTyrTyrAlaMetAspTyr 15 SEQIDNO:14 ArgAlaSerGlnAspIleSerAsnTyrLeuAsn 1510 SEQIDNO:15 TyrThrSerArgLeuHisSer 15 SEQIDNO:16 GlnGlnGlyAsnThrLeuProTyrThr 15