PCSK9 INHIBITORS AND METHODS OF USE THEREOF

20240228469 · 2024-07-11

    Inventors

    Cpc classification

    International classification

    Abstract

    A compound with the Formula (I):


    A-B-C(I)

    wherein A is of the following formula:

    ##STR00001##

    where X.sup.1 is N
    B is of formula (B-1) or (B-2)

    ##STR00002##

    and C is selected from the group consisting of optionally substituted C.sub.6-10 carboaryl, C.sub.5-6 heteroaryl and C.sub.5-10 heterocyclyl and their use as PCSK9 inhibitors.

    Claims

    1. A compound of Formula (I)
    A-B-C(I) or a pharmaceutically acceptable salt, tautomeric forms or stereoisomers thereof, wherein A is of the following: ##STR00868## wherein the wavy line indicates the point of attachment to B; X.sup.1 is N; R.sup.A2 is selected from the group consisting of: (i) H; (ii) halo; (iii) CN; (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; (v) C.sub.1-6 alkoxy, optionally substituted by OH, alkyl amido, or one or more halo groups; (vi) C.sub.1-6 acyl amido, wherein the acyl is optionally substituted by H or methyl; (vii) C.sub.1-6 thioalkyl; (viii) C.sub.1-6 alkyl ester; (ix) C.sub.1-6 alkyl acyl; (x) C.sub.4-5 heterocyclyl; (xi) C.sub.5 heteroaryl; (xii) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, OH, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl or C.sub.1-3 alkyl wherein the C.sub.1-3 alkyl is optionally substituted with one or more halo or OH groups; (xiii) OH; and (xiv) C.sub.1-6 alkylamino; R.sup.A3 is selected from the group consisting of: (i) H; (ii) halo; (iii) CN; (iv) C.sub.1-6 hydrocarbon optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl, C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkyl ester, C.sub.1-6 alkylamino, C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkyl acylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; (v) OH; (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups; (vii) C.sub.1-6 acyloxy; (viii) C.sub.4 heterocycyl; (ix) NH.sub.2; (x) C.sub.1-6 alkylamino, optionally substituted by CN, OH or C.sub.4 heterocyclyl; (xi) C.sub.1-6 dialkylamino, optionally substituted by NH.sub.2; (xii) C.sub.1-6 acylamido (where acyl substituent is H or Me); (xiii) carbaimidoyl or methyl-carbaimidoyl; (xiv) carboxyamino; (xv) C.sub.1-6 thioalkyl, optionally substituted by OH or NH.sub.2; (xvi) C.sub.1-6 alkyl sulfinyl; (xvi) C.sub.1-6 alkyl sulfonyl, optionally substituted by one or more halo groups; (xvii) C.sub.1-6 sulfonimodyl; (xviii) C.sub.1-6 alkyl phosphinyl; (xix) carboxy; (xx) C(?O)NH.sub.2 (xxi) C.sub.1-6 alkyl ester; (xxii) C.sub.1-6 alkyl acyl, optionally substituted by one or more halo groups; and (xxiii) C.sub.1-6 alkyl amido; or wherein R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form: (i) an optionally substituted C.sub.5-7 heterocycle ring; (ii) an optionally substituted C.sub.5-7 heteroaromatic ring; (iii) an optionally substituted C.sub.6 carboaromatic ring; or (iv) an optionally substituted C.sub.5-7 carbocyclic ring wherein the optional substituents are selected from C.sub.1-6 alkyl, halo, C.sub.1-6 alkoxy, NH.sub.2, C.sub.1-6 alkylamino, OH, and CN; wherein B is of formula (B-1) or (B-2) ##STR00869## wherein the wavy line indicates the point of attachment to A and C; R.sup.B1 is H, OH, ?CHCH.sub.2OH, OC.sub.1-4 alkyl or C.sub.1-4 alkyl, wherein the C.sub.1-4 alkyl is optionally substituted by OH or OMe; ##STR00870## wherein the wavy line indicates the point of attachment to A and C; R.sup.B2 is C.sub.1-2 alkyl-OH, CH.sub.2C(?O)NHMe or C.sub.1-3 alkyl; wherein C is selected from the group consisting of C.sub.6-10 carboaryl, C.sub.5-6 heteroaryl and C.sub.5-10 heterocyclyl, which groups are optionally substituted by: (i) C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.4-10 heterocyclyl, or C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12 heterocyclyl or a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or more of the following groups: a) one or two ?O groups; b) one or more halo groups; c) CN, NH.sub.2, OH; d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; f) C.sub.1-6 alkylester; g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; h) C.sub.5-6 heteroaryl; i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; l) P(?O)Me.sub.2; m) carboxy or CH.sub.2-carboxy; n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl; (ii) one or more groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido, and di-C.sub.1-6 alkyl sulfonamido.

    2. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A2 is selected from the group consisting of: (i) H; (ii) halo; (iii) C.sub.1-6 alkyl ester; (iv) C.sub.1-6 hydrocarbon; (v) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; (vi) C.sub.1-6 thioalkyl; (vii) C.sub.1-6 alkyl acyl; (viii) C.sub.5 heteroaryl; and (ix) C.sub.1-6 alkylamino.

    3. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A2 is selected from the group consisting of C(?O)OCH.sub.2CH.sub.3, cyclopropyl, methyl, H, Cl, C(?O)CH.sub.3, S-ethyl, pyrazole, N(CH.sub.3).sub.2, C(?O)NH(CH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2C?CH, C(?O)NH(oxetane), C(?O)NH (CH.sub.2CHF.sub.2), C(?O)NH(CH.sub.2CH.sub.3), C(?O)NH.sub.2, C(?O)NH(CH.sub.3), C(?O)N(CH.sub.3).sub.2, C(?O)N(CH.sub.3)(CH.sub.2CH.sub.2OH), C(?O)N(CH.sub.3)(CH.sub.2C?CH) and C(?O)NH(CH.sub.2CH.sub.2OH).

    4. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 is selected from the group consisting of: (i) H; (ii) halo; (iii) CN; (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkylester, C.sub.1-6 alkylamino; C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkylacylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; (v) OH; and (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups.

    5. The compound of any claim 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 is selected from the group consisting of H, methyl and OH.

    6. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein B is of the following formula: ##STR00871##

    7. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl, wherein the optional substituents are selected from C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12 heterocyclyl and a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or more of the following groups: a) one or two ?O groups; b) one or more halo groups; c) CN, NH.sub.2 or OH; d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; f) C.sub.1-6 alkylester; g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; h) C.sub.5-6 heteroaryl; i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; l) P(?O)Me.sub.2; m) carboxy or CH.sub.2-carboxy; and/or n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    8. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein C is: a) an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl wherein the optional substituents are selected from C.sub.6 heteroaryl or C.sub.6 heterocyclyl, which are themselves optionally substituted by one or more groups selected from the following: i) one or two ?O groups; ii) methyl; iii) OMe; iv) Cl; v) CN; vi) CF.sub.3; vii) F; viii) pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; and ix) OCF.sub.3; x) OCHF.sub.2; or b) an optionally substituted pyridinyl wherein the optional substituent is phenyl or pyridyl which are themselves optionally substituted by one or more groups selected from the following: a) one or more OMe groups; b) one or more F groups; c) CN; d) tetrazole; and e) carboxy; or c) an optionally substituted pyridinyl wherein the optional substituent is a C.sub.5 heteroaryl or C.sub.5 heterocyclyl which are themselves optionally substituted by one or more substituents selected from methyl and CN.

    9. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-1): ##STR00872## wherein D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, each which are themselves optionally substituted by: i) one or two ?O groups; ii) one or two C.sub.1-4 alkyl groups which can be branched; iii) OMe; iv) piperazinyl, optionally substituted by methyl; v) C(?O)OH (carboxy); vi) Cl; vii)F; viii) phenyl, optionally substituted by one or more fluoro; ix) CN; x) CF.sub.3; xi) OCF.sub.3; xii) tetrazolyl, pyrazolyl, triazolyl each of which is optionally substituted by methyl; xiii) NH.sub.2; xiv) pyridinyl; xv) CH.sub.2OH; xvi) OH; xvii) P(?O)Me.sub.2; or xviii) OCHF.sub.2.

    10. The compound of claim 9 or a pharmaceutically acceptable salt thereof, wherein D is of the formula (D-1): ##STR00873## wherein one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from i) C.sub.1-6 alkyl, optionally substituted by one or more halo groups; ii) C.sub.1-6 alkoxy, optionally substituted by one or more halo groups; iii) C.sub.5-6 heterocyclyl or C.sub.5-6 heteroaryl with an optional methyl substituent; iv) carboxy or CH.sub.2-carboxy; v) ?O, halo, NH.sub.2 or CN; vi) phenyl, optionally substituted by one or more halo atoms; and the rest are H; or wherein R.sup.D3 and R.sup.D4 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring, wherein the optional substituents are selected from OH, methyl, OMe, halo and C(?O)OH; or wherein R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are all H.

    11. The compound of claim 10 or a pharmaceutically acceptable salt thereof, wherein: a) one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from: i) methyl; ii) OMe; iii) Cl; iv) CN; v) CF.sub.3; vi) F; vii) pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; viii) OCF.sub.3 ix) OCHF.sub.2 and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H; b) R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are all H; c) R.sup.D3 is selected from H, CN, OMe, Cl, pyrazole optionally substituted by methyl, tetrazole, methyl, OCHF.sub.2, or triazole and wherein R.sup.D1, R.sup.D2 and R.sup.D4 are all H; d) R.sup.D1 is selected from H, OMe, Cl, CF.sub.3, OCF.sub.3, OCHF.sub.2, CN, F, pyrazole optionally substituted by methyl or triazole and R.sup.D2, R.sup.D3 and R.sup.D4 are all H; or e) R.sup.D3 and R.sup.D4 form an unsubstituted benzene ring or an unsubstituted pyridine ring.

    12. The compound of claim 9 or a pharmaceutically acceptable salt thereof, wherein D is of the formula (D-2): ##STR00874## wherein X.sup.D is NR.sup.D5a or CR.sup.D5aR.sup.D5b; R.sup.D5a is selected from H or methyl; either R.sup.D5b and R.sup.D6b are both H or together they are CH.sub.2; R.sup.D6a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH, wherein when R.sup.D6a is ?O, R.sup.D6b is absent; R.sup.D7a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH; R.sup.D7b is H, wherein when R.sup.D7a is ?O, R.sup.D7b is absent; or wherein R.sup.D6a and R.sup.D7a together form a benzene ring or a C.sub.6 heteroaromatic ring which is optionally substituted by CN, P(?O)Me.sub.2 or carboxy and R.sup.D6b and R.sup.D7b are absent.

    13. The compound of claim 9 or a pharmaceutically acceptable salt thereof, wherein D is selected from ##STR00875## ##STR00876## ##STR00877## ##STR00878##

    14. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-2): ##STR00879## wherein one of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from the group consisting of: methyl; OMe; piperazinyl optionally substituted by methyl; C(?O)OH (carboxy); Cl; F; pyrazolyl optionally substituted by methyl; triazolyl; tetrazole; optionally substituted phenyl (wherein the optional substituent is methyl or halo); CN; CF.sub.3; OCHF.sub.2, OCF.sub.3; and the rest of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or R.sup.C9 and R.sup.C10 form a benzene or 6 membered heteroaromatic ring, and R.sup.C7 and R.sup.C8 are both H; or wherein R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are all H.

    15. The compound of claim 14 or a pharmaceutically acceptable salt thereof, wherein: a) all of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or b) R.sup.C9 is selected from H, CN, OMe, Cl, pyrazole optionally substituted by methyl, tetrazole, methyl, OCHF.sub.2, or triazole and R.sup.C7, R.sup.C8 and R.sup.C10 are all H; or c) R.sup.C7 is selected from H, OMe, Cl, CF.sub.3, OCF.sub.3, OCHF.sub.2, CN, F, triazole or pyrazole optionally substituted by methyl, and R.sup.C7, R.sup.C8 and R.sup.C10 are all H.

    16. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein C is selected from the group consisting of: ##STR00880## ##STR00881## ##STR00882## ##STR00883## ##STR00884## ##STR00885## ##STR00886## ##STR00887## ##STR00888## ##STR00889##

    17. The compound of claim 1 or a pharmaceutically acceptable salt thereof, wherein A-B-C is of the formula (I-A), (I-B), (I-Ba), (I-Bb), (I-C), (I-D), (I-E), (I-Ea) or (I-Eb): ##STR00890## wherein X.sup.1, R.sup.A2, R.sup.A3, C, D, R.sup.D1, R.sup.D2, R.sup.D3, R.sup.D4, R.sup.D1a, R.sup.D2a, R.sup.D3a, R.sup.D4a, X.sup.D, R.sup.D6a, R.sup.D6b and R.sup.D7a are as defined in any of the preceding claims.

    18. The compound of claim 1 which is: ##STR00891## ##STR00892## ##STR00893## ##STR00894## ##STR00895## ##STR00896## ##STR00897## ##STR00898## ##STR00899## ##STR00900## ##STR00901## ##STR00902## ##STR00903## ##STR00904## ##STR00905## ##STR00906## ##STR00907## ##STR00908## ##STR00909## ##STR00910## ##STR00911## ##STR00912## ##STR00913## or a pharmaceutically acceptable salt thereof.

    19. (canceled)

    20. A pharmaceutical composition comprising the compound of claim 1 or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable diluent, carrier or excipient.

    21. (canceled)

    22. (canceled)

    23. A method of treating PCSK9-mediated disease or disorder in a patient in need thereof comprising administering to the patient a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to claim 1.

    24. The method according to claim 23, wherein the disease or disorder is a cardiovascular disease or disorder.

    25. The method of claim 24, wherein the cardiovascular disease or disorder is selected from dyslipidemia, hypercholesterolemia, hypertriglyceridemia, hyperlipidemia, hypoalphalipoproteinemia, metabolic syndrome, diabetic complications, atherosclerosis, stroke, vascular dimensia, chronic kidney disease, coronary heart disease, coronary artery disease, retinopathy, inflammation, thrombosis, peripheral vascular disease heart failure, and congestive heart failure.

    26. The method of claim 25, wherein the compound is administered simultaneously, separately, or sequentially in combination with an additional active ingredient selected from the group consisting of: i) a statin; ii) a cholesterol absorption inhibitor; iii) a SGLT2 inhibitor; iv) a P2Y12 inhibitor; v) a citrate lyase inhibitor; and vi) anti-hypertensive drugs.

    Description

    DETAILED DESCRIPTION

    [0082] Aspects and embodiments will now be discussed. Further aspects and embodiments will be apparent to those skilled in the art. All documents mentioned in this text are incorporated herein by reference.

    [0083] Compounds of Formula (I) and its use in the treatment of cardiovascular diseases are described herein. The compounds disclosed herein are PCSK9 inhibitors. The compounds may have higher inhibition of PCSK9, lower hERG activity, improved secondary pharmacology profile including GSK3? and/or other kinases, good stability, and/or improved activity in the treatment of cardiovascular diseases. The compounds may have an improved secondary pharmacology profile or an improved off-target profile.

    Definitions

    Substituents

    [0084] The phrase optionally substituted as used herein, pertains to a parent group which may be unsubstituted or which may be substituted.

    [0085] Unless otherwise specified, the term substituted as used herein, pertains to a parent group which bears one or more substituents. The term substituent is used herein in the conventional sense and refers to a chemical moiety which is covalently attached to, or if appropriate, fused to, a parent group. A wide variety of substituents are well known, and methods for their formation and introduction into a variety of parent groups are also well known.

    [0086] Examples of substituents are described in more detail below.

    [0087] Unless otherwise stated, halo is selected from chloro (Cl), fluoro (F), bromo (Br) and iodo (I), such as fluoro.

    [0088] Cyano (nitrile, carbonitrile): CN.

    [0089] Hydroxy: OH.

    [0090] Oxo: ?O (oxygen double bonded to the rest of the molecule).

    [0091] C.sub.1-6 hydrocarbon: The term C.sub.1-6 hydrocarbon as used herein pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 1 to 6 carbon atoms, which may be aliphatic or alicyclic, which may be saturated or unsaturated (e.g. partially unsaturated, fully unsaturated) and may also be branched. Thus, the term hydrocarbon includes the terms alkyl, alkenyl, alkynyl, cycloalkyl, etc., discussed below.

    [0092] C.sub.1-6 alkyl: The term C.sub.1-6 alkyl as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 1 to 6 carbon atoms, which are saturated and may also be branched. The term C.sub.1-4 alkyl as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 1 to 4 carbon atoms, which are saturated.

    [0093] Examples of saturated alkyl groups include, but are not limited to, methyl (C.sub.1), ethyl (C.sub.2), propyl (C.sub.3), butyl (C.sub.4), pentyl (C.sub.5) and hexyl (C.sub.6).

    [0094] Examples of saturated linear alkyl groups include, but are not limited to, methyl (C.sub.1), ethyl (C.sub.2), n-propyl (C.sub.3), n-butyl (C.sub.4), n-pentyl (amyl) (C.sub.5) and n-hexyl (C.sub.6).

    [0095] Examples of saturated branched alkyl groups include iso-propyl (C.sub.3), iso-butyl (C.sub.4), sec-butyl (C.sub.4), tert-butyl (C.sub.4), iso-pentyl (C.sub.5), and neo-pentyl (C.sub.5).

    [0096] C.sub.2-6 Alkenyl: The term C.sub.2-6 alkenyl as used herein, pertains to a hydrocarbon group having one or more carbon-carbon double bonds.

    [0097] Examples of unsaturated alkenyl groups include, but are not limited to, ethenyl (vinyl, CH?CH.sub.2), 1-propenyl (CH?CHCH.sub.3), 2-propenyl (allyl, CHCH?CH.sub.2), isopropenyl (1-methylvinyl, C(CH.sub.3)?CH.sub.2), butenyl (C.sub.4), pentenyl (C.sub.5), and hexenyl (C.sub.6).

    [0098] C.sub.2-6 alkynyl: The term C.sub.2-6 alkynyl as used herein, pertains to a hydrocarbon group having one or more carbon-carbon triple bonds.

    [0099] Examples of unsaturated alkynyl groups include, but are not limited to, ethynyl (C?CH) and 2-propynyl (propargyl, CH.sub.2C?CH).

    [0100] C.sub.1-6 alkoxy: The term C.sub.1-6 alkoxy as used herein, pertains to an OR group, wherein R is an C.sub.1-6 hydrocarbon group. Examples of C.sub.1-6 alkoxy groups include, but are not limited to, OMe, OEt (ethoxy), O(nPr) (n-propoxy), O(iPr) (isopropoxy), O(nBu) (n-butoxy), O(sBu) (sec-butoxy), O(iBu) (isobutoxy), and O(tBu) (tert-butoxy).

    [0101] C.sub.1-6 acyloxy: The term C.sub.1-6 acyloxy (reverse ester) as used herein, pertains to an OC(?O)R, wherein R is a C.sub.1-6 hydrocarbon group. Examples of acyloxy groups include, but are not limited to, OC(?O)CH.sub.3 (acetoxy), OC(?O)CH.sub.2CH.sub.3, or OC(?O)C(CH.sub.3).sub.3.

    [0102] Amino: NR.sup.1R.sup.2, wherein R.sup.1 and R.sup.2 are independently amino substituents, for example, hydrogen, a C.sub.1-6 hydrocarbon group (also referred to as C.sub.1-6 alkylamino or C.sub.1-6 dialkylamino), or, in the case of a cyclic amino group, R.sup.1 and R.sup.2, taken together with the nitrogen atom to which they are attached, form a heterocyclic ring having from 4 to 6 ring atoms. Amino groups may be primary (NH.sub.2), secondary (NHR.sup.1), or tertiary (NHR.sup.1R.sup.2), and in cationic form, may be quaternary (.sup.+NR.sup.1R.sup.2R.sup.3). Examples of amino groups include, but are not limited to NH.sub.2, NHCH.sub.3, NHC(CH.sub.3).sub.2, N(CH.sub.3).sub.2, N(CH.sub.2CH.sub.3).sub.2, and NHPh. Examples of cyclic amino groups include, but are not limited to, aziridino, azetidino, pyrrolidino, piperidino, piperazino, morpholino, and thiomorpholino.

    [0103] C.sub.1-6 acylamido: Acylamido (acylamino): NR.sup.1C(?O)R.sup.2, wherein R.sup.1 is an amide substituent, for example, hydrogen or a C.sub.1-6 hydrocarbon group, and R.sup.2 is an acyl substituent, for example, a C.sub.1-6 hydrocarbon group. Examples of acylamide groups include, but are not limited to, NHC(?O)CH.sub.3 and NHC(?O)CH.sub.2CH.sub.3. In some embodiments R.sup.1 and R.sup.2 may together form a cyclic or bicyclic structure and form a cyclic acylamido groups. Examples of such groups include succinimidyl, maleimidyl, phthalimidyl, 2-oxo-3H-benzimidazol-1-yl, 3-methyl-2-oxo-benzimidazol-1-yl, 1-methyl-2-oxoimidazo[4,5-b]pyridin-3-yl, 2,5-dioxoimidazolidin-1-yl and 2,4-dioxoimidazolidin-1-yl:

    ##STR00006##

    [0104] Carbaimidoyl: C(?NH)(NH.sub.2).

    [0105] Methyl-carbaimidoyl: C(?NCH.sub.3)NH.sub.2.

    [0106] Carboxyamino: N(H)(C(?O)OH).

    [0107] C.sub.1-6 thioalkyl: The term C.sub.1-6 thioalkyl as used herein, pertains to an SR, wherein R is a C.sub.1-6 hydrocarbon group. Examples of C.sub.1-6 alkylthio groups include, but are not limited to, SCH.sub.3 and SCH.sub.2CH.sub.3.

    [0108] C.sub.1-6 alkyl sulfinyl: The term C.sub.1-6 alkyl sulfinyl pertains to a sulfine (sulfinyl, sulfoxide) which has the structure S(?O)R, wherein R is a C.sub.1-6 hydrocarbon group. Examples of C.sub.1-6 alkyl sulfinyl groups include, but are not limited to, S(?O)CH.sub.3 and S(?O)CH.sub.2CH.sub.3.

    [0109] C.sub.1-6 alkyl sulfonyl: The term C.sub.1-6 alkyl sulfonyl as used herein pertains to an S(?O).sub.2R, group wherein R is a C.sub.1-6 hydrocarbon group, including, for example, a fluorinated or perfluorinated C.sub.1-6 alkyl group. Examples of C.sub.1-6 alkyl sulfonyl groups include, but are not limited to, S(?O).sub.2CH.sub.3 (methanesulfonyl, mesyl), S(?O).sub.2CF.sub.3 (triflyl), S(?O).sub.2CH.sub.2CH.sub.3 (esyl), S(?O).sub.2C.sub.4F.sub.9 (nonaflyl) and S(?O).sub.2CH.sub.2CF.sub.3 (tresyl).

    [0110] C.sub.1-6 sulfonimodyl: The term C.sub.1-6 sulfonimodyl is also referred to as Sulfonamido (sulfinamoyl; sulfonic acid amide; sulfonamide) and has the structure S(?O).sub.2NR.sup.1R.sup.2, wherein R.sup.1 and R.sup.2 are independently amino substituents, as defined for amino groups. Examples of sulfonamido groups include, but are not limited to, S(?O).sub.2NH.sub.2, S(?O).sub.2NH(CH.sub.3), S(?O).sub.2N(CH.sub.3).sub.2, S(?O).sub.2NH(CH.sub.2CH.sub.3) and S(?O).sub.2N(CH.sub.2CH.sub.3).sub.2.

    [0111] C.sub.1-6 alkyl phosphinyl: The term C.sub.1-6 alkyl phosphinyl (phosphine oxide) has the structure P(?O)R.sub.2, wherein each R is independently a C.sub.1-6 hydrocarbon group. Examples of C.sub.1-6 alkyl phosphinyl groups include, but are not limited to, P(?O)(CH.sub.3).sub.2, P(?O)(CH.sub.2CH.sub.3).sub.2 and P(?O)(tBu).sub.2. Wherein each R group can be the same or different groups.

    [0112] Carboxy (carboxylic acid): C(?O)OH.

    [0113] C.sub.1-6 alkyl ester: The term C.sub.1-6 alkyl ester (carboxylate, carboxylic acid ester, oxycarbonyl) has the structure C(?O)OR, wherein R is a C.sub.1-6 hydrocarbon group. Examples of ester groups include, but are not limited to, C(?O)OCH.sub.3, C(?O)OCH.sub.2CH.sub.3 and C(?O)OC(CH.sub.3).sub.3.

    [0114] C.sub.1-6 alkyl acyl: The term C.sub.1-6 alkyl acyl also known as Acyl (keto) has the structure C(?O)R, wherein R is a C.sub.1-6 hydrocarbon group. Examples of C.sub.1-6 alkyl acyl groups include, but are not limited to, C(?O)CH.sub.3 (acetyl), C(?O)CH.sub.2CH.sub.3 (propionyl) or C(?O)C(CH.sub.3).sub.3 (t-butyryl). C.sub.1-6 alkyl amido: The term C.sub.1-6 alkyl amido (also referred to as carbamoyl, carbamyl, aminocarbonyl, carboxamide) has the structure C(?O)NR.sup.1R.sup.2, wherein R.sup.1 and R.sup.2 are independently amino substituents, as defined for amino groups for example, hydrogen, a C.sub.1-6 hydrocarbon group (also referred to as C.sub.1-6 alkylamido or C.sub.1-6 dialkylamido), or, in the case of a cyclic amido group, R.sup.1 and R.sup.2, taken together with the nitrogen atom to which they are attached, form a heterocyclic ring having from 4 to 6 ring atoms. Examples of amido groups include, but are not limited to, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, C(?O)NHCH.sub.2CH.sub.3, and C(?O)N(CH.sub.2CH.sub.3).sub.2, as well as amido groups in which R.sup.1 and R.sup.2, together with the nitrogen atom to which they are attached, form a heterocyclic structure as in, for example, piperidinocarbonyl, morpholinocarbonyl, thiomorpholinocarbonyl, and piperazinocarbonyl.

    [0115] C.sub.3-12 cycloalkyl: The term C.sub.3-12 cycloalkyl as used herein, pertains to an alkyl group which is also a cyclyl group; that is, a monovalent moiety obtained by removing a hydrogen atom from an alicyclic ring atom of a cyclic hydrocarbon (carbocyclic) compound, which moiety has from 3 to 7 carbon atoms, including from 3 to 7 ring atoms. The carbocyclic ring may be saturated or unsaturated and may be bridged or unbridged. The ring may be a fused ring or a single ring.

    [0116] Examples of cycloalkyl groups include, but are not limited to, those derived from: [0117] saturated monocyclic hydrocarbon compounds:
    cyclopropane (C.sub.3), cyclobutane (C.sub.4), cyclopentane (C.sub.5), cyclohexane (C.sub.6), cycloheptane (C.sub.7), methylcyclopropane (C.sub.4), dimethylcyclopropane (C.sub.5), methylcyclobutane (C.sub.5), dimethylcyclobutane (C.sub.6), methylcyclopentane (C.sub.6), dimethylcyclopentane (C.sub.7) and methylcyclohexane (C.sub.7); [0118] unsaturated monocyclic hydrocarbon compounds:
    cyclopropene (C.sub.3), cyclobutene (C.sub.4), cyclopentene (C.sub.5), cyclohexene (C.sub.6), methylcyclopropene (C.sub.4), dimethylcyclopropene (C.sub.5), methylcyclobutene (C.sub.5), dimethylcyclobutene (C.sub.6), methylcyclopentene (C.sub.6), dimethylcyclopentene (C.sub.7) and methylcyclohexene (C.sub.7); and [0119] saturated polycyclic hydrocarbon compounds:
    norcarane (C.sub.7), norpinane (C.sub.7), norbornane (C.sub.7).

    [0120] C.sub.3-10 heterocyclyl: The term C.sub.3-10 heterocyclyl as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a ring atom of a heterocyclic compound, which moiety has from 3 to 10 ring atoms, of which from 1 to 5 are ring heteroatoms. In certain embodiments, each ring has from 3 to 7 ring atoms, of which from 1 to 4 are ring heteroatoms. The ring may be saturated or unsaturated, and may be bridged or unbridged. The ring may be a fused ring or a single ring. For the avoidance of doubt, substituents on the heterocycloalkyl ring may be linked via either a carbon atom or a heteroatom.

    [0121] In this context the term heteroatom means O, S, N, Si or B (Boron).

    [0122] In this context, the prefixes (e.g. C.sub.3-10 C.sub.3-7, C.sub.5-6, etc.) denote the number of ring atoms, or range of number of ring atoms, whether carbon atoms or heteroatoms. For example, the term C.sub.5-6heterocyclyl, as used herein, pertains to a heterocyclyl group having 5 or 6 ring atoms.

    [0123] Examples of monocyclic heterocyclyl groups include, but are not limited to, those derived from: [0124] N.sub.1: aziridine (C.sub.3), azetidine (C.sub.4), pyrrolidine (tetrahydropyrrole) (C.sub.5), pyrroline (e.g., 3-pyrroline, 2,5-dihydropyrrole) (C.sub.5), 2H-pyrrole or 3H-pyrrole (isopyrrole, isoazole) (C.sub.5), piperidine (C.sub.6), dihydropyridine (C.sub.6), tetrahydropyridine (C.sub.6), azepine (C.sub.7); [0125] O.sub.1: oxirane (C.sub.3), oxetane (C.sub.4), oxolane (tetrahydrofuran) (C.sub.5), oxole (dihydrofuran) (C.sub.5), oxane (tetrahydropyran) (C.sub.6), dihydropyran (C.sub.6), pyran (C.sub.6), oxepin (C.sub.7); [0126] S.sub.1: thiirane (C.sub.3), thietane (C.sub.4), thiolane (tetrahydrothiophene) (C.sub.5), thiane (tetrahydrothiopyran) (C.sub.6), thiepane (C.sub.7); [0127] O.sub.2: dioxolane (C.sub.5), dioxane (C.sub.6), and dioxepane (C.sub.7); [0128] O.sub.3: trioxane (C.sub.6); [0129] N.sub.2: imidazolidine (C.sub.5), pyrazolidine (diazolidine) (C.sub.5), imidazoline (C.sub.5), pyrazoline (dihydropyrazole) (C.sub.5), piperazine (C.sub.6); [0130] N.sub.1O.sub.1: tetrahydrooxazole (C.sub.5), dihydrooxazole (C.sub.5), tetrahydroisoxazole (C.sub.5), dihydroisoxazole (C.sub.5), morpholine (C.sub.6), tetrahydrooxazine (C.sub.6), dihydrooxazine (C.sub.6), oxazine (C.sub.6); [0131] N.sub.1S.sub.1: thiazoline (C.sub.5), thiazolidine (C.sub.5), thiomorpholine (C.sub.6); [0132] N.sub.2O.sub.1: oxadiazine (C.sub.6); [0133] O.sub.1S.sub.1: oxathiole (C.sub.5) and oxathiane (thioxane) (C.sub.6); and, [0134] N.sub.1O.sub.1S.sub.1: oxathiazine (C.sub.6).

    [0135] Examples of bicyclic heterocyclyl groups include, but are not limited to those derived from:

    TABLE-US-00001 Compound Structure 7-azabicyclo[4.2.0]octane (N.sub.1)C.sub.8 [00007]embedded image 3-azabicyclo[3.1.0]hexane (N.sub.1)C.sub.6 [00008]embedded image 6-azabicyclo[3.2.0]heptane (N.sub.1)C.sub.7 [00009]embedded image 2,3,3a,4,5,6,7,7a- octahydrofuro[2,3- c]pyridine(N.sub.1O.sub.1)C.sub.9 [00010]embedded image

    [0136] C.sub.6-10 carboaryl: The term C.sub.6-10 carboaryl, as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound, which moiety has from 6 to 10 ring atoms and the ring atoms are all carbon atoms, as in carboaryl groups. The ring may be a fused ring or a single ring. Examples of carboaryl groups include, but are not limited to, those derived from benzene (i.e. phenyl) (C.sub.6), naphthalene (C.sub.10) and azulene (C.sub.10).

    [0137] In this context, the prefixes (e.g. C.sub.5-7, C.sub.5-6, C.sub.5-10, etc.) denote the number of ring atoms, or range of number of ring atoms. For example, the term C.sub.5-6 aryl as used herein, pertains to an aryl group having 5 or 6 ring atoms.

    [0138] Examples of carboaryl groups which comprise fused rings, at least one of which is an aromatic ring, include, but are not limited to, groups derived from indane (e.g. 2,3-dihydro-1H-indene) (C.sub.9), indene (C.sub.9), isoindene (C.sub.9) and tetraline (1,2,3,4-tetrahydronaphthalene) (C.sub.10).

    [0139] C.sub.5-10 heteroaryl: The term C.sub.5-10 heteroaryl, as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound, which moiety has from 5 to 10 ring atoms of which from 1 to 5 are ring heteroatoms. In certain embodiments, each ring has from 5 to 7 ring atoms, of which from 1 to 4 are ring heteroatoms.

    [0140] For the avoidance of doubt, substituents on the heteroaryl ring may be linked via either a carbon atom or a heteroatom. The ring may be a fused ring or a single ring.

    [0141] In this context the term heteroatom means O, S, N, Si or B (Boron).

    [0142] Examples of monocyclic heteroaryl groups include, but are not limited to, those derived from: [0143] N.sub.1: pyrrole (azole) (C.sub.5), pyridine (azine) (C.sub.6); [0144] O.sub.1: furan (oxole) (C.sub.5); [0145] S.sub.1: thiophene (thiole) (C.sub.5); [0146] N.sub.1O.sub.1: oxazole (C.sub.5), isoxazole (C.sub.5), isoxazine (C.sub.6); [0147] N.sub.2O.sub.1: oxadiazole (furazan) (C.sub.5); [0148] N.sub.3O.sub.1: oxatriazole (C.sub.5); [0149] N.sub.1S.sub.1: thiazole (O.sub.5), isothiazole (C.sub.5); [0150] N.sub.2: imidazole (1,3-diazole) (C.sub.5), pyrazole (1,2-diazole) (C.sub.5), pyridazine (1,2-diazine) (O.sub.6), pyrimidine (1,3-diazine) (O.sub.6) (e.g., cytosine, thymine, uracil), pyrazine (1,4-diazine) (O.sub.6); [0151] N.sub.3: triazole (C.sub.5), triazine (O.sub.6); and, [0152] N.sub.4: tetrazole (C.sub.5).

    [0153] Examples of heteroaryl which comprise fused rings, include, but are not limited to O.sub.9 (with 2 fused rings) derived from:

    TABLE-US-00002 Compound Structure benzofuran (O.sub.1) [00011]embedded image isobenzofuran (O.sub.1) [00012]embedded image indole (N.sub.1) [00013]embedded image isoindole (N.sub.1) [00014]embedded image indolizine (N.sub.1) [00015]embedded image indoline (N.sub.1) [00016]embedded image isoindoline (N.sub.1) [00017]embedded image purine (N.sub.4)(e.g., adenine, guanine) [00018]embedded image [00019]embedded image [00020]embedded image benzimidazole (N.sub.2), [00021]embedded image indazole (N.sub.2) [00022]embedded image benzoxazole (N.sub.1O.sub.1) [00023]embedded image benzisoxazole (N.sub.1O.sub.1) [00024]embedded image benzodioxole (O.sub.2) [00025]embedded image [00026]embedded image benzofurazan (N.sub.2O.sub.1) [00027]embedded image benzotriazole (N.sub.3) [00028]embedded image benzothiofuran (S.sub.1) [00029]embedded image benzothiazole (N.sub.1S.sub.1) [00030]embedded image benzothiadiazole (N.sub.2S) [00031]embedded image 3H-imidazo[4,5- b]pyridine (N.sub.3) [00032]embedded image 5H-pyrrolo[2,3- b]pyrazine (N.sub.3) [00033]embedded image 1H-pyrazolo[3,4- b]pyrazine (N.sub.4) [00034]embedded image

    [0154] Examples of heteroaryl which comprise fused rings, include, but are not limited to C.sub.10 (with 2 fused rings) derived from:

    TABLE-US-00003 Compound Structure 2H-chromene (O.sub.1) [00035]embedded image 1H- isochromene (O.sub.1) [00036]embedded image chroman (O.sub.1) [00037]embedded image isochroman (O.sub.1) [00038]embedded image 3,4-dihydro- benzo[d][1,2]dioxine (O.sub.2) [00039]embedded image quinoline (N.sub.1) [00040]embedded image isoquinoline (N.sub.1) [00041]embedded image quinolizine (N.sub.1) [00042]embedded image benzoxazine (N.sub.1O.sub.1) [00043]embedded image [00044]embedded image [00045]embedded image And isomers thereof benzodiazine (N.sub.2) [00046]embedded image pteridine (N.sub.4) [00047]embedded image quinoxaline (N.sub.2) [00048]embedded image quinazoline (N.sub.2) [00049]embedded image cinnoline (N.sub.2) [00050]embedded image phthalazine (N.sub.2) [00051]embedded image naphthyridine (N.sub.2) [00052]embedded image [00053]embedded image [00054]embedded image [00055]embedded image and isomer thereof

    [0155] Spiro C.sub.6-12 carbocyclyl: The term Spiro C.sub.6-12carbocyclyl as used herein pertains to a moiety that has at least two molecular rings with only one common atom. The simplest spiro compounds are bicyclic (having just two rings), or have a bicyclic portion as part of the larger ring system, in either case with the two rings connected through the defining single common atom. Spiro C.sub.6-12carbocyclyl pertains to a cyclyl group; that is, a monovalent moiety obtained by removing a hydrogen atom from an alicyclic ring atom of a cyclic hydrocarbon (carbocyclic) compound, which moiety has from 6 to 12 carbon atoms, including from 3 to 7 ring atoms wherein the rings share a common atom.

    [0156] Spiro C.sub.6-12 heterocyclyl: The term Spiro C.sub.6-12heterocyclyl as used herein pertains to a moiety that has at least two molecular rings with only one common atom. The simplest spiro compounds are bicyclic (having just two rings), or have a bicyclic portion as part of the larger ring system, in either case with the two rings connected through the defining single common atom. The spiro C.sub.6-12heterocyclyl moiety pertains to a monovalent moiety obtained by removing a hydrogen atom from a ring atom of a heterocyclic compound, which moiety has from 8 to 12 ring atoms of which from 1 to 3 are ring heteroatoms wherein the rings share a common atom. In certain embodiments, each ring has from 9 to 11 ring atoms, of which from 1 to 2 are ring heteroatoms. For the avoidance of doubt, substituents on the heteroaryl ring may be linked via either a carbon atom or a heteroatom.

    [0157] For the avoidance of doubt, where multiple substituents are independently selected from a given group, the selected substituents may comprise the same substituents or different substituents from within the given group.

    Pharmaceutically Acceptable Salt

    [0158] The term pharmaceutically acceptable is used to specify that an object (for example a salt, dosage form or excipient) is suitable for use in patients. An example list of pharmaceutically acceptable salts can be found in the Handbook of Pharmaceutical Salts: Properties, Selection and Use, P. H. Stahl and C. G. Wermuth, editors, Weinheim/Z?rich: Wiley-VCH/VHCA, 2002. A suitable pharmaceutically acceptable salt of a compound of Formula (I) is, for example, an acid-addition salt. An acid addition salt of a compound of Formula (I) may be formed by bringing the compound into contact with a suitable inorganic or organic acid under conditions known to the skilled person. An acid addition salt may for example be formed using an inorganic acid selected from the group consisting of hydrochloric acid, hydrobromic acid, sulphuric acid and phosphoric acid. An acid addition salt may also be formed using an organic acid selected from the group consisting of trifluoroacetic acid, citric acid, maleic acid, oxalic acid, acetic acid, formic acid, benzoic acid, fumaric acid, succinic acid, tartaric acid, lactic acid, pyruvic acid, methanesulfonic acid, benzenesulfonic acid and para-toluenesulfonic acid.

    [0159] Therefore, in one embodiment there is provided a compound of Formula (I) or a pharmaceutically acceptable salt thereof, where the pharmaceutically acceptable salt is a hydrochloric acid, hydrobromic acid, sulphuric acid, phosphoric acid, trifluoroacetic acid, citric acid, maleic acid, oxalic acid, acetic acid, formic acid, benzoic acid, fumaric acid, succinic acid, tartaric acid, lactic acid, pyruvic acid, methanesulfonic acid, benzenesulfonic acid or para-toluenesulfonic acid salt. In one embodiment there is provided a compound of Formula (I) or a pharmaceutically acceptable salt thereof, where the pharmaceutically acceptable salt is a methanesulfonic acid salt. In one embodiment there is provided a compound of Formula (I) or a pharmaceutically acceptable salt thereof, where the pharmaceutically acceptable salt is a mono-methanesulfonic acid salt, i.e. the stoichiometry of the compound of the compound of Formula (I) to methanesulfonic acid is 1:1.

    Other Forms

    [0160] Compounds and salts described in this specification may exist in solvated forms and unsolvated forms. For example, a solvated form may be a hydrated form, such as a hemihydrate, a monohydrate, a dihydrate, a trihydrate or an alternative quantity thereof. The compounds of Formula (I) encompass all such solvated and unsolvated forms of compounds of Formula (I), particularly to the extent that such forms possess PCSK9 kinase inhibitory activity, as for example measured using the tests described herein.

    [0161] Compounds and salts described in this specification include one or more chiral (i.e. asymmetric) centres. To the extent a structure or chemical name in this specification does not indicate the chirality, the structure or name is intended to encompass any single stereoisomer (i.e. any single chiral isomer) corresponding to that structure or name, as well as any mixture of stereoisomers (e.g. a racemate). In some embodiments, a single stereoisomer is obtained by isolating it from a mixture of isomers (e.g. a racemate) using, for example, chiral chromatographic separation. In other embodiments, a single stereoisomer is obtained through direct synthesis from, for example, a chiral starting material.

    [0162] A particular enantiomer of a compound described herein may be more active than other enantiomers of the same compound.

    [0163] According to one embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, which is a single enantiomer being in an enantiomeric excess (% ee) of ?95, ?98% or ?99%. Conveniently, the single enantiomer is present in an enantiomeric excess (% ee) of ?99%.

    [0164] According to another embodiment there is provided a pharmaceutical composition, which comprises a compound of Formula (I), which is a single enantiomer being in an enantiomeric excess (% ee) of ?95, ?98% or ?99% or a pharmaceutically acceptable salt thereof, in association with one or more pharmaceutically acceptable excipients. Conveniently, the single enantiomer is present in an enantiomeric excess (% ee) of ?99%.

    Isotopes

    [0165] Atoms of the compounds and salts described in this specification may exist as their isotopes. The compound of Formula (I) encompasses all compounds of Formula (I) where an atom is replaced by one or more of its isotopes (for example a compound of Formula (I) where one or more carbon atom is an .sup.11C or .sup.13C carbon isotope, or where one or more hydrogen atoms is a .sup.2H or .sup.3H isotope).

    Tautomers

    [0166] Compounds and salts described in this specification may exist as a mixture of tautomers. Tautomers are structural isomers that exist in equilibrium resulting from the migration of a hydrogen atom. The compound of Formula (I) includes all tautomers of compounds of Formula (I) particularly to the extent that such tautomers possess PCSK9 inhibitory activity.

    [0167] For example, tautomeric forms of some of the exemplified compounds where R.sup.A3 is OH can be shown as follows.

    ##STR00056##

    Crystalline Forms

    [0168] Compounds and salts described in this specification may be crystalline and may exhibit one or more crystalline forms. The compound of Formula (I) encompasses any crystalline or amorphous form of a compound of Formula (I), or mixture of such forms, which possesses PCSK9 inhibitory activity.

    [0169] It is generally known that crystalline materials may be characterised using conventional techniques such as X-Ray Powder Diffraction (XRPD), Differential Scanning Calorimetry (DSC), Thermal Gravimetric Analysis (TGA), Diffuse Reflectance Infrared Fourier Transform (DRIFT) spectroscopy, Near Infrared (NIR) spectroscopy, solution and/or solid state nuclear magnetic resonance spectroscopy. The water content of crystalline materials may be determined by Karl Fischer analysis.

    Therapy, Prophylaxis and Related Terms

    [0170] The term therapy is intended to have its normal meaning of dealing with a disease in order to entirely or partially relieve one, some or all of its symptoms, or to correct or compensate for the underlying pathology. The term therapy also includes prophylaxis unless there are specific indications to the contrary. The terms therapeutic and therapeutically should be interpreted in a corresponding manner.

    [0171] The term prophylaxis is intended to have its normal meaning and includes primary prophylaxis to prevent the development of the disease and secondary prophylaxis whereby the disease has already developed and the patient is temporarily or permanently protected against exacerbation or worsening of the disease or the development of new symptoms associated with the disease.

    [0172] The term treatment is used synonymously with therapy. Similarly the term treat can be regarded as applying therapy where therapy is as defined herein.

    [0173] The term subject to which administration is contemplated includes, but is not limited to, humans (i.e., a male or female of any age group, e.g., a paediatric subject (e.g., infant, child, adolescent) or adult subject (e.g., young adult, middle-aged adult or senior adult)) and/or other primates (e.g., cynomolgus monkeys, rhesus monkeys); mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, goats, cats, and/or dogs; and/or birds, including commercially relevant birds such as chickens, ducks, geese, quail, and/or turkeys. Preferred subjects are humans.

    [0174] An effective amount, as used herein, refers to an amount that is sufficient to achieve a desired biological effect. A therapeutically effective amount, as used herein refers to an amount that is sufficient to achieve a desired therapeutic effect. For example, a therapeutically effective amount can refer to an amount that is sufficient to improve at least one sign or symptom of the disease to be treated.

    Pharmaceutical Compositions

    [0175] The compounds of Formula (I), and pharmaceutically acceptable salts thereof, may be administered as pharmaceutical compositions, comprising one or more pharmaceutically acceptable excipients.

    [0176] Therefore, in one embodiment there is provided a pharmaceutical composition comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.

    [0177] The excipient(s) selected for inclusion in a particular composition will depend on factors such as the mode of administration and the form of the composition provided. Suitable pharmaceutically acceptable excipients are well known to persons skilled in the art and are described, for example, in the Handbook of Pharmaceutical Excipients, Sixth edition, Pharmaceutical Press, edited by Rowe, Ray C; Sheskey, Paul J; Quinn, Marian. Pharmaceutically acceptable excipients may function as, for example, adjuvants, diluents, carriers, stabilisers, flavourings, colorants, fillers, binders, disintegrants, lubricants, glidants, thickening agents and coating agents. As persons skilled in the art will appreciate, certain pharmaceutically acceptable excipients may serve more than one function and may serve alternative functions depending on how much of the excipient is present in the composition and what other excipients are present in the composition.

    [0178] The pharmaceutical compositions may be in a form suitable for oral use (for example as tablets, lozenges, hard or soft capsules, aqueous or oily suspensions, emulsions, dispersible powders or granules, syrups or elixirs), for topical use (for example as creams, ointments, gels, or aqueous or oily solutions or suspensions), for administration by inhalation (for example as a finely divided powder or a liquid aerosol), for administration by insufflation (for example as a finely divided powder) or for parenteral administration (for example as a sterile aqueous or oily solution for intravenous, subcutaneous or intramuscular dosing), or as a suppository for rectal dosing. The compositions may be obtained by conventional procedures well known in the art. Compositions intended for oral use may contain additional components, for example, one or more colouring, sweetening, flavouring and/or preservative agents.

    [0179] Suitable daily doses of the compounds disclosed herein, or a pharmaceutically acceptable salt thereof, in therapeutic treatment of humans are about 0.0001-100 mg/kg body weight. Pharmaceutical formulations as described herein may be formulated by methods known to those skilled in the art to provide doses of the active compound in the range of 0.1 mg to 1000 mg. The daily dose will necessarily be varied depending upon the host treated, the particular route of administration, any therapies being co-administered, and the severity of the illness being treated. Accordingly, the practitioner who is treating any particular patient may determine the optimum dosage.

    [0180] The pharmaceutical compositions described herein comprise compounds of Formula (I), or a pharmaceutically acceptable salt thereof, and are therefore expected to be useful in therapy.

    [0181] As such, in one embodiment there is provided a pharmaceutical composition for use in therapy, comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.

    [0182] In one embodiment there is provided a pharmaceutical composition for use in the treatment of a disease in which inhibition of PCSK9 is beneficial, comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient. In one embodiment there is provided a pharmaceutical composition for use in the treatment of a cardiovascular disease, comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient. In one embodiment there is provided a pharmaceutical composition for use in the treatment of a cardiovascular disease in which inhibition of PCSK9 is beneficial, comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.

    Methods of Use

    [0183] The compounds described herein may be used in a method of therapy. Also provided is a method of treatment, comprising administering to a subject in need of treatment a therapeutically effective amount of a compound of formula I. The term therapeutically effective amount is an amount sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage, is within the responsibility of general practitioners and other medical doctors.

    [0184] A compound may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.

    [0185] In one embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising the compound of Formula (I) for use in therapy. In one embodiment there is provided the use of the compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising the compound of Formula (I) for the manufacture of a medicament. In another embodiment there is provided a method of treatment comprising administering to a subject the compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising the compound of Formula (I).

    [0186] The compounds described herein are PCSK9 inhibitors. The PCSK9 gene was identified using genetic mapping techniques on DNA from subjects with autosomal dominant hypercholesterolemia (Abifadel 2003). The encoded protein is a serine protease that is mostly expressed in the liver, gut, kidney, and nervous system and circulates in plasma. While not wishing to be bound by any particular theory, studies on mutations in the gene indicated that its putative role was in reducing LDLRs at the cell surface independently of its catalytic activity. (Abifadel 2010). Binding of PCSK9 to the LDLR results in their lysosomal degradation. This enhanced LDLR degradation results in increases in the amount of circulating low-density lipoprotein (LDL). PCSK9 is upregulated by statins, SREBP-1a and SREBP-2, LXR agonist, and insulin, but downregulated by dietary cholesterol, glucagon, ethinylestradiol, chenodeoxycholic acid and the bile acid-activated farnesoid X receptor (FXR) (Maxwell 2003; Persson 2009; Langhi 2008). Since an elevated level of PCSK9 decreases the abundance of LDLR on the cell surface, increasing doses of statins fail to achieve proportional LDL-C lowering results. Thus, disclosed herein are methods for treating a wide range of cardiovascular diseases and conditions that benefit from inhibiting PCSK9 thereby lowering LDL-C.

    [0187] In certain embodiments, the method of inhibiting PCSK9 occurs in a subject in need thereof, thereby treating a disease or disorder mediated by PCSK9. Also, disclosed herein are methods of treating or preventing a disease or a disorder mediated by PCSK9 comprising administering a compound of Formula (I) or a pharmaceutically acceptable salt thereof. In certain embodiments, disclosed herein are methods of treating a disease or a disorder mediated by PCSK9 comprising administering a compound of Formula (I) or a pharmaceutically acceptable salt thereof. In certain embodiments, disclosed herein are methods of preventing a disease or a disorder mediated by PCSK9 comprising administering a compound of Formula (I) or a pharmaceutically acceptable salt thereof. The prevention of cardiovascular events through the inhibition of PCSK9 has been described, e.g., in Robinson 2015.

    [0188] In some embodiments there is provided a method of treating a cardiovascular disease comprising administering to a subject a compound of Formula (I), or a pharmaceutical composition comprising a compound of Formula (I). In some embodiments there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising a compound of Formula (I) for use in the treatment of a cardiovascular disease. In some embodiments there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition comprising a compound of Formula (I) for the manufacture of a medicament for the treatment of a cardiovascular disease.

    [0189] Exemplary cardiovascular diseases and conditions include, but are not limited to, dyslipidemia, hypercholesterolemia, hypertriglyceridemia, hyperlipidemia, hypoalphalipoproteinemia, metabolic syndrome, diabetic complications, atherosclerosis, stroke, vascular dimensia, chronic kidney disease, coronary heart disease, coronary artery disease, retinopathy, inflammation, thrombosis, peripheral vascular disease, heart failure or congestive heart failure. In certain embodiments, exemplary cardiovascular diseases and conditions include, but are not limited to, hypercholesterolemia, hyperlipidemia, hyperlipoproteinemia, hypertriglyceridemia, dyslipidemia, dyslipoproteinemia, atherosclerosis, hepatic steatosis, metabolic syndrome and coronary artery disease. In certain embodiments, the disease is hypercholesterolemia, such as familial hypercholesterolemia or autosomal dominant hypercholesterolemia. In certain embodiments, the disease is hyperlipidemia. In certain embodiments, the disease is coronary artery disease.

    [0190] In certain embodiments, the disclosed methods of treatment can decrease high levels of circulating serum cholesterol, such as LDL-C and VLDL-Cholesterol. In addition, the disclosed methods are useful for decreasing circulating serum triglycerides, circulating serum lipoprotein A, circulating serum LDL-C and atherogenic lipoproteins. In certain embodiments, the diseases or conditions treated with the disclosed compounds and compositions include atherosclerosis and atherosclerotic plaque formation. Subjects having a gain-of-function mutation in the PCSK9 gene also benefit with treatment with the disclosed compounds and compositions counteracting the mutation through their inhibition of PCSK9.

    Combination Treatments

    [0191] Disclosed compounds and compositions may be conjointly administered with other therapeutic agents, such as other agents suitable for the treatment of high levels of LDL-C and triglycerides. In certain embodiments, conjointly administering one or more additional therapeutic agents with a compound described herein provides a synergistic effect. In certain embodiments, conjointly administering one or more additional therapeutic agents provides an additive effect.

    [0192] In some embodiments in which a combination therapy is used, the amount of the compound or salt described in this specification and the amount of the other pharmaceutically active agent(s) are, when combined, therapeutically effective to treat a targeted disorder in the animal patient. In this context, the combined amounts are therapeutically effective amounts if they are, when combined, sufficient to reduce or completely alleviate symptoms or other detrimental effects of the disorder; cure the disorder; reverse, completely stop, or slow the progress of the disorder; or reduce the risk of the disorder getting worse. Typically, such amounts may be determined by one skilled in the art by, for example, starting with the dosage range described in this specification for the compound or salt and an approved or otherwise published dosage range(s) of the other pharmaceutically active compound(s).

    [0193] A pharmaceutical composition of the specification may comprise one or more further active ingredients, as appropriate, examples of combinations of a compound of the specification (or a pharmaceutically acceptable salt thereof) and one or more additional active ingredients are described herein.

    [0194] The specification further relates to a combination therapy wherein a compound of the specification, or a pharmaceutically acceptable salt thereof, and a second active ingredient are administered concurrently, sequentially or in admixture, for the treatment of one or more of the conditions listed above. Such a combination may be used in combination with one or more further active ingredients.

    [0195] In one aspect there is provided a combination (for example, for use as a medicament for the treatment of one of the diseases or conditions listed herein, such as a cardiovascular disease) comprising a compound of the specification, or a pharmaceutically acceptable salt thereof, and at least one active ingredient selected from: [0196] i) a statin; [0197] ii) a cholesterol absorption inhibitor; [0198] iii) a SGLT2 inhibitor; [0199] iv) a P2Y12 inhibitor; [0200] v) a citrate lyase inhibitor; and [0201] vi) anti-hypertensive drugs.

    [0202] In a further aspect of the present specification there is provided a pharmaceutical composition (for example, for use as a medicament for the treatment of one of the diseases or conditions listed herein, such as a cardiovascular disease) comprising a compound of the specification, or a pharmaceutically acceptable salt thereof, and at least one active ingredient selected from: [0203] i) a statin; [0204] ii) a cholesterol absorption inhibitor; [0205] iii) a SGLT2 inhibitor; [0206] iv) a P2Y12 inhibitor; [0207] v) citrate lyase inhibitor; [0208] vi) anti-hypertensive drugs.

    [0209] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from a statin, wherein the statin is selected from atorvastatin, Fluvastatin, Lovastatin, Mevastatin, Pitavastatin, Pravastatin, Rosuvastatin or Simvastatin. In another aspect the statin is Rosuvastatin (Crestor).

    [0210] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from a cholesterol absorption inhibitor, wherein the cholesterol absorption inhibitor is selected from Ezetimibe (Ezetrol).

    [0211] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from a SGLT2 inhibitor, wherein the SGLT2 inhibitor is selected from Canagliflozin, Dapagliflozin, Empagliflozin, Ertugliflozin, Ipragliflozin, Luseogliflozin, Remogliflozin etabonate, Sergliflozin etabonate, Sotagliflozin or Tofogliflozin. In some aspects the SGLT2 inhibitor is selected from Dapagliflozin (Farxiga or Forxiga).

    [0212] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from a P2Y12 inhibitor, wherein the P2Y12 inhibitor is selected from Ticagrelor and Clopidogrel (Plavix).

    [0213] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from a citrate lyase inhibitor, wherein the citrate lyase inhibitor is Bempedoic acid (Nexletol).

    [0214] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from Ezetimibe, Rosuvastatin, Dapagliflozin and Ticagrelor. In one embodiment there is one additional active ingredient. In another embodiment there are two additional active ingredients. In one embodiment the additional active ingredient is Ezetimibe, Rosuvastatin, Dapagliflozin or Ticagrelor. In another embodiment the additional two active ingredients are Ezetimibe and Rosuvastatin or Dapagliflozin and Rosuvastatin.

    [0215] In another embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient selected from anti-hypertensive drugs. In some aspects, the antihypertensive drug is selected from Valsartan (Diovan), Metoprolol (Lopressor), HCTZ (Hydrochlorothiazide), Olmesartan (Benicar), Lisinopril (Prinivil, Zestril), Amlodipine besylate (Norvasc), Candesartan, or a calcium channel blocker or a combination thereof. In another aspect there is provided the compound of Formula (I) or a pharmaceutically acceptable salt thereof in combination with: [0216] i) Valsartan; [0217] ii) Metoprolol; [0218] iii) Valsartan and HCTZ; [0219] iv) Olmesartan; [0220] v) Olmesartan and HCTZ; [0221] vi) Lisinopril; [0222] vii) Amlodipine; [0223] viii) Candesartan; [0224] ix) a calcium channel blocker; or [0225] x) HCTZ.

    [0226] In one embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one additional active ingredient for use in the simultaneous, separate or sequential treatment of a cardiovascular disease. In one embodiment there is provided a compound of Formula (I), or a pharmaceutically acceptable salt thereof, for use in the treatment of a cardiovascular disease, where the compound of Formula (I), or a pharmaceutically acceptable salt thereof, is administered simultaneously, separately or sequentially with at least one an additional active substance selected from Ezetimibe, Rosuvastatin, Dapagliflozin and Ticagrelor.

    [0227] In another embodiment there is provided a method of treating a cardiovascular disease in a subject, which comprises administering to said subject a compound of Formula (I) or a pharmaceutically acceptable salt thereof, and simultaneously, separately or sequentially administering at least one additional active substance, wherein the at least one additional active substance is selected from Ezetimibe, Rosuvastatin, Dapagliflozin and Ticagrelor.

    Further Embodiments

    [0228] The following embodiments may apply to all aspects as described above or may relate to a single aspect. The embodiments may be combined together in any combination. [0229] X.sup.1

    [0230] In some embodiments, X.sup.1 is N. [0231] R.sup.A2

    [0232] In some embodiments R.sup.A2 is selected from the group consisting of: [0233] (i) H; [0234] (ii) halo; [0235] (iii) CN; [0236] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [0237] (v) C.sub.1-6 alkoxy, optionally substituted by OH, alkyl amido, or one or more halo groups; [0238] (vi) C.sub.1-6 acyl amido (where acyl substituent is H or Me); [0239] (vii) C.sub.1-6 thioalkyl, [0240] (viii) C.sub.1-6 alkyl ester; [0241] (ix) C.sub.1-6 alkyl acyl, [0242] (x) C.sub.4-5 heterocyclyl; [0243] (xi) C.sub.5 heteroaryl; [0244] (xii) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3alkyl amido, CN, OH, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; [0245] (xiii) OH; and [0246] (xiv) C.sub.1-6 alkylamino.

    [0247] In some embodiments R.sup.A2 is selected from the group consisting of: [0248] (i) H; [0249] (ii) halo; [0250] (iii) CN; [0251] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [0252] (v) C.sub.1-6 alkoxy, optionally substituted by OH, alkyl amido, or one or more halo groups; [0253] (vi) C.sub.1-6 acyl amido (where acyl substituent is H or Me); [0254] (vii) C.sub.1-6 thioalkyl, [0255] (viii) C.sub.1-6 alkyl ester; [0256] (ix) C.sub.1-6 alkyl acyl, [0257] (x) C.sub.4-5 heterocyclyl; [0258] (xi) C.sub.5heteroaryl; [0259] (xii) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; and [0260] (xiii) OH.

    [0261] In some embodiments R.sup.A2 is selected from the group consisting of: [0262] (i) H; [0263] (ii) halo; [0264] (iii) CN; [0265] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6acyl, C.sub.1-6alkoxy or one or more halo groups; [0266] (v) OH; [0267] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, C.sub.1-6 alkyl amido, or one or more halo groups; [0268] (vii) C.sub.1-6 alkyl ester; [0269] (viii) C.sub.1-6 alkyl acyl; [0270] (ix) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; and [0271] (x) C.sub.1-6 alkylamino

    [0272] In further embodiments R.sup.A2 is selected from the group consisting of: [0273] (i) H; [0274] (ii) halo; [0275] (iii) CN; [0276] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6alkoxy or one or more halo groups; [0277] (v) OH; [0278] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, C.sub.1-6 alkyl amido, or one or more halo groups; [0279] (vii) C.sub.1-6 alkyl ester; [0280] (viii) C.sub.1-6 alkyl acyl; and [0281] (ix) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups.

    [0282] In further embodiments R.sup.A2 is selected from the group consisting of: [0283] (i) H; [0284] (ii) halo; [0285] (iii) CN; [0286] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [0287] (v) C.sub.1-6 alkoxy, optionally substituted by OH, C.sub.1-6 alkyl amido, or one or more halo groups; [0288] (vi) C.sub.1-6 thioalkyl; [0289] (viii) C.sub.1-6 alkyl ester; and [0290] (ix) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3alkyl which alkyl is optionally substituted with one or more halo or OH groups.

    [0291] In further embodiments R.sup.A2 is selected from the group consisting of: [0292] (i) H; [0293] (ii) halo; [0294] (iii) C.sub.1-6 alkyl ester; [0295] (iv) C.sub.1-6 hydrocarbon; [0296] (v) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3alkyl which alkyl is optionally substituted with one or more halo or OH groups; [0297] (vi) C.sub.1-6 thioalkyl; [0298] (vii) C.sub.1-6 alkyl acyl; [0299] (viii) C.sub.5 heteroaryl; or [0300] (ix) C.sub.1-6 alkylamino.

    [0301] When R.sup.A2 is halo, in some embodiments it is Br or Cl. In further embodiments it is Cl.

    [0302] In some embodiments R.sup.A2 is selected from CN, Cl, OMe, methyl, cyclopropyl, OCHF.sub.2, OCF.sub.3 and optionally substituted C.sub.1-6 alkylamido.

    [0303] In some embodiments R.sup.A2 is selected from C.sub.1-6alkyl ester,

    [0304] In some embodiments R.sup.A2 is CN.

    [0305] In some embodiments R.sup.A2 is H.

    [0306] In some embodiments R.sup.A2 is OH.

    [0307] In some embodiments R.sup.A2 is C(?O)CH.sub.3.

    [0308] In some embodiments R.sup.A2 is OCHF.sub.2.

    [0309] In some embodiments R.sup.A2 is cyclopropyl.

    [0310] In some embodiments R.sup.A2 is Cl.

    [0311] In some embodiments R.sup.A2 is methyl.

    [0312] In some embodiments R.sup.A2 is S-ethyl.

    [0313] In some embodiments R.sup.A2 is a pyrazole.

    [0314] In some embodiments R.sup.A2 is N(CH.sub.3).sub.2.

    [0315] In some embodiments R.sup.A2 is C(?O)NH(CH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2C?CH, C(?O)NH(oxetane), C(?O)NH(CH.sub.2CHF.sub.2), C(?O)NH(CH.sub.2CH.sub.3), C(?O)NH.sub.2, C(?O)NH(CH.sub.2), C(?O)N(CH.sub.3).sub.2, C(?O)N(CH.sub.3)(CH.sub.2CH.sub.2OH), C(?O)N(CH.sub.3)(CH.sub.2C?CH or C(?O)NH(CH.sub.2CH.sub.2OH).

    [0316] When R.sup.A2 is a C.sub.1-6 hydrocarbon it is an optionally substituted C.sub.1-6 alkyl. In some embodiments it is optionally substituted methyl, optionally substituted ethyl or optionally substituted cyclopropyl.

    [0317] In further embodiments, it is optionally substituted methyl. In further embodiments, it is unsubstituted methyl. In other embodiments it is unsubstituted cyclopropyl.

    [0318] When R.sup.A2 is optionally substituted C.sub.1-6 alkyl, in some embodiments the optional substituents are selected from OH, CN, or one or more halo groups. In further embodiments the optional substituents are selected from OH, F and Br.

    [0319] When R.sup.A2 is optionally substituted C.sub.1-6alkoxy, in some embodiments it is optionally substituted OMe or ethoxy.

    [0320] When R.sup.A2 is optionally substituted C.sub.1-6 alkoxy, in some embodiments the optional substituents are selected from alkyl amido or one or more halo groups. In another embodiment the optional substituents are selected from one or more F. In another embodiment where R.sup.A2 is optionally substituted C.sub.1-6alkoxy it is difluoromethoxy (OCHF.sub.2).

    [0321] When R.sup.A2 is C.sub.1-6 alkyl ester, in some embodiments it is C(?O)OCH.sub.2CH.sub.3.

    [0322] When R.sup.A2 is C.sub.1-6 alkyl amido, in some embodiments the optional substituents are selected from one or more methyl groups, an oxetane ring, a C.sub.2alkylamido, ethyl which ethyl is optionally substituted by OH or one or more halo groups. In other embodiments when R.sup.A2 is C.sub.1-6 alkyl amido it is C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2. When R.sup.A2 is C.sub.1-6 alkyl amido, in some embodiments the optional substituent is OH.

    [0323] When R.sup.A2 is C.sub.1-6 alkylamino in some embodiments it is NHCH.sub.3, NHC(CH.sub.3).sub.2, N(CH.sub.2CH.sub.3).sub.2, or N(CH.sub.3).sub.2. In some embodiments when R.sup.A is C.sub.1-6 alkylamino it is N(CH.sub.3).sub.2.

    [0324] In other embodiments R.sup.A2 is selected from OCHF.sub.2, Cl, OMe, methyl, C(?O)CH.sub.3, CN, CH.sub.2OH, H and cyclopropyl. In further embodiments R.sup.A2 is selected from methyl, OCHF.sub.2, Cl, CH.sub.2OH, H, CN, C(?O)CH.sub.3 or OMe.

    [0325] In further embodiments R.sup.A2 is selected from methyl, OCHF.sub.2, Cl and cyclopropyl.

    [0326] In further embodiments R.sup.A2 is selected from H, COOH, CH.sub.2OH, methyl, CN, cyclopropyl, C(?O)CH.sub.3, OCHF.sub.2, Cl, C(?O)OCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3.

    [0327] In some embodiments R.sup.A2 is selected from the group consisting of CN, methyl, Cl, C(?O)CH.sub.3, C(?O)OCH.sub.2CH.sub.3, cyclopropyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, OCHF.sub.2, H, OMe, and OCF.sub.3.

    [0328] In some embodiments R.sup.A2 is selected from C(?O)OCH.sub.2CH.sub.3, cyclopropyl, methyl, C(?O)NH(CH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2C?CH, C(?O)NH(oxetane), C(?O)NH(CH.sub.2CHF.sub.2), C(?O)NH(CH.sub.2CH.sub.3), C(?O)NH.sub.2, C(?O)NH(CH.sub.3), C(?O)N(CH.sub.3).sub.2, H, C(?O)N(CH.sub.3)(CH.sub.2CH.sub.2OH), C(?O)N(CH.sub.3)(CH.sub.2C?CH, Cl, N(CH.sub.3).sub.2, pyrazole, S-ethyl, C(?O)CH.sub.3, or C(?O)NH(CH.sub.2CH.sub.2OH). In some embodiments R.sup.12 is selected from ON, methyl, Cl, C(?O)CH.sub.3, C(C?O)OCH.sub.2CH.sub.3, cyclopropyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, OCHF.sub.2, H, OMe, OCF.sub.3. These groups are as shown in the table below:

    TABLE-US-00004 [00057]embedded image [00058]embedded image [00059]embedded image [00060]embedded image [00061]embedded image [00062]embedded image [00063]embedded image [00064]embedded image [00065]embedded image [00066]embedded image [00067]embedded image [00068]embedded image [00069]embedded image [00070]embedded image [00071]embedded image [00072]embedded image [00073]embedded image [00074]embedded image

    [0329] In some embodiments R.sup.A2 is selected from the following groups:

    In some embodiments R.sup.A2 is selected from the following groups:

    ##STR00075## [0330] R.sup.A3

    [0331] In some embodiments R.sup.A3 is selected from the group consisting of: [0332] (i) H; [0333] (ii) halo; [0334] (iii) CN; [0335] (iv) C.sub.1-6hydrocarbon optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl, C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkyl ester, C.sub.1-6 alkylamino, C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkyl acylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [0336] (v) OH; [0337] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups; [0338] (vii) C.sub.1-6 acyloxy; [0339] (viii) C.sub.4 heterocycyl; [0340] (ix) NH.sub.2; [0341] (x) C.sub.1-6 alkylamino, optionally substituted by CN, OH or C.sub.4heterocyclyl; [0342] (xi) C.sub.1-6 dialkylamino, optionally substituted by NH.sub.2; [0343] (xii) C.sub.1-6 acylamido (where acyl substituent is H or Me); [0344] (xiii) carbaimidoyl or methyl-carbaimidoyl; [0345] (xiv) carboxyamino; [0346] (xv) C.sub.1-6 thioalkyl, optionally substituted by OH or NH.sub.2; [0347] (xvi) C.sub.1-6 alkyl sulfinyl; [0348] (xvi) C.sub.1-6 alkyl sulfonyl, optionally substituted by one or more halo groups; [0349] (xvii) C.sub.1-6 sulfonimodyl; [0350] (xviii) C.sub.1-6 alkyl phosphinyl; [0351] (xix) carboxy; [0352] (xx) C(?O)NH.sub.2 [0353] (xxi) C.sub.1-6 alkyl ester; [0354] (xxii) C.sub.1-6 alkyl acyl, optionally substituted by one or more halo groups; and [0355] (xxiii) C.sub.1-6 alkyl amido.

    [0356] In some embodiments R.sup.A3 is selected from the group consisting of: [0357] (i) H; [0358] (ii) halo; [0359] (iii) CN; [0360] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkylester, C.sub.1-6 alkylamino; C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkylacylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [0361] (v) OH; and [0362] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups.

    [0363] In some embodiments R.sup.A3 is selected from the group consisting of: [0364] (i) H; [0365] (ii) halo; [0366] (iii) CN; [0367] (iv) C.sub.1-6hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkylester, C.sub.1-6 alkylamino; C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkylacylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [0368] (v) OH; [0369] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups.

    [0370] Where R.sup.A3 is halo, in some embodiments it is Br or Cl. In some embodiments it is Cl. In further embodiments R.sup.A3 is Br.

    [0371] Where R.sup.A3 is a C.sub.1-6hydrocarbon it is an optionally substituted C.sub.1-6 alkyl. In some embodiments it is optionally substituted methyl or optionally substituted ethyl. In further embodiments, it is optionally substituted methyl. In further embodiments, it is unsubstituted methyl.

    [0372] When R.sup.A3 is optionally substituted C.sub.1-6 alkyl, in some embodiments the optionally substituents are selected from OH, CN, or one or more halo groups. In further embodiments the optional substituents are selected from OH, F and Br.

    [0373] In some embodiments R.sup.A3 is OH.

    [0374] When R.sup.A3 is optionally substituted C.sub.1-alkoxy, in some embodiments it is optionally substituted OMe or ethoxy. In further embodiments it is OMe.

    [0375] When R.sup.A3 is optionally substituted C.sub.1-alkoxy, in some embodiments the optional substituents are selected from alkyl amido or one or more halo groups. In another embodiment the optional substituents are selected from one or more F.

    [0376] In some embodiments R.sup.A3 is selected from H, CF.sub.3, CN, C.sub.1-2alkyl, NH.sub.2 and halo. In other embodiments R.sup.A3 is selected from H, methyl, CN and Cl.

    [0377] In some embodiments R.sup.A3 is selected from H, OMe, CF.sub.3, CN, C.sub.1-2alkyl, NH.sub.2 and halo.

    [0378] In some embodiments R.sup.A3 is CN.

    [0379] In some embodiments R.sup.A3 is H.

    [0380] In some embodiments R.sup.A3 is methyl.

    [0381] In some embodiments R.sup.A3 is OMe. In some embodiments R.sup.A3 is selected from methyl, H and CN.

    [0382] In some embodiments R.sup.A3 is selected from H, methyl or OH.

    R.sup.A2 and R.sup.A3

    [0383] When R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C carboaromatic ring or C.sub.5-7 heteroaromatic ring they form an optionally substituted benzene ring or an optionally substituted pyridine ring.

    [0384] When R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C carboaromatic ring or C.sub.5-7 heteroaromatic ring the optional substituents are selected from NH.sub.2, C.sub.1-6 alkyl, C.sub.1-6 alkoxy and halo. In other embodiments the optional substituents are selected from methyl, ethyl, OMe, NH.sub.2, F, Cl and Br. In other embodiments the optional substituents are selected from methyl, NH.sub.2, Cl, F and OMe. In other embodiments the optional substituent is methyl.

    [0385] In one embodiment when R.sup.A2 and R.sup.A3 together with the carbon atoms to which they are bound form an optionally substituted C.sub.5-7 heteroaromatic ring, they form an optionally substituted pyridine. In some embodiments the optional substituent is NH.sub.2. In another embodiment R.sup.A2 and R.sup.A3 together with the carbon atoms to which they are bound form an unsubstituted pyridine. In another embodiment R.sup.A2 and R.sup.A3 together form an optionally substituted pyrazole, an optionally substituted pyrrole or an optionally substituted thiazole. In some embodiments the optional substituent is methyl.

    [0386] When R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C.sub.5-7 heteroaromatic ring, the optional substituents are selected from C.sub.1-6 alkyl, C.sub.1-6 alkoxy, NH.sub.2 and halo. In other embodiments the optional substituents are selected from methyl, ethyl, OMe, ethoxy, NH.sub.2 and halo. In other embodiments the optional substituents are selected from NH.sub.2 and methyl.

    [0387] When R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C.sub.5-7 heterocycle ring, they form a 5 membered ring which comprises one or two atoms selected from N, O and S. In some embodiments the 5 membered ring contains one N and one S. In other embodiments the 5 membered ring contains one N. In other embodiments the 5 membered ring contains one N and one O. In other embodiments the 5 membered ring contains two Ns. In some embodiments R.sup.A3 and R.sup.A together with the carbon atoms to which they are bound form an optionally substituted pyrrole or pyrazole.

    [0388] When R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C.sub.5-7 heterocycle ring, the optional substituents are selected from NH.sub.2, C.sub.1-6alkyl, C.sub.1-6alkoxy and halo. In other embodiments the optional substituents are selected from methyl, ethyl, OMe, ethoxy, NH.sub.2, F, Cl and Br. In other embodiments the optional substituent is methyl.

    [0389] In other embodiments R.sup.A2 and R.sup.A3 together with the carbon atoms to which they are bound form: [0390] (i) optionally substituted C.sub.6 heteroaromatic ring; wherein the optional substituent is NH.sub.2; [0391] (ii) optionally substituted C.sub.6 carboaromatic ring; wherein the optional substituent is F, OMe, Cl; [0392] (iii) optionally substituted C.sub.5 heteroaromatic or C.sub.5 heterocycle ring wherein the optional substituent is methyl.

    [0393] In some embodiments R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C carboaromatic ring or C.sub.5-7 heteroaromatic ring wherein the optional substituents are selected from C.sub.1-6alkyl, and halo.

    [0394] In some embodiments R.sup.A2 and R.sup.A3 together form an unsubstituted 2-pyrazole, a 2-pyrrole substituted by methyl, pyridine optionally substituted by NH.sub.2, or a phenyl optionally substituted by Cl, F or OMe.

    [0395] In some embodiments R.sup.A2 and R.sup.A3 together form a ring selected from:

    ##STR00076##

    B

    [0396] In some embodiments B is of formula (B-1):

    ##STR00077##

    wherein the wavy lines indicate the point of attachment to A and C; wherein R.sup.B1 is H, OH, OMe, O-Ethyl, CH.sub.2OH, CH.sub.2CH.sub.2OH or ?CHCH.sub.2OH.

    [0397] In other embodiments R.sup.B1 is H, CH.sub.2OH, CH.sub.2CH.sub.2OH or ?CHCH.sub.2OH.

    [0398] In other embodiments R.sup.B1 is CH.sub.2OH, CH.sub.2CH.sub.2OH or ?CHCH.sub.2OH.

    [0399] In other embodiments R.sup.B1 is H.

    [0400] In another embodiment B is of the formula (B-1a):

    ##STR00078##

    [0401] In further embodiments B is of the formula (B-1b):

    ##STR00079##

    [0402] Therefore in some embodiments the compounds of Formula (I) is the S,S-enantiomer.

    [0403] In some embodiments B is of formula (B-2):

    ##STR00080##

    wherein the wavy line indicates the point of attachment to A and C; R.sup.B2 is C.sub.1-2 alkyl-OH, CH.sub.2CONHMe or C.sub.1-3 alkyl.

    [0404] In some of these embodiments, R.sup.B2 is C.sub.1-2 alkyl-OH, or C.sub.1-3 alkyl In some embodiments when B is of the formula (B-2) it is of the following formula (B-2a) wherein the wavy line indicates the point of attachment to A and C; and R.sup.B2 is C.sub.1-2alkyl-OH, CH.sub.2CONHMe or C.sub.1-2alkyl;

    ##STR00081##

    [0405] In some embodiments B is of the following formula:

    ##STR00082##

    [0406] In further embodiments B is of the following formula:

    ##STR00083##

    C

    [0407] C is selected from the group consisting of C.sub.6 10 carboaryl, C.sub.5-6 heteroaryl and C.sub.5-10 heterocyclyl, which groups are optionally substituted by: [0408] (i) C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl C.sub.4-10 heterocyclyl, or C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12heterocyclyl or a spiro C.sub.6-12carbocyclyl, which are themselves optionally substituted by one or more of the following groups: [0409] a) one or two ?O groups; [0410] b) one or more halo groups; [0411] c) CN, NH.sub.2, OH; [0412] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0413] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0414] f) C.sub.1-6alkylester; [0415] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0416] h) C.sub.5-6 heteroaryl; [0417] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0418] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0419] l) P(?O)Me.sub.2; [0420] m) carboxy or CH.sub.2-carboxy; [0421] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl; [0422] (ii) one or more groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido, and di-C.sub.1-6alkyl sulfonamido.

    [0423] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl, wherein the optional substituents are selected from C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12 heterocyclyl or a spiro C.sub.6-12carbocyclyl, which are themselves optionally substituted by one or more of the following groups: [0424] a) one or two ?O groups; [0425] b) one or more halo groups; [0426] c) CN, NH.sub.2 or OH; [0427] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0428] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0429] f) C.sub.1-6 alkylester; [0430] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0431] h) C.sub.5-6 heteroaryl; [0432] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0433] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0434] l) P(?O)Me.sub.2; [0435] m) carboxy or CH.sub.2-carboxy; and/or [0436] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [0437] When C is an optionally substituted C.sub.5-6 heteroaryl in some embodiments it is an optionally substituted C.sub.6heteroaryl. In other embodiments it is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl. In other embodiments it is an optionally substituted pyridinyl.

    [0438] When C is an optionally substituted C.sub.5-6 heteroaryl it can be optionally substituted by: [0439] (i) C.sub.6-10carboaryl, C.sub.4-10carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, or C.sub.5-10bridged heterocyclyl, spiro C.sub.6-12heterocyclyl or a spiro C.sub.6-12carbocyclyl,
    which are themselves optionally substituted by one or more of the groups selected from: [0440] a) one or two ?O groups; [0441] b) one or more halo groups; [0442] c) CN, NH.sub.2, OH; [0443] d) C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0444] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0445] f) C.sub.1-6alkylester; [0446] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0447] h) C.sub.5-6 heteroaryl; [0448] i) C.sub.4-10carbocyclyl with an optional methyl or ?O substituent; [0449] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0450] l) P(?O)Me.sub.2; [0451] m) carboxy or CH.sub.2-carboxy; and/or [0452] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl; [0453] (ii) one or more groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido and di-C.sub.1-6 alkyl sulfonamido.

    [0454] Where C is substituted by C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, it may bear a number of substituent groups. The substituents are selected from: [0455] a) one or two ?O groups; [0456] b) one or more halo groups, CN, NH.sub.2; [0457] c) one or more C.sub.1-6 alkyl including (CH.sub.3).sub.2, C.sub.1-6 alkoxy, or C.sub.1-alkylester, wherein each is optionally substituted by one or more halo groups; [0458] d) C.sub.5-6 heterocyclyl or C.sub.5-6heteroaryl with an optional methyl substituent; [0459] e) C.sub.6-10carboaryl optionally substituted by one or more halo atoms; [0460] f) P(?O)Me.sub.2; or [0461] g) carboxy or CH.sub.2-carboxy.

    [0462] In some embodiments one substituent of C is at the para position.

    [0463] In some embodiments when C is an optionally substituted C.sub.5-6heteroaryl, the optional substituents are selected from C.sub.1-6alkyl and halo. In further embodiments the optional substituent is methyl. In further embodiments C is substituted by methyl at the meta position.

    [0464] In other embodiments where C is substituted by an optionally substituted C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, it may be substituted by an optionally substituted phenyl, an optionally substituted pyridyl, an optionally substituted imidazolidinyl, an optionally substituted dihydroquinolinyl, an optionally substituted benzimidazolyl or an optionally substituted imidazopyridinyl. These group themselves may be optionally substituted by one or two ?O groups, halo, CN, one or more C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6alkylester, C.sub.5-6 heterocyclyl (with an optional methyl substituent), phenyl substituted by F at the para position, carboxy, CH.sub.2-carboxy, tetrazolyl, pyrazolyl, triazolyl or P(?O)Me.sub.2.

    [0465] In other embodiments when C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl it may bear a number of substituent groups. The substituents are selected from an optionally substituted C.sub.5-10 heteroaryl and C.sub.5-10 heterocyclyl, which are themselves optionally substituted by one or two ?O groups, one or more halo groups, CN, one or more C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1 6alkylester, O.sub.5-6 heterocyclyl (with an optional methyl substituent), phenyl optionally substituted with one or two halo groups, carboxy, CH.sub.2-carboxy, tetrazolyl, pyrazolyl, triazolyl, a pyridine ring, NH.sub.2 or OH. In some embodiments the substituents are an optionally substituted phenyl, an optionally substituted pyridyl, an optionally substituted imidazolidine, an optionally substituted dihydroquinoline, an optionally substituted benzimidazolyl or an optionally substituted imidazopyridinyl.

    [0466] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl wherein the optional substituents are selected from: [0467] i) C.sub.6-10carboaryl, C.sub.5-10 heteroaryl C.sub.5-10 heterocyclyl, which are themselves optionally substituted by one or more of the following groups: [0468] a) one or two ?O groups; [0469] b) one or more halo groups; [0470] c) CN, NH.sub.2, OH; [0471] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0472] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0473] f) C.sub.1-6 alkylester; [0474] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0475] h) C.sub.5-6 heteroaryl; [0476] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0477] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0478] l) P(?O)Me.sub.2; [0479] m) carboxy, CH.sub.2-carboxy; and/or [0480] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl; [0481] ii) one or more groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido and di-C.sub.1-6 alkyl sulfonamido.

    [0482] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl wherein the optional substituents are selected from C.sub.6-10carboaryl, C.sub.5-10 heteroaryl C.sub.5-10 heterocyclyl, which are themselves optionally substituted by one or more groups selected from the following: [0483] a) one or two ?O groups; [0484] b) one or more halo groups; [0485] c) CN, NH.sub.2, OH; [0486] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0487] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0488] f) C.sub.1-6 alkylester; [0489] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0490] h) C.sub.5-6 heteroaryl; [0491] i) C.sub.4-10carbocyclyl with an optional methyl or ?O substituent; [0492] j) C.sub.6-10carboaryl with optional substituents of one or more halo groups; [0493] l) P(?O)Me.sub.2; [0494] m) carboxy, CH.sub.2-carboxy; and/or [0495] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [0496] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl, wherein the optional substituents are selected from C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12heterocyclyl or a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or more of the following groups: [0497] a) one or two ?O groups; [0498] b) one or more halo groups; [0499] c) CN, NH.sub.2 or OH; [0500] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with a substituent selected from OH or one or more halo groups; [0501] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0502] f) C.sub.1-6 alkylester; [0503] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0504] h) C.sub.5-6 heteroaryl; [0505] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0506] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0507] l) P(?O)Me.sub.2; [0508] m) carboxy or CH.sub.2-carboxy; and/or [0509] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [0510] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl, wherein the optional substituents are selected from C.sub.610 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12heterocyclyl or a spiro C.sub.6-12carbocyclyl, which are themselves optionally substituted by one or more of the following groups: [0511] a) one or more halo groups; [0512] b) CN, NH.sub.2 or OH; [0513] c) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0514] d) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0515] e) C.sub.1-6 alkylester; [0516] f) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0517] g) C.sub.5-6 heteroaryl; [0518] h) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0519] i) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0520] j) P(?O)Me.sub.2; [0521] k) carboxy or CH.sub.2-carboxy; and/or [0522] l) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [0523] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl, wherein the optional substituents are selected from C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12heterocyclyl or a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or two ?O groups and substituted with one or more of the following groups: [0524] a) one or more halo groups; [0525] b) CN, NH.sub.2 or OH; [0526] c) one or more C.sub.1-6 alkyl groups including branched and cyclic and with a substituent selected from OH or one or more halo groups; [0527] d) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0528] e) C.sub.1-6 alkylester; [0529] f) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0530] g) C.sub.5-6 heteroaryl; [0531] h) C.sub.4-10 ocarbocyclyl with an optional methyl or ?O substituent; [0532] i) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0533] j) P(?O)Me.sub.2; [0534] k) carboxy or CH.sub.2-carboxy; and/or [0535] l) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [0536] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl wherein the optional substituents are selected from C.sub.6 heteroaryl or C.sub.6 heterocyclyl, which are themselves optionally substituted by one or more groups selected from the following: [0537] i) one or two ?O groups; [0538] ii) methyl; [0539] iii) OMe; [0540] iv) Cl; [0541] v) CN; [0542] vi) CF.sub.3; [0543] vii) F; [0544] viii) pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; [0545] ix) OCF.sub.3; [0546] x) OCHF.sub.2.

    [0547] In some embodiments C is a substituted pyridyl which is substituted by a C.sub.6 heterocyclyl or C.sub.6 heteroaryl, each of which contain either one or two N atoms and are substituted by ?O and another group selected from methyl, Cl, OMe, CN, and OCHF.sub.2.

    [0548] In some embodiments C is a substituted pyridyl which is substituted by a pyridyl which is itself substituted by at least one ?O group and another group selected from CF.sub.3, OCF.sub.3, Cl, CN, OMe, pyrazole optionally substituted by methyl, tetrazole, F, OCHF.sub.2 or triazole.

    [0549] In further embodiments C is an optionally substituted pyridinyl wherein the optional substituents are selected from phenyl and pyridyl which are themselves optionally substituted by methyl or CN.

    [0550] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl wherein the optional substituents are selected from pyridine, pyridazine and pyrimidine which are themselves optionally substituted by one or more groups selected from the following: [0551] a) one or two ?O groups; [0552] b) one or more halo groups; [0553] c) methyl; [0554] d) OMe; [0555] e) CN; or [0556] f) OCHF.sub.2.

    [0557] In some embodiments C is an optionally substituted pyridinyl wherein the optional substituent is phenyl or pyridyl which are themselves optionally substituted by one or more groups selected from the following: [0558] a) one or more OMe groups; [0559] b) one or more F groups; [0560] c) CN; [0561] d) tetrazole; or [0562] e) carboxy.

    [0563] In some embodiments C is an optionally substituted pyridinyl wherein the optional substituent is a C.sub.5 heteroaryl or C.sub.5 heterocyclyl which are themselves optionally substituted by one or more substituents selected from methyl and CN. In some embodiments C is an optionally substituted pyridinyl wherein the optional substituent is a pyrazole, triazole, imidazole or an oxazole which are themselves optionally substituted by one or more substituents selected from methyl and CN.

    [0564] In further embodiments the pyrazole, triazole, imidazole or oxazole are substituted by two methyl groups and optionally one CN group.

    [0565] In some embodiments C is an optionally substituted pyridinyl wherein the optional substituent is an unsubstituted C.sub.9 membered heterocyclyl containing 2 or 3 nitrogen atoms.

    [0566] In another embodiment C is of the formula (C-1):

    ##STR00084##

    wherein D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, which are themselves optionally substituted by ?O, halo, CN, NH.sub.2, OH, one or more C.sub.1-6 alkyl groups, which alkyl is optionally substituted by halo, C.sub.1-6 alkoxy which is optionally substituted by halo, C.sub.1-6alkylester, C.sub.5-6 heterocyclyl (with an optional methyl substituent), carboxy, CH.sub.2-carboxy, P(?O)Me.sub.2, tetrazolyl, pyrazolyl or triazolyl. In some embodiments the optional substituents are selected from ?O, CN, F, Cl, Br, CN, methyl, ethyl, OMe, ethoxy, OCF.sub.3, OMe, CF.sub.3, P(?O)Me.sub.2 and C.sub.1-2 alkyl ester.

    [0567] When C is (C-1) in some embodiments D is an optionally substituted pyridin-2-one. In some embodiments the optional substituents are selected from OMe, C, F, methyl, trifluoromethyl, OCF.sub.3, C(?O)OH (carboxy), CN, pyrazolyl, triazolyl, tetrazolyl, phenyl with an optional F substituent at the para position or piperazinyl with a methyl substituent. In some embodiments the pyridine-2-one is unsubstituted. In some embodiments the pyridin-2-one is pyridin-2(1H-one.

    [0568] When C is (C-1), in some embodiments D is an optionally substituted 6 membered heteroaryl which contains one or two N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position and the other optional substituents are selected from methyl, OMe, piperazine substituted by methyl, C(?O)OH (carboxy), Cl, phenyl substituted by fluoro, CN, CF.sub.3, F, pyrazolyl, triazolyl, tetrazolyl, or OCF.sub.3.

    [0569] In some embodiments C is of the formula (C-1):

    ##STR00085##

    wherein D is C.sub.6-10carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, each of which are themselves optionally substituted by: [0570] i) one or two ?O groups; [0571] ii) one or two C.sub.1-4 alkyl groups which can be branched; [0572] iii) OMe; [0573] iv) piperazinyl, optionally substituted by methyl; [0574] v) C(?O)OH (carboxy); [0575] vi) Cl; [0576] vii) F; [0577] viii) phenyl, optionally substituted by one or more fluoro; [0578] ix) CN; [0579] x) CF.sub.3; [0580] xi) OCF.sub.3; [0581] xii) tetrazolyl, pyrazolyl, triazolyl each of which is optionally substituted by methyl; [0582] xiii) NH.sub.2; [0583] xiv) pyridinyl; [0584] xv) CH.sub.2OH; [0585] xvi) OH; [0586] xvii) P(?O)Me.sub.2; or [0587] xviii) OCHF.sub.2.

    [0588] In some embodiments C is of the formula (C-1):

    ##STR00086##

    wherein D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, each of which are themselves optionally substituted by: [0589] i) one or two ?O groups; [0590] ii) one or two C.sub.1-4 alkyl groups which can be branched; [0591] i) OMe; [0592] ii) piperazinyl, optionally substituted by methyl; [0593] iii) C(?O)OH (carboxy); [0594] iv) Cl; [0595] v) F; [0596] vi) phenyl, optionally substituted by one or more fluoro; [0597] vii) CN; [0598] viii) CF.sub.3; [0599] ix) OCF.sub.3; [0600] x) OMe; [0601] xi) tetrazolyl, pyrazolyl, triazolyl; [0602] xii) NH.sub.2; [0603] xiii) (CH.sub.3).sub.2; [0604] xiv) pyridinyl; [0605] xv) CH.sub.2OH; [0606] xvi) OH; or [0607] xvii) P(?O)Me.sub.2.

    [0608] In some embodiments D is an optionally substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position, wherein the optional substituents are selected from: [0609] i) methyl; [0610] ii) OMe; [0611] iii) piperazinyl substituted by methyl; [0612] iv) C(?O)OH (carboxy); [0613] v) C; [0614] vi) phenyl substituted by fluoro; [0615] vii) CN; [0616] viii) CF.sub.3; [0617] ix) OCF.sub.3; [0618] x) F; or [0619] xi) pyrazolyl, triazolyl or tetrazolyl.

    [0620] In some embodiments when C is (C-1), D is an optionally substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position wherein the optional substituents are selected from: [0621] i) methyl; [0622] ii) OMe; [0623] iii) piperazinyl substituted by methyl; [0624] iv) C(?O)OH (carboxy); [0625] v) Cl; [0626] vi) F; [0627] vii) phenyl substituted by fluoro; [0628] viii) CN; [0629] ix) CF.sub.3; [0630] x) OCF.sub.3; [0631] xi) OCHF.sub.2; [0632] xii) pyrazole, triazole, tetrazole each of which is optionally substituted by methyl.

    [0633] In some embodiments D is an optionally substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position, wherein the optional substituents are selected from: [0634] i) methyl; [0635] ii) OMe; [0636] iii) Cl; [0637] iv) F; [0638] v) CN; [0639] vi) CF.sub.3; [0640] vii) OCF.sub.3; [0641] viii) OCHF.sub.2; or [0642] ix) pyrazolyl, triazolyl or tetrazolyl each of which is optionally substituted by methyl.

    [0643] In some embodiments D is a substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position, wherein the substituents are selected from: [0644] i) OMe; [0645] ii) Cl; [0646] iii) F; [0647] iv) CN; [0648] v) CF.sub.3; [0649] vi) OCF.sub.3; [0650] vii) OCHF.sub.2; or [0651] viii) pyrazolyl, triazolyl or tetrazolyl each of which is optionally substituted by methyl.

    [0652] In some embodiments C is of the formula (C-1) wherein D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, each of which are themselves optionally substituted by: [0653] i) one or two ?O groups; [0654] ii) one or two C.sub.1-4 alkyl groups which can be branched and optionally substituted by one or more halo groups; [0655] iii) one or more OMe groups; [0656] iv) C(?O)OH (carboxy); [0657] v) halo; [0658] vi) CN; [0659] vii) C.sub.1-4 alkoxy optionally substituted by one or more halo groups; [0660] viii) tetrazolyl, pyrazolyl, triazolyl wherein each is optionally substituted by methyl; [0661] ix) P(?O)Me.sub.2.

    [0662] In some embodiments C is of the formula (C-1) and D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or CO.sub.5-10 heterocyclyl, each of which are themselves optionally substituted by: one or two ?O groups; methyl, CF.sub.3; OCF.sub.3; Cl, CN, OMe, pyrazole optionally substituted by methyl, tetrazole, F, OCHF.sub.2, triazole, C(?O)OH, P(?O)Me.sub.2.

    [0663] In some embodiments D is optionally substituted by 1, 2 or 3 substituents,

    [0664] In some embodiments D is optionally substituted by 1 substituent,

    [0665] In some embodiments D is optionally substituted by 2 or 3 substituents,

    [0666] In some embodiments when C is (C-1), D is an optionally substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position wherein the optional substituents are selected from: [0667] i) methyl; [0668] ii) OMe; [0669] iii) piperazinyl substituted by methyl; [0670] iv) C(?O)OH (carboxy); [0671] v) Cl; [0672] vi) F; [0673] vii) phenyl substituted by fluoro; [0674] viii) CN; [0675] ix) CF.sub.3; [0676] x) OCF.sub.3; [0677] xi) pyrazole optionally substituted by methyl, triazole, tetrazole.

    [0678] In some embodiments C is of the formula (C-1) and D is an optionally substituted phenyl or piperidyl wherein there are one or two optional substituents selected from F, OMe and CN. In some embodiments C is of the formula (C-1) and D is an optionally substituted phenyl or pyridyl wherein there are one or two optional substituents selected from F, OMe and CN.

    [0679] In some embodiments D is an optionally substituted C.sub.5 heterocyclyl or C.sub.5 heteroaryl, wherein the optional substituents are selected from methyl and CN. In further embodiments D is an optionally substituted pyrazole, imidazole, triazole or oxazole wherein the optional substituents are selected from methyl and CN. In further embodiments D is a triazole substituted with two methyl groups. In further embodiments D is a pyrazole substituted by two methyl groups. In further embodiments D is an imidazole substituted by two methyl groups and CN. In further embodiments D is an oxazole substituted by two methyl groups.

    [0680] In some embodiments D is a C.sub.9 heterocyclyl or C.sub.9 heteroaryl comprising 2 or 3 nitrogen atoms.

    [0681] In further embodiments D is 1H-pyrazolo[3,4-b]pyridiyl, indazol-1-yl or indazol-2-yl.

    [0682] In some embodiments D is optionally substituted by 1, 2 or 3 substituents.

    [0683] In another embodiment D is of the formula (D-1):

    ##STR00087##

    wherein one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from a C.sub.1-6 alkyl optionally substituted by one or more halo groups; C.sub.1-6 alkoxy optionally substituted by one or more halo groups, C.sub.5-6 heterocyclyl or C.sub.5-6heteroaryl with an optional methyl substituent, carboxy, ?O, halo, NH.sub.2, CN, or phenyl optionally substituted by one or more halo atoms; or wherein R.sup.D3 and R.sup.D4 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring wherein the optional substituents are selected from OH, methyl, OMe, halo, CN, P(?O)Me.sub.2 and C(?O)OH;
    or wherein R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are all H.

    [0684] In another embodiment one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from C.sub.1-6 alkyl optionally substituted by one or more halo groups, C.sub.1-6 alkoxy optionally substituted by one or more halo groups, C.sub.5-6 heterocyclyl or C.sub.5-6heteroaryl with an optional methyl substituent, carboxy halo, CN, or phenyl optionally substituted by one or more halo atoms, and the rest are H.

    [0685] In some embodiments D is of the formula (D-1) and one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from: [0686] i) methyl; [0687] ii) OMe; [0688] iii) piperazine substituted by methyl; [0689] iv) C(?O)OH (carboxy); [0690] v) Cl; [0691] vi) phenyl substituted by fluoro; [0692] vii) CN; [0693] viii) CF.sub.3; [0694] ix) F; [0695] x) pyrazolyl, triazolyl, tetrazolyl; [0696] xi) OCF.sub.3 [0697] and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [0698] In some embodiments D is of the formula (D-1) and one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from: [0699] i) methyl; [0700] ii) OMe; [0701] iii) C; [0702] iv) CN; [0703] v) CF.sub.3; [0704] vi) F; [0705] vii) pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; [0706] viii) OCF.sub.3 [0707] ix) OCHF.sub.2 [0708] and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [0709] In another embodiment one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from methyl, OMe, halo, C(?O)OH, CN, CF.sub.3, OCF.sub.3, OCHF.sub.2 and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [0710] In one embodiment all of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [0711] In another embodiment R.sup.D3 is selected from H, optionally substituted phenyl (wherein the optional substituent is halo), methyl, OMe, C(?O)OH, OCHF.sub.2, Cl, CN and piperazinyl optionally substituted by methyl wherein R.sup.D1, R.sup.D2 and R.sup.D4 are all H. In some embodiments R.sup.D3 is selected from H, CN, OMe, Cl, pyrazole optionally substituted by methyl, tetrazole, methyl, OCHF.sub.2, or triazole and wherein R.sup.D1, R.sup.D2 and R.sup.D4 are all H. In some embodiments R.sup.D3 is selected from H, CN, OMe, Cl, pyrazole, tetrazole, methyl, OCHF.sub.2, or triazole and wherein R.sup.D1, R.sup.D2 and R.sup.D4 are all H.

    [0712] In some embodiments R.sup.D2 is selected from H, OMe, C and CN and wherein R.sup.D1, R.sup.D3 and R.sup.D4 are all H.

    [0713] In other embodiments R.sup.D1 is selected from H, methyl, OMe, C, CF.sub.3, OCF.sub.3, OCHF.sub.2 and CN and R.sup.D2, R.sup.D3 and R.sup.D4 are all H. In some embodiments R.sup.D1 is selected from H, OMe, C, CF.sub.3, OCF.sub.3, OCHF.sub.2, CN, F, triazole and pyrazole optionally substituted by methyl, and R.sup.D2, R.sup.D3 and R.sup.D4 are all H.

    [0714] In another embodiment R.sup.D3 and R.sup.D4 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring wherein the optional substituents are selected from OH, CN, P(?O)Me.sub.2, methyl, OMe, halo and C(?O)OH.

    [0715] In some embodiments R.sup.D3 and R.sup.D4 form an optionally substituted benzene ring or an optionally substituted pyridine ring.

    [0716] In some embodiments R.sup.D3 and R.sup.D4 form an unsubstituted benzene ring or an unsubstituted pyridine ring.

    [0717] In another embodiment D is of the formula (D-2):

    ##STR00088## [0718] Wherein X.sup.D is NR.sup.D5a or CR.sup.D5aR.sup.D5b; [0719] R.sup.D5a is selected from H or methyl; [0720] either R.sup.D5b and R.sup.D6b are both H or together they are CH.sub.2; [0721] R.sup.D6a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH, wherein when R.sup.D6a is ?O, R.sup.D6b is absent; [0722] R.sup.D7a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH; [0723] R.sup.D7b is H, wherein when R.sup.D7a is ?O, R.sup.D7b is absent; [0724] or wherein R.sup.D6a and R.sup.D7a together form a benzene ring or a C.sub.6 heteroaromatic ring which is optionally substituted by CN, P(?O)Me.sub.2 or carboxy and R.sup.D6b and R.sup.D7b are absent.

    [0725] In some embodiments C is of the formula (C-1) and D is of the formula (D-2) and X.sup.D is N and R.sup.D5a is methyl.

    [0726] In some embodiments C is of the formula (C-1) and D is of the formula (D-2) and R.sup.D6a and R.sup.D6b both H and R.sup.D7a is selected from ?O, CH.sub.2OH or C(?O)OH and R.sup.D7b is H or when R.sup.D7a is O, R.sup.D7b is absent.

    [0727] In some embodiments C is of the formula (C-1) and D is of the formula (D-2) and X.sup.D is N and R.sup.D5a is methyl wherein R.sup.D7a is selected from H and ?O and R.sup.D6a is H and ?O, wherein when R.sup.D7a is ?O, R.sup.D6a and R.sup.D6b are H and R.sup.D7b is absent and wherein R.sup.D6a is ?O, R.sup.D7a and R.sup.D7b are H and R.sup.D6b is absent.

    [0728] In some embodiments C is of the formula (C-1) and D is of the formula (D-2), R.sup.D7a is ?O, and R.sup.D7b is absent, XD is C and R.sup.D5b and R.sup.D6b together are CH.sub.2 and R.sup.D6a and R.sup.D5a are methyl.

    [0729] In another embodiment R.sup.D6a and R.sup.D7a together form a benzene ring or a C.sub.6 heteroaromatic ring which is optionally substituted by CN, P(?O)Me.sub.2 or C(?O)OH, and R.sup.D6b and R.sup.D7b are absent.

    [0730] In some embodiments R.sup.D6a and R.sup.D7a together form a benzene ring or a pyridine ring which is optionally substituted by CN, P(?O)Me.sub.2, or C(?O)OH and R.sup.D6b and R.sup.D7b are absent.

    [0731] In some embodiments R.sup.D6a and R.sup.D7a form an unsubstituted benzene ring and R.sup.D6b and R.sup.D7b are absent. In some embodiments R.sup.D6a and R.sup.D7a form an unsubstituted pyridine ring and R.sup.D6b and R.sup.D7b are absent.

    [0732] In some embodiments X.sup.D is N and R.sup.D5a is H or methyl.

    [0733] In some embodiments X.sup.D is C and R.sup.D5a is H or methyl and R.sup.D5b is H. In further embodiments both R.sup.D5a and R.sup.D5b are H.

    [0734] In some embodiments R.sup.D7a is carboxy, CH.sub.2OH or ?O. In some embodiments R.sup.D7a is ?O. R.sup.D7b is H, or when R.sup.D7a is ?O, R.sup.D7b is absent.

    [0735] In some embodiments R.sup.D6a is H or ?O. In some embodiments R.sup.D6a is ?O and R.sup.D6b is absent.

    [0736] In some embodiments where R.sup.D7a is ?O, R.sup.D6a and R.sup.D6b are H and R.sup.D7b is absent and where R.sup.D6a is ?O, R.sup.D7a and R.sup.D7b are H and R.sup.D6a is absent.

    [0737] In some embodiments X.sup.D is N and R.sup.D5a is H or methyl, R.sup.D6b is H and R.sup.D6a and R.sup.D7a together form a pyridine ring or a benzene ring which is optionally substituted by C(?O)OH or CN or P(?O)Me.sub.2 and R.sup.D6b and R.sup.D7b are absent.

    [0738] In some embodiments D is selected from the following table:

    TABLE-US-00005 Name Structure 2-oxo-1-pyridyl [00089]embedded image 3-methyl-2-oxo-1- pyridyl [00090]embedded image 3-methoxy-2- oxo-1-pyridyl [00091]embedded image 5-methoxy-2-oxo- 1-pyridyl [00092]embedded image/ 5-chloro-2-oxo- 1-pyridyl [00093]embedded image/ 2-oxo-1,8- naphthyridin-1-yl [00094]embedded image 2-oxo-1-quinolyl [00095]embedded image 3-methyl-2-oxo- benzimidazol-1-yl [00096]embedded image 3-methyl-2,4- dioxo- imidazolidin-1-yl [00097]embedded image 3-methyl-2,5- dioxo-imidazolidin- 1-yl [00098]embedded image 3-chloro-2-oxo- 1-pyridyl [00099]embedded image 3-cyano-2-oxo-1- pyridyl [00100]embedded image 5-cyano-2-oxo- 1-pyridyl [00101]embedded image 3-fluoro-2- oxopyridin-1(2H)- yl [00102]embedded image 5-methyl-2-oxo- 1-pyridyl [00103]embedded image 5-carboxy-2-oxo- 1-pyridyl [00104]embedded image 2-oxo-5-(1H- pyrazol-4-yl)-1- pyridyl [00105]embedded image 2-oxo-5-(1H- triazol-4-yl)-1- pyridyl [00106]embedded image 5-cyano-3- methyl-2-oxo- benzimidazol-1- yl [00107]embedded image 5-carboxy-3- methyl-2-oxo- benzimidazol-1-yl [00108]embedded image 6-carboxy-3- methyl-2-oxo- benzimidazol-1- yl [00109]embedded image (6-dimethylphosphor- yl-3-methyl-2-oxo- benzimidazol-1-yl) [00110]embedded image 2-oxo-3H- benzimidazol-1- yl [00111]embedded image 2-oxo-1H- imidazo[4,5- b]pyridin-3-yl [00112]embedded image 6-oxopyridazin- 1-yl [00113]embedded image 6-oxopyrimidin-1- yl [00114]embedded image 1-methyl-2-oxo- 3-pyridyl [00115]embedded image 2-oxo-3- (trifluoromethyl)-1- pyridyl [00116]embedded image 2-oxo-3- (trifluoromethoxy)- 1-pyridyl [00117]embedded image 2-oxo-5-(1H- tetrazol-5-yl)-1- pyridyl [00118]embedded image

    [0739] In some embodiments D is selected from the following table:

    TABLE-US-00006 [3- (difluoromethoxy)- 2-oxo-1-pyridyl] [00119]embedded image [5- (difluoromethoxy)- 2-oxo-1-pyridyl] [00120]embedded image (3-carboxy-6- fluoro-2-methoxy- phenyl) [00121]embedded image (3-cyano-6-fluoro- 2-methoxy-phenyl) [00122]embedded image [6-fluoro-2- methoxy-3-(1H- tetrazol-5- yl)phenyl] [00123]embedded image (4-methoxy-2-oxo- 1-pyridyl) [00124]embedded image (4-chloro-2-oxo-1- pyridyl) [00125]embedded image (4-cyano-2-oxo-1- pyridyl) [00126]embedded image [3-(1- methylpyrazol-4- yl)-2-oxo-1- pyridyl] [00127]embedded image [2-oxo-3-(1H- pyrazol-4-yl)-1- pyridyl] [00128]embedded image [2-oxo-3-(1H- triazol-4-yl)-1- pyridyl] [00129]embedded image [5-(1- methylpyrazol-4- yl)-2-oxo-1-pyridyl] [00130]embedded image (5-cyano-1- methyl-2-oxo- imidazo[4,5- b]pyridin-3-yl) [00131]embedded image (6-cyano-1-methyl- 2-oxo-imidazo[4,5- b]pyridin-3-yl) [00132]embedded image (5-methoxy-6- oxo-pyridazin-1- yl) [00133]embedded image (3-chloro-6-oxo- pyridazin-1-yl) [00134]embedded image (2-cyanophenyl) [00135]embedded image (3-methyl-2-pyridyl) [00136]embedded image (3,5- dimethylpyrazol- 1-yl) [00137]embedded image (5-cyano-2,4- dimethyl-imidazol- 1-yl) [00138]embedded image (5-cyano-6-oxo- pyridazin-1-yl) [00139]embedded image [5- (difluoromethoxy)- 6-oxo-pyridazin-1- yl] [00140]embedded image (3-methoxy-2- pyridyl) [00141]embedded image (6-methoxy-2- pyridyl) [00142]embedded image (2,6- dimethoxyphenyl) [00143]embedded image (2-fluoro-6- methoxy-phenyl) [00144]embedded image 2-pyridyl [00145]embedded image pryazolo[3,4- b]pyridin-1-yl [00146]embedded image indazol-1-yl [00147]embedded image indazol-2-yl [00148]embedded image (3,5-dimethyl- 1,2,4-triazol-1-yl) [00149]embedded image (2,5- dimethyloxazol-4- yl) [00150]embedded image (6-cyano-3- methyl-2-oxo- benzimidazol-1- yl) [00151]embedded image (1-methyl-2-oxo- imidazo[4,5- b]pyridin-3-yl) [00152]embedded image (5-chloro-6-oxo- pyridazin-1-yl) [00153]embedded image

    [0740] In some embodiments D is selected from the following table:

    TABLE-US-00007 [00154]embedded image [00155]embedded image [00156]embedded image [00157]embedded image [00158]embedded image [00159]embedded image [00160]embedded image [00161]embedded image [00162]embedded image [00163]embedded image [00164]embedded image [00165]embedded image [00166]embedded image [00167]embedded image [00168]embedded image [00169]embedded image [00170]embedded image [00171]embedded image [00172]embedded image [00173]embedded image [00174]embedded image [00175]embedded image [00176]embedded image [00177]embedded image [00178]embedded image [00179]embedded image [00180]embedded image [00181]embedded image [00182]embedded image [00183]embedded image [00184]embedded image [00185]embedded image [00186]embedded image [00187]embedded image [00188]embedded image [00189]embedded image [00190]embedded image [00191]embedded image [00192]embedded image [00193]embedded image [00194]embedded image [00195]embedded image [00196]embedded image [00197]embedded image [00198]embedded image [00199]embedded image [00200]embedded image [00201]embedded image [00202]embedded image [00203]embedded image [00204]embedded image [00205]embedded image [00206]embedded image [00207]embedded image [00208]embedded image [00209]embedded image [00210]embedded image [00211]embedded image [00212]embedded image [00213]embedded image [00214]embedded image [00215]embedded image [00216]embedded image [00217]embedded image

    [0741] In another embodiment C has the formula (C-2):

    ##STR00218## [0742] wherein one or two of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from methyl, OMe, halo, C(?O)OH, piperazine optionally substituted by methyl, optionally substituted phenyl (wherein the optional substituent is methyl or halo), CN, CF.sub.3, OCF.sub.3, OCHF.sub.2, tetrazolyl, pyrazolyl optionally substituted by methyl, or triazolyl and the rest of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or R.sup.C9 and R.sup.C10 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring wherein the optional substituents are selected from OH, methyl, OMe, halo, CN, P(?O)Me.sub.2 or C(?O)OH; or [0743] wherein R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are all H.

    [0744] In some embodiments one or two of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from methyl, OMe, halo, C(?O)OH, piperazine optionally substituted by methyl, optionally substituted phenyl (wherein the optional substituent is methyl or halo), CN, CF.sub.3, OCF.sub.3, tetrazolyl, pyrazolyl, or triazolyl and the rest of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or R.sup.C9 and R.sup.C10 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring wherein the optional substituents are selected from OH, methyl, OMe, halo, CN, P(?O)Me.sub.2 or C(?O)OH; or wherein R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are all H.

    [0745] In one embodiment C has the formula (C-1) and all of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H.

    [0746] In another embodiment one or two of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from methyl, Cl, OMe, phenyl substituted with F at para position, C(?O)OH, CN, OCF.sub.3, CF.sub.3, F, pyrazolyl, triazolyl, tetrazolyl, piperazinyl substituted by methyl and the rest of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C1O are H. In another embodiment one or two of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from methyl, OMe, Cl, CN, CF.sub.3, F; pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; OCF.sub.3, OCHF.sub.2 and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [0747] In another embodiment one of R.sup.C7 and R.sup.C9 are independently selected from methyl, OMe, Cl, C(?O)OH, piperazinyl optionally substituted by methyl, optionally substituted phenyl (wherein the optional substituent is F), CN, CF.sub.3, OCF.sub.3, F, pyrazolyl, triazolyl or tetrazolyl and the other is H and R.sup.C10 and R.sup.C8 are H. In another embodiment one of R.sup.C7 and R.sup.C9 are independently selected from methyl, OMe, Cl, C(?O)OH, CN, CF.sub.3, OCHF.sub.2, OCF.sub.3, F, pyrazolyl, triazolyl or tetrazolyl and the other is H and R.sup.C10 and R.sup.C8 are H.

    [0748] In another embodiment R.sup.C9 is selected from H, optionally substituted phenyl (wherein the optional substituent is halo), methyl, OMe, C(?O)OH, Cl, CN, pyrazolyl, triazolyl, tetrazolyl, and piperazinyl optionally substituted with methyl and R.sup.C7, R.sup.C8 and R.sup.C10 are all H. In some embodiments R.sup.C9 is selected from H, CN, OMe, Cl, pyrazole optionally substituted by methyl, tetrazole, methyl, OCHF.sub.2, or triazole and R.sup.C7, R.sup.C8 and R.sup.C10 are all H.

    [0749] In other embodiments R.sup.C7 is selected from H, methyl, OMe, C, F, CF.sub.3, OCF.sub.3 and CN and R.sup.C8, R.sup.C9 and R.sup.C10 are all H. In some embodiments R.sup.C7 is selected from H, OMe, C, CF.sub.3, OCF.sub.3, OCHF.sub.2, CN, F, triazole and pyrazole optionally substituted by methyl, and R.sup.C7, R.sup.C8 and R.sup.C10 are all H.

    [0750] In some embodiments R.sup.C8 is selected from H, OMe, C and CN and wherein R.sup.C7, R.sup.C9 and R.sup.C10 are all H.

    [0751] In another embodiment C is selected from the group consisting of the groups 1-48 listed in the following table:

    TABLE-US-00008 No. Structure 1 [00219]embedded image 2 [00220]embedded image 3 [00221]embedded image 4 [00222]embedded image 5 [00223]embedded image 6 [00224]embedded image 7 [00225]embedded image 8 [00226]embedded image 9 [00227]embedded image 10 [00228]embedded image 11 [00229]embedded image 12 [00230]embedded image 13 [00231]embedded image 14 [00232]embedded image 15 [00233]embedded image 16 [00234]embedded image 17 [00235]embedded image 18 [00236]embedded image 19 [00237]embedded image 20 [00238]embedded image 21 [00239]embedded image 22 [00240]embedded image 23 [00241]embedded image 24 [00242]embedded image 25 [00243]embedded image 26 [00244]embedded image 27 [00245]embedded image 28 [00246]embedded image 29 [00247]embedded image 30 [00248]embedded image 31 [00249]embedded image 32 [00250]embedded image 33 [00251]embedded image 34 [00252]embedded image 35 [00253]embedded image 36 [00254]embedded image 37 [00255]embedded image 38 [00256]embedded image 39 [00257]embedded image 40 [00258]embedded image 41 [00259]embedded image 42 [00260]embedded image 43 [00261]embedded image 44 [00262]embedded image 45 [00263]embedded image 46 [00264]embedded image 47 [00265]embedded image 48 [00266]embedded image

    [0752] In another embodiment C is selected from the group consisting of the 49-80 listed in the following table:

    TABLE-US-00009 49 [00267]embedded image 50 [00268]embedded image 51 [00269]embedded image 52 [00270]embedded image 53 [00271]embedded image 54 [00272]embedded image 55 [00273]embedded image 56 [00274]embedded image 57 [00275]embedded image 58 [00276]embedded image 59 [00277]embedded image 60 [00278]embedded image 61 [00279]embedded image 62 [00280]embedded image 63 [00281]embedded image 64 [00282]embedded image 65 [00283]embedded image 66 [00284]embedded image 67 [00285]embedded image 68 [00286]embedded image 69 [00287]embedded image 70 [00288]embedded image 71 [00289]embedded image 72 [00290]embedded image 73 [00291]embedded image 74 [00292]embedded image 75 [00293]embedded image 76 [00294]embedded image 77 [00295]embedded image 78 [00296]embedded image 79 [00297]embedded image 80 [00298]embedded image

    [0753] In another embodiment C is selected from the group consisting of the groups listed in the following table:

    TABLE-US-00010 [00299]embedded image [00300]embedded image [00301]embedded image [00302]embedded image [00303]embedded image [00304]embedded image [00305]embedded image [00306]embedded image [00307]embedded image [00308]embedded image [00309]embedded image [00310]embedded image [00311]embedded image [00312]embedded image [00313]embedded image [00314]embedded image [00315]embedded image [00316]embedded image [00317]embedded image [00318]embedded image [00319]embedded image [00320]embedded image [00321]embedded image [00322]embedded image [00323]embedded image [00324]embedded image [00325]embedded image [00326]embedded image [00327]embedded image [00328]embedded image [00329]embedded image [00330]embedded image [00331]embedded image [00332]embedded image [00333]embedded image [00334]embedded image [00335]embedded image [00336]embedded image [00337]embedded image [00338]embedded image [00339]embedded image [00340]embedded image [00341]embedded image [00342]embedded image [00343]embedded image [00344]embedded image [00345]embedded image [00346]embedded image [00347]embedded image [00348]embedded image [00349]embedded image [00350]embedded image [00351]embedded image [00352]embedded image [00353]embedded image [00354]embedded image [00355]embedded image [00356]embedded image [00357]embedded image [00358]embedded image [00359]embedded image [00360]embedded image [00361]embedded image [00362]embedded image [00363]embedded image [00364]embedded image [00365]embedded image [00366]embedded image [00367]embedded image

    A-B-C

    [0754] In other embodiments the compound of formula A-B-C is of the Formula (I-A):

    ##STR00368## [0755] wherein X.sup.1 is N.

    [0756] In some embodiments R.sup.A2 is selected from the group consisting of: [0757] (i) H; [0758] (ii) halo; [0759] (iii) C.sub.1-6alkyl ester; [0760] (iv) C.sub.1-6 hydrocarbon; [0761] (v) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; [0762] (vi) C.sub.1-6 thioalkyl; [0763] (vii) C.sub.1-6 alkyl acyl; [0764] (viii) C.sub.5 heteroaryl; or [0765] (ix) alkylamino.

    [0766] In some embodiments R.sup.A2 is selected from the group consisting of: Br, Cl, CN, H, C(?O)CH.sub.3, C.sub.1-6 alkyl amido which alkyl amido is optionally substituted by C.sub.1-3alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups, optionally substituted methoxy, methyl, ethyl or cyclopropyl wherein the optional substituents are selected from OH, CN, or one or more halo groups, an optionally substituted methoxy or ethoxy wherein the optional substituents are selected from alkyl amido or one or more halo groups. In further embodiments R.sup.A2 is selected from CN, methyl, Cl, C(?O)CH.sub.3, C(?O)OCH.sub.2CH.sub.3, cyclopropyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, OCHF.sub.2, H, OMe, OCF.sub.3. In some embodiments R.sup.A2 is selected from C(?O)OCH.sub.2CH.sub.3, cyclopropyl, methyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, H, C(?O)N(CH.sub.3)CH.sub.2CH.sub.2OH, C(?O)N(CH.sub.3)CH.sub.2CCH, Cl, N(CH.sub.3).sub.2, pyrazole, SCH.sub.2CH.sub.3, C(?O)CH.sub.3, and C(?O)NHCH.sub.2CH.sub.2OH.

    [0767] In some embodiments R.sup.A3 is selected from the group consisting of CN, Br, Cl, OH, H, CF.sub.3, C.sub.1-2 alkyl, C.sub.1-2alkoxy, NH.sub.2. In further embodiments R.sup.A3 is selected from H, methyl and CN. In some embodiments R.sup.A3 is selected from H, methyl or OH.

    [0768] In other embodiments R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C.sub.6 carboaromatic ring or C.sub.5-7 heteroaromatic ring, the optional substituents are selected from NH.sub.2, C.sub.1-6 alkyl, C.sub.1-6 alkoxy and halo. In other embodiments the optional substituents are selected from NH.sub.2, methyl, ethyl, OMe, F, Cl and Br.

    [0769] In some embodiments R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted pyridine, an optionally substituted benzene, a pyrrole or a pyrazole. In some embodiments R.sup.A2 and R.sup.A1 together form an unsubstituted 2-pyrazole, a 2-pyrrole substituted by methyl, pyridine optionally substituted by NH.sub.2 or benzene optionally substituted by Cl, F or OMe.

    [0770] In some embodiments C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl. In some embodiments the optional substituents are selected from: [0771] (i) C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, or C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12 heterocyclyl or a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or more of the groups selected from: [0772] a) one or two ?O groups; [0773] b) one or more halo groups; [0774] c) CN, NH.sub.2, OH; [0775] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0776] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0777] f) C.sub.1-6 alkylester; [0778] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; h) C.sub.5-6 heteroaryl; [0779] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0780] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0781] k) carboxy, CH.sub.2-carboxy; [0782] l) P(?O)Me.sub.2; [0783] (ii) one or more of the groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido di-C.sub.1-6 alkyl sulfonamido.

    [0784] In other embodiments the compound of formula A-B-C is of the Formula (I-B):

    ##STR00369## [0785] wherein X.sup.1, R.sup.A2 and R.sup.A3 are as defined (I-A).

    [0786] In some embodiments Formula (I-B) can be Formula (I-Ba) or (I-Bb) as shown below:

    ##STR00370##

    [0787] In some embodiments D is C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl which are themselves optionally substituted by one or more groups selected from the following: [0788] a) one or two ?O groups; [0789] b) one or more halo groups; [0790] c) CN, NH.sub.2, OH; [0791] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0792] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0793] f) C.sub.1-6 alkylester; [0794] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0795] h) C.sub.5-6 heteroaryl; [0796] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0797] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0798] l) carboxy, CH.sub.2-carboxy [0799] m) P(?O)Me.sub.2.

    [0800] In some embodiments D is an optionally substituted pyridine-2-one. In some embodiments the optional substituents are selected from OMe, Cl, F, pyrazole, triazole, tetrazole, methyl, trifluoromethyl (CF.sub.3), OCF.sub.3, carboxy (C(?O)OH), CN, phenyl with an optional F substituent at the para position or a piperazine with a methyl substituent. In some embodiments the pyridine-2-one is unsubstituted. In some embodiments the pyridine-2-one is pyridin-2(1H-one.

    [0801] In some embodiments D is an optionally substituted 6 membered heteroaryl which contains one or two N atoms, one of which is bonded to C, which is substituted by ?O at the ortho position and the other optional substituents are selected from methyl, OMe, piperazinyl substituted by methyl, C(?O)OH (carboxy), Cl, F, pyrazolyl, triazolyl, tetrazolyl, phenyl substituted by fluoro, CN, CF.sub.3 or OCF.sub.3. In some embodiments D is an optionally substituted 6 membered heteroaryl which contains one or two N atoms, one of which is bonded to C, which is substituted by ?O at the ortho position and the other optional substituents are selected from methyl, OMe, piperazinyl substituted by methyl, C(?O)OH (carboxy), Cl, F, pyrazolyl optionally substituted with methyl, triazolyl, tetrazolyl, phenyl substituted by fluoro, CN, CF.sub.3, OCHF.sub.2 or OCF.sub.3.

    [0802] In some embodiments D is an optionally substituted C.sub.5 heterocycle or C.sub.5 heteroaryl, wherein the optional substituents are selected from methyl and CN. In further embodiments D is an optionally substituted pyrazole, imidazole, triazole or oxazole wherein the optional substituents are selected from methyl. In further embodiments D is a triazole substituted with two methyl groups. In further embodiments D is a pyrazole substituted by two methyl groups. In further embodiments D is an imidazole substituted by two methyl groups and CN. In further embodiments D is an oxazole substituted by two methyl groups.

    [0803] In some embodiments D is a C.sub.9 heterocyclyl or C.sub.9 heteroaryl comprising 2 or 3 nitrogen atoms.

    [0804] In further embodiments D is 1H-pyrazolo[3,4-b]pyridiyl, indazol-1-yl or indazol-2-yl.

    [0805] In other embodiments the compound of formula A-B-C is of the Formula (I-C):

    ##STR00371## [0806] wherein X.sup.1, R.sup.A2 and R.sup.A3 are as defined (I-A).

    [0807] In some embodiments one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from a C.sub.1-6 alkyl optionally substituted by one or more halo groups; C.sub.1-6 alkoxy optionally substituted by one or more halo groups, C.sub.5-6 heterocyclyl or C.sub.5-6 heteroaryl with an optional methyl substituent, carboxy, ?O, halo, NH.sub.2, CN, or phenyl optionally substituted by one or more halo atoms; or [0808] wherein R.sup.D3 and R.sup.D4 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring wherein the optional substituents are selected from OH, methyl, OMe, halo, C(?O)OH.

    [0809] In another embodiment one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from methyl, OMe, halo, C(?O)OH, CN, CF.sub.3, OCF.sub.3, OCHF.sub.2, pyrazolyl, triazolyl, tetrazolyl and the rest are H. In another embodiment one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from methyl, OMe, halo, C(?O)OH, CN, CF.sub.3, OCF.sub.3, OCHF.sub.2, pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl and the rest are H.

    [0810] In one embodiment all of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [0811] In some embodiments R.sup.D3 and R.sup.D4 form an unsubstituted benzene ring or an unsubstituted pyridine ring.

    [0812] In other embodiments the compound of formula A-B-C is of Formula (I-D):

    ##STR00372##

    [0813] In some embodiments X.sup.1, R.sup.A2 and R.sup.A3 are as defined (I-A).

    [0814] In some embodiments X.sup.D is NR.sup.D5a or CR.sup.D5aR.sup.D5b [0815] R.sup.D5a is selected from H or methyl; [0816] either R.sup.D5b and R.sup.D6b are both H or together they are CH.sub.2; [0817] R.sup.D6a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH; [0818] R.sup.D7a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH; [0819] R.sup.D7b is H, wherein when R.sup.D7a is ?O, R.sup.D7b is absent; [0820] or wherein R.sup.D6a and R.sup.D7a together form a benzene ring or a C.sub.6 heteroaromatic ring which is optionally substituted by CN, P(?O)Me.sub.2 or carboxy and R.sup.D6b and R.sup.D7b are absent.

    [0821] In some embodiments R.sup.D6a and R.sup.D7a together form a benzene ring or a pyridine ring which is optionally substituted by CN, P(?O)Me.sub.2, or carboxy and R.sup.D6b and R.sup.D7a are absent.

    [0822] In other embodiments the compound of formula A-B-C is of the Formula (I-E):

    ##STR00373##

    [0823] In some embodiments R.sup.A2 is selected from: [0824] (i) H; [0825] (ii) halo; [0826] (iii) CN; [0827] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [0828] (v) OH [0829] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, C.sub.1-6 alkyl amido, or one or more halo groups; [0830] (vii) carboxy; [0831] (viii) C.sub.1-6alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups.

    [0832] In some embodiments R.sup.A2 is selected from the group consisting of: [0833] (i) H; [0834] (ii) halo; [0835] (iii) C.sub.1-6 alkyl ester; [0836] (iv) C.sub.1-6 hydrocarbon; [0837] (v) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; [0838] (vi) C.sub.1-6 thioalkyl; [0839] (vii) C.sub.1-6 alkyl acyl; [0840] (viii) C.sub.5 heteroaryl; or [0841] (ix) alkylamino.

    [0842] In some embodiments R.sup.A2 is selected from CN, methyl, Cl, C(?O)CH.sub.3, C(?O)OCH.sub.2CH.sub.3, cyclopropyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, OCHF.sub.2, H, OMe, OCF.sub.3, or [0843] R.sup.A2 and R.sup.A3 together form an unsubstituted 2-pyrazole, a 2-pyrrole substituted by methyl, pyridine optionally substituted by NH.sub.2, or benzene optionally substituted by Cl, F or OMe.

    [0844] In some embodiments R.sup.A2 is selected from C(?O)OCH.sub.2CH.sub.3, cyclopropyl, methyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, H, C(?O)N(CH.sub.3)CH.sub.2CH.sub.2OH, C(?O)N(CH.sub.3)CH.sub.2CCH, Cl, N(CH.sub.3).sub.2, pyrazole, SCH.sub.2CH.sub.3, C(?O)CH.sub.3, and C(?O)NHCH.sub.2CH.sub.2OH.

    [0845] In some embodiments R.sup.A3 is selected from: [0846] (i) H; [0847] (ii) halo; [0848] (iii) CN; [0849] (iv) C.sub.1-6 hydrocarbon optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkylester, C.sub.1-6 alkylamino; C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkylacylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [0850] (v) OH; [0851] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups.

    [0852] In some embodiments R.sup.A3 is selected from: [0853] (i) H; [0854] (ii) halo; [0855] (iii) CN; [0856] (iv) C.sub.1-6 hydrocarbon optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkylester, C.sub.1-6 alkylamino; C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkylacylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [0857] (v) OH; [0858] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups.

    [0859] In some embodiments the compound is of the Formula (I-E) and R.sup.A3 is H, methyl or OH. In further embodiments the compound is of the Formula (I-E) and R.sup.A3 is H.

    [0860] In some embodiments the compound is of the Formula (I-E) and D is a C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, which are themselves optionally substituted by ?O; halo; CN; NH.sub.2; OH; one or more C.sub.1-6 alkyl groups, which alkyl is optionally substituted by halo; C.sub.1-6 alkoxy which is optionally substituted by halo; C.sub.1-6alkylester; C.sub.5-6 heterocyclyl with an optional methyl substituent; carboxy; CH.sub.2-carboxy; tetrazolyl; pyrazolyl or triazolyl. In some embodiments the optional substituents are selected from ?O, CN, F, Cl, Br, CN, methyl, ethyl, OMe, ethoxy, OCF.sub.3, CF.sub.3, C.sub.1-2 alkyl ester. In some embodiments the compound is of the Formula (I-E) and D is a C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, which are themselves optionally substituted by ?O; methyl; OMe; piperazinyl substituted by methyl; C(?O)OH (carboxy); Cl; F; phenyl substituted by fluoro; CN; CF.sub.3; OCHF.sub.2, OCF.sub.3; pyrazole optionally substituted by methyl, triazole, tetrazole.

    [0861] In some embodiments the compound is of the Formula (I-E) and D is an optionally substituted pyridin-2-one. In some embodiments the optional substituents are selected from OMe, Cl, F, pyrazole, triazole, tetrazole, methyl, trifluoromethyl (CF.sub.3), OCF.sub.3, carboxy (C(?O)OH), CN, phenyl with an optional F substituent at the para position or a piperazinyl with a methyl substituent. In some embodiments the compound is of the Formula (I-E) and D is an optionally substituted pyridin-2-one or pyridin-2(1H-one. In some embodiments the optional substituents are selected from OMe, Cl, F, pyrazole, triazole, tetrazole, methyl, trifluoromethyl (CF.sub.3), OCHF.sub.2, OCF.sub.3, carboxy (C(?O)OH), CN, phenyl with an optional F substituent at the para position or a piperazinyl with a methyl substituent. In some embodiments the pyridine-2-one is unsubstituted. In some embodiments the pyridine-2-one is pyridin-2(1H)-one.

    [0862] In some embodiments the compound is of the Formula (I-E) and D is an optionally substituted C.sub.5 heterocycle or C.sub.5 heteroaryl, wherein the optional substituents are selected from methyl and CN. In further embodiments D is an optionally substituted pyrazole, imidazole, triazole or oxazole wherein the optional substituents are selected from methyl. In further embodiments D is a triazole substituted with two methyl groups. In further embodiments D is a pyrazole substituted by two methyl groups. In further embodiments D is an imidazole substituted by two methyl groups and CN. In further embodiments D is an oxazole substituted by two methyl groups. In some embodiments D is a C.sub.9 heterocyclyl or C.sub.9 heteroaryl comprising 2 or 3 nitrogen atoms. In further embodiments D is 1H-pyrazolo[3,4-b]pyridiyl, indazol-1-yl or indazol-2-yl.

    [0863] In some embodiments D is optionally substituted by 1, 2 or 3 substituents.

    [0864] In another embodiment the compound is of Formula (I-Ea):

    ##STR00374## [0865] wherein D and R.sup.A3 are a defined above for Formula (I-E).

    [0866] In another embodiment the compound is of Formula (I-Eb):

    ##STR00375##

    [0867] Wherein D and R.sup.A3 are a defined above for Formula (I-E).

    [0868] In one embodiment the compound is of Formula (I)


    A-B-C(I) [0869] or a pharmaceutically acceptable salt, tautomeric forms or stereoisomers thereof, wherein A is of the following:

    ##STR00376## [0870] wherein the wavy line indicates the point of attachment to B; [0871] X.sup.1 is N; [0872] R.sup.A2 is selected from the group consisting of: [0873] (i) H; [0874] (ii) halo; [0875] (iii) CN; [0876] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [0877] (v) C.sub.1-6 alkoxy, optionally substituted by OH, alkyl amido, or one or more halo groups; [0878] (vi) C.sub.1-6 acyl amido (wherein the acyl is optionally substituted by H or methyl); [0879] (vii) C.sub.1-6 thioalkyl; [0880] (viii) C.sub.1-6 alkyl ester; [0881] (ix) C.sub.1-6 alkyl acyl; [0882] (x) C.sub.4-5 heterocyclyl; [0883] (xi) C.sub.5 heteroaryl; [0884] (xii) C.sub.1-6alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl or C.sub.1-3 alkyl wherein the C.sub.1-3 alkyl is optionally substituted with one or more halo or OH groups; and [0885] (xiii) OH; [0886] R.sup.A3 is selected from the group consisting of: [0887] (i) H; [0888] (ii) halo; [0889] (iii) CN; [0890] (iv) C.sub.1-6 hydrocarbon optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl, C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkyl ester, C.sub.1-6 alkylamino, C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkyl acylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [0891] (v) OH; [0892] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups; [0893] (vii) C.sub.1-6 acyloxy; [0894] (viii) C.sub.4 heterocycyl; [0895] (ix) NH.sub.2; [0896] (x) C.sub.1-6 alkylamino, optionally substituted by CN, OH or C.sub.4 heterocyclyl; [0897] (xi) C.sub.1-6 dialkylamino, optionally substituted by NH.sub.2; [0898] (xii) C.sub.1-6 acylamido (where acyl substituent is H or Me); [0899] (xiii) carbaimidoyl or methyl-carbaimidoyl; [0900] (xiv) carboxyamino; [0901] (xv) C.sub.1-6 thioalkyl, optionally substituted by OH or NH.sub.2; [0902] (xvi) C.sub.1-6 alkyl sulfinyl; [0903] (xvi) C.sub.1-6 alkyl sulfonyl, optionally substituted by one or more halo groups; [0904] (xvii) C.sub.1-6 sulfonimodyl; [0905] (xviii) C.sub.1-6 alkyl phosphinyl; [0906] (xix) carboxy; [0907] (xx) C(?O)NH.sub.2 [0908] (xxi) C.sub.1-6 alkyl ester; [0909] (xxii) C.sub.1-6 alkyl acyl, optionally substituted by one or more halo groups; and [0910] (xxiiv) C.sub.1-6 alkyl amido; [0911] or wherein R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form: [0912] (i) an optionally substituted C.sub.5-7 heterocycle ring; [0913] (ii) an optionally substituted C.sub.5-heteroaromatic ring; [0914] (iii) an optionally substituted C.sub.6 carboaromatic ring; [0915] (iv) an optionally substituted C.sub.5-7 carbocyclic ring [0916] wherein the optional substituents are selected from C.sub.1-6 alkyl, halo, C.sub.1-6 alkoxy, NH.sub.2, C.sub.1-6 alkylamino, OH, and CN; [0917] wherein B is of formula (B-1) or (B-2)

    ##STR00377## [0918] wherein the wavy line indicates the point of attachment to A and C; [0919] R.sup.B1 is H, OH, ?CHCH.sub.2OH, OC.sub.1-4 alkyl or C.sub.1-4 alkyl, wherein the C.sub.1-4 alkyl is optionally substituted by OH or OMe;

    ##STR00378## [0920] wherein the wavy line indicates the point of attachment to A and C; [0921] R.sup.B2 is C.sub.1-2 alkyl-OH, CH.sub.2CONHMe or C.sub.1-3 alkyl; [0922] wherein C is selected from the group consisting of C.sub.6-10 carboaryl, C.sub.5-6 heteroaryl and C.sub.5-10 heterocyclyl, which groups are optionally substituted by: [0923] (i) C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.4-10 heterocyclyl, or C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12 heterocyclyl or a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or more of the following groups: [0924] a) one or two ?O groups; [0925] b) one or more halo groups; [0926] c) CN, NH.sub.2, OH; [0927] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [0928] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [0929] f) C.sub.1-6 alkylester; [0930] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [0931] h) C.sub.5-6 heteroaryl; [0932] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [0933] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [0934] l) P(?O)Me.sub.2; [0935] m) carboxy or CH.sub.2-carboxy; and/or [0936] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl; [0937] (ii) one or more groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido, and di-C.sub.1-6alkyl sulfonamido.

    [0938] In some embodiments the compound is of Formula (I)


    A-B-C(I) [0939] or a pharmaceutically acceptable salt, tautomeric forms or stereoisomers thereof, [0940] wherein A is of the following:

    ##STR00379## [0941] wherein the wavy line indicates the point of attachment to B; [0942] R.sup.A2 is C.sub.1-6 alkylamino; [0943] X.sup.1, R.sup.A3, B and C are as defined above.

    [0944] In some embodiments the compound of Formula (I) is selected from the following in Table 1.

    TABLE-US-00011 TABLE 1 Ex Structure Name 10 [00380]embedded image Ethyl 3-(((1S,3S)-3-((2-oxo-2H-[1,3- bipyridin]-6-yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxylate 50 [00381]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3- bipyriidn]-2-one 51 [00382]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3- (trifluoromethyl)-2H-[1,3-bipyridin]-2-one 52 [00383]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3- (trifluoromethoxy)-2H-[1,3-bipyridin]-2-one 53 [00384]embedded image (1S,3S)-N.sup.1-(6-Cyclopropyl-1,2,4-triazin-3-yl)- N.sup.3-(5-(2,6-difluorophenyl)pyridin-2- yl)cyclopentane-1,3-diamine 54 [00385]embedded image (1S,3S)-N.sup.1-(6-Cyclopropyl-1,2,4-triazin-3-yl)- N.sup.3-(5-(2-fluoro-6-methoxyphenyl)pyridin-2- yl)cyclopentane-1,3-diamine 55 [00386]embedded image 3-Chloro-6-(((1S,3S)-3-((6-cyclopropyl-1,2,4- triazin-3-yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 56 [00387]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3- bipyridine]-5-carbonitrile 57 [00388]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin- 3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1- methylimidazolidine-2,4-dione 58 [00389]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3- bipyridine]-3-carbonitrile 59 [00390]embedded image 2-(5-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin- 3-yl)amino)cyclopentyl)amino)pyrazin-2- yl)pyridazin-3(2H)-one 60 [00391]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-1-methyl-[3,3- bipyridin]-2(1H)-one 61 [00392]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3-fluoro-[2,3- bipyridine]-6-carbonitrile 62 [00393]embedded image 1-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin- 3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-3- methylimidazolidine-2,4-dione 63 [00394]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin- 3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1- methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin- 2-one 64 [00395]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3-methoxy-2H- [1,3-bipyridin]-2-one 65 [00396]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-5-methoxy-2H- [1,3-bipyridin]-2-one 66 [00397]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3-methyl-2H- [1,3-bipyridin]-2-one 67 [00398]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3- bipyridin]-2-one 68 [00399]embedded image N-(2-Amino-2-oxoethyl)-3-(((1S,3S)-3-((2- oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6- carboxamide 69 [00400]embedded image 3-(((1S,3S)-3-((2-Oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N-(prop-2-yn-1- yl)-1,2,4-triazine-6-carboxamide 70 [00401]embedded image N-(Oxetan-3-yl)-3-(((1S,3S)-3-((2-oxo-2H- [1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6- carboxamide 71 [00402]embedded image N-(2,2-Difluoroethyl)-3-(((1S,3S)-3-((2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6- carboxamide 72 [00403]embedded image N-(2-Hydroxyethyl)-3-(((1S,3S)-3-((2-oxo-2H- [1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6- carboxamide 73 [00404]embedded image N-Ethyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3- bipyridin]-6-yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide 74 [00405]embedded image 3-(((1S,3S)-3-((2-Oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6- carboxamide 75 [00406]embedded image N-Methyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3- bipyridin]-6-yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide 76 [00407]embedded image N,N-Dimethyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3- bipyridin]-6-yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide

    [0945] Further compounds are shown in Table 2:

    TABLE-US-00012 TABLE 2 Ex Structure Name 112 [00408]embedded image 5-Chloro-6-(((1S,3S)-3-((6-cyclopropyl-1,2,4- triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3- bipyridin]-2-one 113 [00409]embedded image 3-(5-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyrazin-2-yl)-1- methylpyridin-2(1H)-one 114 [00410]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin-3-yl)pyrimidin- 4(3H)-one 115 [00411]embedded image 3-(2-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyrimidin-5-yl)-1- methylpyridin-2(1H)-one 116 [00412]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin-3-yl)-1-methyl- 2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5- carbonitrile 117 [00413]embedded image 1-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-methyl- 2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5- carbonitrile 118 [00414]embedded image 2-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin- 3(2H)-one 119 [00415]embedded image 2-(2-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyrimidin-5- yl)pyridazin-3(2H)-one 120 [00416]embedded image 2-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-6H-[1,5-bipyrimidin]- 6-one 121 [00417]embedded image 1-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-methyl- 2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5- carboxylic acid 122 [00418]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-5-(1H-1,2,3-triazin-4- yl)-2H-[1,3-bipyridin]-2-one 123 [00419]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-5-(1H-pyrazol-4-yl)- 2H-[1,3-bipyridin]-2-one 124 [00420]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-5-(1H-tetrazol-5-yl)- 2H-[1,3-bipyridin]-2-one 125 [00421]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin-3-yl)-5- (dimethylphosphoryl)-1-methyl-1,3-dihydro-2H- benzo[d]imidazol-2-one 126 [00422]embedded image 6-(((1S,3S)-3-((5-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 127 [00423]embedded image 6-(((1S,3S)-3-((5,6-Dimethyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 128 [00424]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3- bipyridine]-5-carbonitrile 129 [00425]embedded image 3-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 130 [00426]embedded image 5-Methyl-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 131 [00427]embedded image 3-Methyl-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 132 [00428]embedded image 3-Methoxy-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin- 3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]- 2-one 133 [00429]embedded image 5-Methoxy-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin- 3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]- 2-one 134 [00430]embedded image 5-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 135 [00431]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3-(trifluoromethyl)- 2H-[1,3-bipyridin]-2-one 136 [00432]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3- bipyridine]-3-carbonitrile 137 [00433]embedded image 3-Fluoro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2- one 138 [00434]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3-(trifluoromethoxy)- 2H-[1,3-bipyridin]-2-one

    [0946] Further compounds are shown in Table 3:

    TABLE-US-00013 TABLE 3 Ex Structure Name 151 [00435]embedded image N-(2-Hydroxyethyl)-N-methyl-3- (((1S,3S)-3-((2-oxo-2H-[1,3- bipyridin]-6- yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide 152 [00436]embedded image N-Methyl-3-(((1S,3S)-3-((2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (prop-2-yn-1-yl)-1,2,4-triazine-6- carboxamide 153 [00437]embedded image 3-(((1S,3S)-3-((3-Methoxy-2- oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 154 [00438]embedded image 3-(((1S,3S)-3-((5-Methoxy-2- oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 155 [00439]embedded image 3-(((1S,3S)-3-((3-Methyl-2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 156 [00440]embedded image 3-(((1S,3S)-3-((5-Methyl-2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 157 [00441]embedded image 3-(((1S,3S)-3-((3-Chloro-2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 158 [00442]embedded image 3-(((1S,3S)-3-((5-Chloro-2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 159 [00443]embedded image 3-(((1S,3S)-3-((3-Cyano-2-oxo- 2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-N- (oxetan-3-yl)-1,2,4-triazine-6- carboxamide 160 [00444]embedded image N-(Oxetan-3-yl)-3-(((1S,3S)-3- ((2-oxo-3-(trifluoromethoxy)-2H- [1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide 161 [00445]embedded image N-(Oxetan-3-yl)-3-(((1S,3S)-3- ((2-oxo-3-(trifluoromethyl)-2H- [1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide 165 [00446]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-3- (difluoromethoxy)-2H-[1,3- bipyridin]-2-one 166 [00447]embedded image 6-(((1S,3S)-3-((6-Cyclopropyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-5- (difluoromethoxy)-2H-[1,3- bipyridin]-2-one 167 [00448]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-4-fluoro-2- methoxybenzoic acid 168 [00449]embedded image 3-(6-(((1S,3S)-3-((6-Cyclopropyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-4-fluoro-2- methoxybenzonitrile 169 [00450]embedded image (1S,3S)-N1-(6-Cyclopropyl- 1,2,4-triazin-3-yl)-N3-(5-(6- fluoro-2-methoxy-3-(1H-tetrazol- 5-yl)phenyl)pyridin-2- yl)cyclopentane-1,3-diamine 173 [00451]embedded image rel-3-Methyl-6-(((1R,3R)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 180 [00452]embedded image 4-Methoxy-6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 182 [00453]embedded image 4-Chloro-6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 183 [00454]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-2- oxo-2H-[1,3-bipyridine]-4- carbonitrile 185 [00455]embedded image 5-(Difluoromethoxy)-6-(((1S,3S)- 3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 187 [00456]embedded image 3-(Difluoromethoxy)-6-(((1S,3S)- 3-((6-methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 197 [00457]embedded image 1-(6-(((1S,3S)-3-((6-Methyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-1,8-naphthyridin-2(1H)- one 198 [00458]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-3- (1-methyl-1H-pyrazol-4-yl)-2H- [1,3-bipyridin]-2-one 199 [00459]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-3- (1H-pyrazol-4-yl)-2H-[1,3- bipyridin]-2-one 200 [00460]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-3- (1H-1,2,3-triazol-4-yl)-2H-[1,3- bipyridin]-2-one 201 [00461]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-5- (1-methyl-1H-pyrazol-4-yl)-2H- [1,3-bipyridin]-2-one 202 [00462]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-5- (1H-pyrazol-4-yl)-2H-[1,3- bipyridin]-2-one 208 [00463]embedded image 6-(((1S,3S)-3-((6-Methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-5- (1H-1,2,3-triazol-4-yl)-2H-[1,3- bipyridin]-2-one 210 [00464]embedded image 1-Methyl-3-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-2-oxo-2,3-dihydro-1H- benzo[d]imidazole-5-carbonitrile 211 [00465]embedded image 3-Methyl-1-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-2-oxo-2,3-dihydro-1H- benzo[d]imidazole-5-carbonitrile 212 [00466]embedded image 1-Methyl-3-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-1,3-dihydro-2H- imidazo[4,5-b]pyridin-2-one 213 [00467]embedded image 1-Methyl-3-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-2-oxo-2,3-dihydro-1H- imidazo[4,5-b]pyridine-5- carbonitrile 214 [00468]embedded image 1-Methyl-3-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-2-oxo-2,3-dihydro-1H- imidazo[4,5-b]pyridine-6- carbonitrile 220 [00469]embedded image 4-Methoxy-2-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)pyridazin-3(2H)-one 221 [00470]embedded image 4-Chloro-2-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)pyridazin-3(2H)-one 222 [00471]embedded image 6-Chloro-2-(6-(((1S,3S)-3-((6- methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)pyridazin-3(2H)-one 247 [00472]embedded image 2-(6-(((1S,3S)-3-((6-Methyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)benzonitrile 248 [00473]embedded image (1S,3S)-N1-(6-Methyl-1,2,4- triazin-3-yl)-N3-(3-methyl-[2,3- bipyridin]-6-yl)cyclopentane-1,3- diamine 249 [00474]embedded image (1S,3S)-N1-(5-(3,5-Dimethyl-1H- pyrazol-1-yl)pyridin-2-yl)-N3-(6- methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 250 [00475]embedded image 2,4-Dimethyl-1-(6-(((1S,3S)-3- ((6-Methyl-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-1H-imidazole-5- carbonitrile 254 [00476]embedded image 6-(((1S,3S)-3-((6-Methyl-5-oxo- 4,5-dihydro-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 255 [00477]embedded image 6-(((1S,3S)-3-((6-Chloro-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 256 [00478]embedded image 6-(((1S,3S)-3-((6- (Dimethylamino)-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 257 [00479]embedded image 6-(((1S,3S)-3-((6-(1H-Pyrazol-5- yl)-1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 258 [00480]embedded image 6-(((1S,3S)-3-((6-(Ethylthio)- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 260 [00481]embedded image 6-(((1S,3S)-3-((6-Acetyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)-2H- [1,3-bipyridin]-2-one 277 [00482]embedded image 2-(6-(((1S,3S)-3-((6-Methyl- 1,2,4-triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)-3-oxo-2,3- dihydropyridazine-4-carbonitrile 281 [00483]embedded image 4-(Difluoromethoxy)-2-(6- (((1S,3S)-3-((6-methyl-1,2,4- triazin-3- yl)amino)cyclopentyl)amino)pyridin- 3-yl)pyridazin-3(2H)-one 304 [00484]embedded image (1S,3S)-N1-(3-Methoxy-[2,3- bipyridin]-6-yl)-N3-(6-methyl- 1,2,4-triazin-3-yl)cyclopentane- 1,3-diamine 305 [00485]embedded image (1S,3S)-N1-(6-Methoxy-[2,3- bipyridin]-6-yl)-N3-(6-methyl- 1,2,4-triazin-3-yl)cyclopentane- 1,3-diamine 306 [00486]embedded image (1S,3S)-N1-(5-(2- Methoxyphenyl)pyridin-2-yl)-N3- (6-methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 307 [00487]embedded image (1S,3S)-N1-(5-(2,6- Dimethoxyphenyl)pyridin-2-yl)- N3-(6-methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 308 [00488]embedded image (1S,3S)-N1-(5-(2-Fluoro-6- methoxyphenyl)pyridin-2-yl)-N3- (6-methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 309 [00489]embedded image (1S,3S)-N1-([2,3-Bipyridin]-6- yl)-N3-(6-methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 310 [00490]embedded image (1S,3S)-N1-(5-(1H-Pyrazolo[3,4- b]pyridin-1-yl)pyridin-2-yl)-N3-(6- methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 311 [00491]embedded image (1S,3S)-N1-(5-(1H-Indazol-1- yl)pyridin-2-yl)-N3-(6-methyl- 1,2,4-triazin-3-yl)cyclopentane- 1,3-diamine 312 [00492]embedded image (1S,3S)-N1-(5-(2H-Indazol-2- yl)pyridin-2-yl)-N3-(6-methyl- 1,2,4-triazin-3-yl)cyclopentane- 1,3-diamine 313 [00493]embedded image (1S,3S)-N1-(5-(3,5-Dimethyl-1H- 1,2,4-triazol-1-yl)pyridin-2-yl)- N3-(6-methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 314 [00494]embedded image (1S,3S)-N1-(5-(2,5- Dimethyloxazol-4-yl)pyridin-2-yl)- N3-(6-methyl-1,2,4-triazin-3- yl)cyclopentane-1,3-diamine 315 [00495]embedded image rac-(R)-6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)-3- methyl-2H-[1,3-bipyridin]-2-one 316 [00496]embedded image rac-(R)-6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)-5- methyl-2H-[1,3-bipyridin]-2-one 317 [00497]embedded image rac-(R)-6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)-5- methoxy-2H-[1,3-bipyridin]-2- one 318 [00498]embedded image rac-(R)-1-(6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)pyri- din-3-yl)quinolin-2(1H)-one 319 [00499]embedded image rac-(R)-3-(6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)pyri- din-3-yl)-1-methyl-1,3-dihydro- 2H-imidazo[4,5-b]pyridin-2-one 320 [00500]embedded image rac-(R)-1-(6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)pyri- din-3-yl)-1,8-naphthyridin-2(1H)- one 321 [00501]embedded image rac-(R)-1-(6-((4-Hydroxy-2-(((6- methyl-1,2,4-triazin-3- yl)amino)methyl)butyl)amino)pyri- din-3-yl)-3-methyl-1,3-dihydro- 2H-benzo[d]imidazol-2-one

    [0947] In some embodiments the compound is selected from 50, 57, 129, 132 and 136. In some embodiments the compound is 132.

    General Synthesis

    [0948] The compounds according to general formula (I-B) can be prepared according to the following schemes 1, 2, 3, 4 and 5. The schemes and procedures described below illustrate synthetic routes to the compounds of general formula (I-B) and are not intended to be limiting. It is clear that the order of transformations as exemplified in schemes 1, 2, 3, 4 and 5 can be modified in various ways. The order of transformations exemplified in these schemes is therefore not intended to be limiting.

    [0949] Routes for the preparation of compounds of general formula (I-B) and corresponding intermediates are described in schemes 1, 2, 3, 4 and 5.

    ##STR00502##

    [0950] Monoarylated diamines of general formula (A3) can be obtained via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination between monoprotected diamines (A1) or their corresponding salts and heteroaryls (A2a) with X being a leaving group like halogen or S(O)Me as depicted in Scheme 1. For S.sub.NAr approaches with X being groups like for example fluorine or S(O)Me, diamines (A1) may be reacted with (A2a) in the presence of inorganic bases like K.sub.2CO.sub.3 or Na.sub.2CO.sub.3 or in the presence of organic bases like triethylamine or DIPEA or without any additional base in polar solvents such as for example DMSO, NMP or nBuOH at temperatures between 100-130? C. The reaction times may vary between 1 hour and 24 hours. In certain instances, it can be beneficial to apply microwave heating.

    [0951] For palladium catalyzed Buchwald-Hartwig aminations all methods that are known in the art may be applied. For example, diamines (A1) may be reacted with (A2a) in the presence of a palladium catalyst like Pd PEPPSI-IpentCl [CAS 1612891-29-8], Pd.sub.2(dba).sub.3 or tBuXPhos Pd G3 [1447963-75-8] and a base like Cs.sub.2CO.sub.3 or NaOtBu in aprotic solvents like 1,4-dioxane, DMF, toluene or DMA at temperatures between room temperature and 130? C., preferably at 65-100? C., for 15-24 h.

    [0952] Diamines of general formula (A1) and heteroaryls of general formula (A2a) are either commercially available or can be prepared according to procedures available from the public domain. For the synthesis of diamines (A1) see for example WO2004004726 and references therein.

    [0953] Arylated diamines of general formula (A6) can be obtained from (A3) via copper catalyzed Ullmann couplings with heterocycles (A4) or via palladium catalyzed Suzuki couplings with boronic acid derivatives (A5). For Ullmann couplings all methods that are known in the art may be applied. For example, (A3) may be reacted with (A4) in the presence of a copper catalyst like Cu(I)I, Cu(Otf).sub.2 or Cu(Oac).sub.2 and a base like Cs.sub.2CO.sub.3 or K.sub.2CO.sub.3 in polar, aprotic solvents like 1,4-dioxane, DMF or pyridine at temperatures between room temperature and 120? C., preferably at 100? C. for 15-20 h. In some instances a ligand like N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine, TMEDA, N.sup.1,N.sup.2-dimethylethane-1,2-diamine or N,N-dimethylglycine might be added to the reaction mixture.

    [0954] For Suzuki couplings towards (A6) all methods that are known in the art may be applied. For example, (A3) may be reacted with boronic acid derivatives (A5) in the presence of a palladium catalyst like 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride [CAS 95408-45-0] or 1,1-bis(diphenylphosphino)ferrocene palladium dichloride [CAS 72287-26-4] and a base like Cs.sub.2CO.sub.3, K.sub.2CO.sub.3 or K.sub.3PO.sub.4 in polar solvents such as 1,4-dioxane, THF and water or mixtures thereof at temperatures between room temperature and 120? C. for 2-15 hours.

    [0955] Heterocycles of general formula (A4) and boronic acid derivatives of general formula (A5) are either commercially available or can be prepared according to procedures available from the public domain.

    [0956] Primary amines of general formula (A7) can be obtained from monoprotected diamines of general formula (A6) via deprotection methods. Depending on the protective group applied these can be for example acidic, basic, oxidative or hydrogenation methods. Appropriate protective moieties for amino groups and their introduction and cleavage are well-known in the art. For an overview of protective group chemistry see for example Wuts 2014.

    [0957] Final compounds of general formula (I-B) can be synthesized from primary amines of general formula (A7) via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination. Primary amines of general formula (A7) can be reacted with heteroaryls of general formula (A8) with X being a leaving group like halogen such as chlorine or S(O)Me applying procedures in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1. Heteroaryls of general formula (A8) are either commercially available or can be prepared according to procedures available from the public domain.

    [0958] An alternative route to compounds of general formula (I-B) starts with deprotection of diamines of general formula (A3) to give primary amines of general formula (A9) as depicted in Scheme 1. For deprotection the same procedures apply as described for the synthesis of (A7) from (A6).

    [0959] Primary amines of general formula (A9) in turn can be reacted with heteroaryls of general formula (A8) via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination to give aryl iodides of general formula (A10) applying procedures in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1.

    [0960] Final compounds of general formula (I-B) can be synthesized from aryl iodides of general formula (10) via copper catalyzed Ullmann couplings with heterocycles H-D (A4) or via palladium catalyzed Suzuki couplings with boronic acid derivatives (A5) applying procedures in analogy to those described for the synthesis of compounds (A6) from (A3) in Scheme 1.

    [0961] Yet another approach to compounds of general formula (I-B) starts from monoprotected diamines (1) or their corresponding salts and preassembled heteroaryls (A11a) with X being a leaving group like halogen or S(O)Me via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination to give arylated diamines of general formula (A6). The procedures that can be applied are in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1. Heteroaryls of general formula (A11a) are either commercially available or can be prepared according to procedures available from the public domain (for example via Chan-Lam coupling). Specific examples of (A11a) are described in the subsequent paragraphs.

    [0962] An alternative route for the preparation of compounds of general formula (I-B) and intermediates of general formula (A10) is depicted in Scheme 2.

    ##STR00503##

    [0963] Monoarylated diamines of general formula (A12) can be obtained via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination between monoprotected diamines (A1) or their corresponding salts and heteroaryls (A8) with X being a leaving group such as halogen or S(O)Me. The procedures that can be applied are in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1.

    [0964] Deprotection of diamines of general formula (A12) can give primary amines of general formula (A13). For deprotection the same procedures apply as described for the synthesis of (A7) from (A6) in Scheme 1.

    [0965] Final compounds of general formula (I-B) in turn can be synthesized from primary amines (A13) or their corresponding salts and preassembled heteroaryls (A11a) with X being a leaving group like halogen or S(O)Me via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination. The procedures that can be applied are in analogy to those described for the synthesis of (A6) from (A1) and (A11a) in Scheme 1.

    [0966] For the synthesis of intermediates of general formula (A10) primary amines (A13) or their corresponding salts may be reacted with heteroaryls (A2a) with X being a leaving group like halogen or S(O)Me in a nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination. The procedures that can be applied are in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1.

    [0967] Carboxylic acid derivatives of general formula (A21) may be synthesized according to the route depicted in Scheme 3. Nitro compounds of general formula (A15) can be obtained from reacting monoprotected diamines (A1) or their corresponding salts and nitroaryls (A14) with X being a leaving group like chlorine in a nucleophilic aromatic substitution (S.sub.NAr). The reaction can be carried out in the presence of inorganic bases like K.sub.2CO.sub.3 in polar solvents such as for example DMSO at temperatures between room temperature and the boiling point of the solvent for 2-12 h. Nitroaryls of general formula (A14) are either commercially available or can be prepared according to procedures available from the public domain.

    [0968] Anilines of general formula (A16) may be obtained from nitro compounds of general formula (A15) by reduction. For reduction all methods that are known in the art may be applied. For example, nitro compounds of general formula (A15) can be reacted in the presence of a metal catalyst like palladium on charcoal under an atmosphere of hydrogen gas (1-5 bar) in polar, protic solvents like methanol or ethanol at temperatures between 0? C. and the boiling point of the solvent for 15-24 h.

    ##STR00504## ##STR00505##

    [0969] Pyridones of general formula (A18) may be obtained from anilines (A16) by condensation with oxo-pyranes of general formula (A17) with Alk being methyl or ethyl in polar, protic solvents like ethanol at temperatures between room temperature and the boiling point of the solvent for 2-12 h. Oxo-pyranes of general formula (A17) are either commercially available or can be prepared according to procedures available from the public domain.

    [0970] Primary amines of general formula (A19) may be synthesized from (A18) via removal of the protective group. For deprotection the same procedures apply as described for the synthesis of (A7) from (A6) in Scheme 1.

    [0971] Carboxylic esters of general formula (A20) can be obtained from primary amines (A19) and heteroaryls (A8) via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination applying procedures in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1.

    [0972] Carboxylic acid derivatives of general formula (A21) may be synthesized from carboxylic esters of general formula (A20) by ester hydrolysis. For saponification all methods that are known in the art may be applied. For example, esters (A20) may be reacted with bases like sodium hydroxide in polar, protic solvents like methanol, water or mixtures thereof at temperatures between 0? C. and the boiling point of the solvent for 0.5-2 h. 1,2,4-Triazines of general formula (A29) may be synthesized according to the routes depicted in Scheme 4. The methyl-thioether moiety of 3-(methylthio)-1,2,4-triazine (A22) [CAS 28735-21-9] might be activated for nucleophilic displacement by oxidation for which all methods that are known in the art may be applied. For example, (A22) can be reacted with mCPBA or Oxone? in inert solvents like dichloromethane at temperatures between 0? C. and the boiling point of the solvent for 0.5-2 h. The crude oxidation product may be directly converted to monoarylated diamines of general formula (A23) in a nucleophilic aromatic substitution (S.sub.NAr) by reacting it with primary amines of general formula (A1) in polar solvents such as for example nBuOH at temperatures between room temperature and the boiling point of the solvent for 2-18 hours.

    [0973] Aryl bromides of general formula (A24) can be obtained from triazines of general formula (A23) by bromination. For bromination all methods that are known in the art may be applied. For example, triazines (A23) can be reacted with bromine or N-bromosuccinimide (NBS) in solvents like methanol, water, DMF or mixtures thereof at temperatures between 0? C. and the boiling point of the solvent for 4-15 h.

    [0974] 3,6-Disubstituted triazines of general formula (A27) may be synthesized from aryl bromides (A24) via Suzuki coupling for which all methods that are known in the art may be applied. For example, (A24) may be reacted with potassium trifluoroborates (A25) or trioxatriborinanes (A26) in the presence of a palladium catalyst like CataCXium A Pd G3 [CAS 1651823-59-4] or 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride [CAS 95408-45-0] and a base like Cs.sub.2CO.sub.3, K.sub.2CO.sub.3 or K.sub.3PO.sub.4 in polar solvents such as 1,4-dioxane, THF and water or mixtures thereof at temperatures between room temperature and 120? C. for 8-15 hours. Trifluoroborates of general formula (A25) or trioxatriborinanes (A26) are either commercially available or can be prepared according to procedures available from the public domain.

    ##STR00506## ##STR00507##

    [0975] Primary amines of general formula (A28) may be obtained from (A27) via removal of the protective group. For deprotection the same procedures apply as described for the synthesis of (A7) from (A6) in Scheme 1.

    [0976] Final compounds of general formula (A29) can be synthesized from primary amines (A28) or their corresponding salts and preassembled heteroaryls (All) with X being a leaving group like halogen via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination. The procedures that can be applied are in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1.

    [0977] Heteroaryls of general formula (A11) are either commercially available or can be prepared according to procedures available from the public domain. Specific examples of (All) are described in the subsequent paragraphs.

    [0978] In an alternative route to triazines of general formula (A29), primary amines (A28) or their corresponding salts may be first reacted with heteroaryls (A2) with X being a leaving group like halogen via nucleophilic aromatic substitution (S.sub.NAr) or palladium catalyzed Buchwald-Hartwig amination to give aryl iodides of general formula (A30). The procedures that can be applied are in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1.

    [0979] Heteroaryls of general formula (A2) are either commercially available or can be prepared according to procedures available from the public domain.

    [0980] Final compounds of general formula (A29) can be synthesized from aryl iodides of general formula (A30) via copper catalyzed Ullmann couplings with heterocycles H-D (A4) or via palladium catalyzed Suzuki couplings with boronic acid derivatives (A5) applying procedures in analogy to those described for the synthesis of compounds (A6) from (A3) in Scheme 1.

    [0981] In an alternative approach to 3,6-disubstituted triazines of general formula (A27), ketoacetals of general formula (A31) may be reacted with methyl hydrazinecarbimidothioate (A32) or its corresponding salts in polar solvents such as for example methanol at temperatures between room temperature and the boiling point of the solvent for 5-12 h to give triazine thioethers of general formula (A33) [for a similar approach to triazine thioethers see Duan 2012]. Ketoacetals of general formula (A31) and methyl hydrazinecarbimidothioate (A32) are either commercially available or can be prepared according to procedures available from the public domain.

    [0982] Triazine thioethers of general formula (A33) in turn could be transferred to 3,6-disubstituted triazines of general formula (A27) by a two-step approach including oxidation of (A33) followed by nucleophilic aromatic substitution (S.sub.NAr) with primary amines of general formula (A1) applying procedures in analogy to those described for the synthesis of compounds (A23) from (A22) in Scheme 4.

    [0983] Carboxylic ester or amide derivatives of general formulae (A35) and (A37) may be synthesized according to the routes depicted in Scheme 5. Carboxylic esters of general formula (A35) may be obtained from primary amines (A7) [see Scheme 1] and triazines of general formula (A34) via nucleophilic aromatic substitution (S.sub.NAr) applying procedures in analogy to those described for the synthesis of (A3) from (A1) and (A2a) in Scheme 1. For example, (A7) and (A34) can be reacted in the presence of an organic base like DIPEA in polar solvents such as NMP at temperatures between room temperature and the boiling point of the solvent for 0.5-2 h applying microwave heating. Triazines of general formula (A34) are either commercially available or can be prepared according to procedures available from the public domain.

    [0984] Carboxamides of general formula (A37) can be obtained from carboxylic esters (A35) via direct amidation. For amidation reactions all methods that are known in the art may be applied. For example, esters (A35) can be reacted with amines (A36) in polar solvents such as methanol, ethanol or THE at temperatures between room temperature and the boiling point of the solvent for 1-5 hours. If an amine (A36) of limited nucleophilicity is used it is possible to increase the temperature and prolong the reaction time and/or to add Lewis acids like AIMe.sub.3.

    ##STR00508##

    [0985] Alternatively, esters (A35) may first be hydrolyzed to carboxylic acids of general formula (A38).

    [0986] For saponification all methods that are known in the art may be applied. For example, esters (A35) may be reacted with bases like sodium hydroxide, lithium hydroxide or potassium hydroxide in polar, protic solvents like water or methanol or mixtures thereof at temperatures between 0 00 and the boiling point of the solvent for 0.5-24 hours. In certain cases it might be beneficial to add ethers like THE or 1,4-dioxane to the reaction mixture.

    [0987] Carboxamides of general formula (A37) in turn can be obtained from carboxylic acids (A38) via amide coupling with appropriate amines (A36). For amide coupling all methods that are known from peptide chemistry in the art may be applied. For example, acids (A38) may be reacted with amines (A36) in polar, aprotic solvents like DMF, acetonitrile or NMP via an activated acid derivative. These activated derivatives can be obtained from acids (A38) with reagents such as HOBt, HOAt or N-hydroxysuccinimide and a carbodiimide such as DCC or EDC or else with preformed reagents like HATU, PyBOP or T3P?. In order to increase reactivity a suitable base such as DIPEA or triethylamine can be used. In certain cases, the activated acid derivative might be isolated prior to the reaction with the amine (A36). Amide formation might also be accomplished via the acid halide (which can be formed from a carboxylic acid by reaction with e.g. oxalyl chloride, thionyl chloride or sulfuryl chloride), mixed anhydride (which can be formed from a carboxylic acid by reaction with e.g. isobutylchloroformate), imidazolide (which can be formed from a carboxylic acid by reaction with e.g. CDI) or azide (which can be formed from a carboxylic acid by reaction with DPPA).

    [0988] For the synthesis of final compounds of general formula (B-2) routes and methods comparable to the ones described in Schemes 1-5 may be applied. Without being intended to be limiting the routes to compounds of general formula (A43) in Schemes 6-7 are given for further illustration. Diamines of general formula (A39) are either commercially available or can be prepared according to procedures available from the public domain.

    ##STR00509##

    ##STR00510##

    [0989] Further compounds with different formulae as described above can be prepared by similar methods.

    EXPERIMENTAL SECTION

    [0990] NMR peak forms are stated as they appear in the spectra, possible higher order effects have not been considered.

    [0991] The following table lists the abbreviations used in this paragraph and in the examples section as far as they are not explained within the text body. Other abbreviations have their meanings customary per se to the skilled person.

    Abbreviations

    [0992] Aq Aqueous [0993] BINAP 2,2-Bis(diphenylphosphaneyl)-1,1-binaphthalene [0994] Boc tert-Butoxycarbonyl [0995] Brine Saturated aqueous sodium chloride solution [0996] nBuOH Butan-1-ol [0997] CataCXium A Di(adamantan-1-yl)(butyl)phosphane (CAS Registry Number 321921-71-5) [0998] CataCXium A Pd G3 Methanesulfonato(diadamantyl-n-butylphosphino)-2-amino-1,1 biphenyl-2-yl)palladium(II) precatalyst generation 3 [0999] CDI 1,1-Carbonyldiimidazole [1000] CHAPS 3-[(3-Cholamidopropyl)dimethylammonio]-1-propanesulfonate [1001] m-CPBA 3-Chlorobenzoperoxoic acid [1002] DavePhos 2-(Dicyclohexylphosphaneyl)-N,N-dimethyl-[1,1-biphenyl]-2-amine (CAS Registry Number 213697-53-1) [1003] dba (all-trans)-Dibenzylideneacetone [1004] DCC Dicyclohexylcarbodiimide [1005] DCM Dichloromethane [1006] DEA Diethylamine [1007] DIPEA N-ethyl-N-isopropyl-propan-2-amine [1008] DMA N,N-Dimethylacetamide [1009] DME Dimethoxyethane [1010] DMF N,N-Dimethylformamide [1011] DMSO Dimethyl sulfoxide [1012] DPPA Diphenyl phosphorazidate [1013] dppf 1,1-Bis(diphenylphosphino)ferrocene [1014] EDC 2-(((Ethylimino)methylene)amino)-N,N-dimethylethan-1-amine hydrochloride [1015] ESI Electrospray ionization [1016] EtOAc Ethyl acetate [1017] EtOH Ethanol [1018] FA Formic acid [1019] G3 Generation 3 [1020] Gmean Geometric mean [1021] HATU (1-(Bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium-3-oxo hexafluorophosphate [1022] HEPES (4-(2-Hydroxyethyl)-1-piperazineethanesulfonic acid) [1023] HOAt 3H-[1,2,3]Triazolo[4,5-b]pyridin-3-ol [1024] HOBt 1H-Benzo[d][1,2,3]triazol-1-ol [1025] HPLC High performance liquid chromatography [1026] HRMS High resolution mass spectrometry [1027] i-PrOH Propan-2-ol [1028] IC.sub.50 Half maximal inhibitory concentration [1029] K.sub.D Dissociation constant [1030] MeCN Acetonitrile [1031] MeOH Methanol [1032] MS Mass spectrometry [1033] MTBD 7-Methyl-1,5,7-triazabicyclo[4.4.0]dec-5-ene [1034] MTBE Methyl tert-butyl ether [1035] MW Microwave [1036] NBS N-Bromosuccinimide [1037] NCS 1-Chloropyrrolidine-2,5-dione [1038] NIS 1-lodopyrrolidine-2,5-dione [1039] NMP 1-Methylpyrrolidin-2-one [1040] NMR Nuclear magnetic resonance [1041] O.n Overnight [1042] Otf Trifluoromethanesulfonate [1043] Pd-118/PdCl.sub.2(dtbpf) [1,1-Bis(di-tert-butylphosphino)ferrocene]dichloropalladium(II) [1044] Pd.sub.2(dba).sub.3 Tris(dibenzylideneacetone)dipalladium (0) [1045] Pd.sub.2(dba).sub.3-CHCl.sub.3 Tris(dibenzylideneacetone)dipalladium(0) chloroform adduct [1046] Pd(dppf)Cl.sub.2-DCM [1,1-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) [1047] CH.sub.2Cl.sub.2 (1:1) [1048] PdCl.sub.2(dppf) [1,1-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) [1049] Pd-PEPPSI-IpentCl [1050] 2-methylpyridine (SP-4-1)-[1,3-Bis[2,6-bis(1-ethylpropyl)phenyl]-4,5-dichloro-1,3-dihydro-2H-imidazol-2-ylidene]dichloro(2-methylpyridine)palladium (CAS Registry Number 1612891-29-8) [1051] PE Petroleum ether [1052] PG Protective group [1053] prep. Preparative [1054] PyBOP ((1H-Benzo[d][1,2,3]triazol-1-yl)oxy)tri(pyrrolidin-1-yl)phosphonium hexafluorophosphate [1055] qToF Quadrupole time-of-flight [1056] RockPhos Di-tert-butyl(2,4,6-triisopropyl-3-methoxy-6-methyl-[1,1-biphenyl]-2-yl)phosphine [1057] rt Room temperature [1058] sat. Saturated [1059] SFC Supercritical fluid chromatography [1060] S.sub.NAr Nucleophilic aromatic substitution [1061] T3P 2,4,6-Tripropyl-1,3,5,2,4,6-trioxatriphosphinane 2,4,6-trioxide [1062] TEA Triethylamine [1063] TFA Trifluoroacetic acid [1064] TFAA 2,2,2-Trifluoroacetic anhydride [1065] THE Tetrahydrofurane [1066] TLC Thin layer chromatography [1067] TMEDA N.sup.1N.sup.1,N.sup.2,N.sup.2-Tetramethylethane-1,2-diamine [1068] t.sub.R Retention time [1069] UPLC Ultra high performance liquid chromatography [1070] XantPhos 4,5-Bis(diphenylphosphino)-9,9-dimethylxanthene, (9,9-dimethyl-9H-xanthene-4,5-diyl)bis(diphenylphosphine) [1071] XPhos Dicyclohexyl(2 4,6-triisopropyl-[1,1-biphenyl]-2-yi)phosphane

    Units

    [1072] atm atmosphere [1073] C Celcius [1074] g gram [1075] h hour(s) [1076] Hz hertz [1077] L liter [1078] M mole per liter [1079] mg milligram [1080] MHz megahertz [1081] min minute(s) [1082] mL milliliter [1083] mm millimeter [1084] mM millimole per liter [1085] mol mole [1086] mmol millimole(s) [1087] nA nanoampere [1088] nL nanolitre [1089] ?m micrometer [1090] ?L microliter [1091] N equivalents per liter [1092] nm nanometer [1093] ppm parts per million [1094] ? Angstrom

    [1095] The various embodiments described in this application are illustrated by the following examples which are not meant to limit the compound of Formula (I) in any way.

    [1096] The example testing experiments described herein serve to illustrate the present embodiments and is not limited to the examples given.

    Experimental SectionGeneral Part

    General Conditions

    [1097] (i) operations were carried out at room temperature (rt), i.e. in the range 17 to 28? C. and were needed under an atmosphere of an inert gas such as N.sub.2; [1098] (ii) where reactions refer to being degassed or purged, this can be performed for example by purging the reaction solvent with a constant flow of nitrogen for a suitable period of time (for example 5 to 10 min) or by repeatedly evacuating the vessel and backfill with appropriate inert atmosphere (for example nitrogen (g) or argon (g)); [1099] (iii) where reactions refer to the use of a microwave reactor, one of the following microwave reactors were used: Biotage Initiator, Personal Chemistry Emrys Optimizer, Personal Chemistry Smith Creator or CEM Explorer; [1100] (iv) in general, the course of reactions was followed by thin layer chromatography (TLC) and/or analytical high performance liquid chromatography (HPLC or UPLC) which was usually coupled to a mass spectrometer (LCMS); [1101] (v) to remove excess water, organic solutions were dried over anhydrous MgSO.sub.4 or Na.sub.2SO.sub.4, or by using ISOLUTE? Phase Separator, and work-up procedures were carried out using traditional phase separating techniques; [1102] (vi) evaporations were carried out either by rotary evaporation in vacuo or in a Genevac? HT-4/EZ-2 or Biotage? V10; [1103] (vii) unless otherwise stated, flash column chromatography was performed on normal phase silica, using either Merck Silica Gel (Art. 9385) or pre-packed cartridges such as Biotage? SNAP cartridges (40-63 ?m silica, 4-330 g), Biotage? Sfar Silica HC D cartridges (20 ?m, 10-100 g), Interchim puriFlash? cartridges (25 ?m, 4-120 g), Interchim puriFlash? cartridges (50 ?m, 25-330 g), Grace? GraceResolv? Silica Flash Cartridges (4-120 g) or Agela Flash Colum Silica-CS cartridges (80-330 g), or on reverse phase silica using Agela Technologies C-18, spherical cartridges (20-35 ?m, 100 A, 80-330 g), manually or automated using a Grace Reveleris? X2 Flash system or similar system; [1104] (viii) preparative reversed phase HPLC and preparative reversed phase SFC were performed using standard HPLC and SFC instruments, respectively, equipped with either a MS and/or UV triggered fraction collecting instrument, using either isocratic or a gradient of the mobile phase as described in the experimental section; [1105] relevant fractions were collected, combined and freeze-dried or evaporated to give the purified compound or relevant fractions were collected, combined and concentrated at reduced pressure, extracted with DCM or EtOAc, and the organic phase was dried either over Na.sub.2SO.sub.4 or by using a phase-separator, and then concentrated at reduced pressure to give the purified compound; [1106] (ix) chiral preparative chromatography was carried out using HPLC or SFC on a standard HPLC or SFC instrument, respectively, and using either isocratic or gradient run with mobile phase as described in the experimental section; [1107] (x) preparative thin layer chromatography (TLC) was performed using TLC glass plates and applying a suitable solvent or mixture of solvents; [1108] (xi) yields, where present, are not necessarily the maximum attainable, and some, reactions were repeated if a larger amount of the reaction product was required; [1109] (xii) where certain compounds were obtained as an acid-addition salt, for example a mono-hydrochloride salt or a di-hydrochloride salt, the stoichiometry of the salt was based on the number and nature of the basic groups in the compound, the exact stoichiometry of the salt was generally not determined, for example by means of elemental analysis data. Where stated the salts were treated according to literature-known processes to generate the corresponding free base prior to being used; [1110] (xiii) in general, the structures of the end-products of the Formula (I) were confirmed by nuclear magnetic resonance (NMR) and/or mass spectral techniques; proton NMR chemical shift values were measured on the delta scale using Bruker Avance III 300, 400, 500 and 600 spectrometers, operating at .sup.1H frequencies of 300, 400, 500 and 600 MHz, respectively. The experiments were typically recorded at 25? C. Chemical shifts are given in ppm with the solvent as internal standard. Protons on heteroatoms such as NH and OH protons are only reported when detected in NMR and can therefore be missing. In certain instances, protons can be masked or partially masked by solvent peaks and will therefore either be missing and not reported or reported as multiplets overlapping with solvent. The following abbreviations have been used (and derivatives thereof, e.g. dd, doublet of doublets, etc.): s, singlet; d, doublet; t, triplet; q, quartet; m, multiplet; br, broad; qn, quintet; p, pentet. Electrospray mass spectral data were obtained using a Waters Acquity UPLC coupled to a Waters single quadrupole mass spectrometer or similar equipment, acquiring both positive and negative ion data, and generally, only ions relating to the parent structure are reported; high resolution electrospray mass spectral data were obtained using a Waters XEVO qToF mass spectrometer or similar equipment, coupled to a Waters Acquity UPLC, acquiring either positive and negative ion data, and generally, only ions relating to the parent structure are reported; [1111] (xiv) intermediates were in certain cases not fully purified but their structures and purity were assessed by TLC, analytical HPLC/UPLC, and/or NMR analysis and/or mass spectrometry; [1112] (xv) certain intermediates were isolated as TFA salts and can contain excess TFA. The excess can be calculated from the weight of the crude sample. Where stated the salts were treated according to literature-known processes to generate the corresponding free base prior to being used; [1113] (xvi) unless stated otherwise compounds containing an asymmetric carbon and/or sulfur atom were not resolved; [1114] (xvii) in general Examples and Intermediate compounds are named using ChemDraw Professional version 21.0.0.28 from PerkinElmer. ChemDraw Professional version 21.0.0.28 generates the names of chemical structures using the Cahn-Ingold-Prelog (CIP) rules for stereochemistry and follows IUPAC rules as closely as possible when generating chemical names. Stereoisomers are differentiated from each other by stereodescriptors cited in names and assigned in accordance with the CIP rules.

    [1115] Where applicable ChemDraw is using labels in the graphical representation of stereocenters such as & and or to describe the configuration of the stereochemical centers present in the structure. A number following the & and or flag is assigned to each stereocenter present.

    [1116] In some cases, the purification methods as described above can provide those compounds of Formula (I) which possess a sufficiently basic or acidic functionality in the form of a salt, such as, in the case of a compound of Formula (I) which is sufficiently basic, a trifluoroacetate or formate salt for example, or, in the case of a compound of Formula (I) which is sufficiently acidic, an ammonium salt for example. A salt of this type can either be transformed into its free base or free acid form, respectively, by various methods known in the art or be used as salt in subsequent biological assays. It is to be understood the specific form (e.g. salt, free base etc.) of a compound of Formula (I) as isolated and as described herein is not necessarily the only form in which said compound can be applied to a biological assay in order to quantify the specific biological activity.

    Purification Methods

    Preparative HPLC Methods:

    [1117] PrepMethod A: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeOH in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1118] PrepMethod B: The compound was purified by preparative HPLC on a YMC-Actus Triart C18 ExRS column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1119] PrepMethod C: The compound was purified by preparative HPLC on a Xbridge? Shield RP18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1120] PrepMethod D: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1121] PrepMethod E: The compound was purified by preparative HPLC on a Waters Xselect CSH C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/FA (0.1%) buffer system as mobile phase; [1122] PrepMethod F: The compound was purified by preparative HPLC on a Xbridge? C18 column (10 ?m, 250?50 mm ID) using a gradient of MeCN in H.sub.2O/MeCN/NH.sub.3 (95/5/0.2) buffer system as mobile phase; [1123] PrepMethod G: The compound was purified by preparative HPLC on a Kromasil C.sub.8 column (10 ?m, 250?20 mm ID) using a gradient of MeCN in H.sub.2O/MeCN/FA (95/5/0.2) buffer system as mobile phase; [1124] PrepMethod H: The compound was purified by preparative HPLC on a Xbridge? C18 column (10 ?m, 250?19 mm ID) using a gradient of MeCN in H.sub.2O/MeCN/NH.sub.3 (95/5/0.2) buffer system as mobile phase; [1125] PrepMethod I: The compound was purified by preparative HPLC on a Xbridge? C18 ODB column (5 ?m, 150?19 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM, pH 9) buffer system as mobile phase; [1126] PrepMethod J: The compound was purified by preparative HPLC on a Waters? Sunfire? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/FA (0.1%) as mobile phase; [1127] PrepMethod K: The compound was purified by preparative HPLC on a YMC-Actus Triart C18 column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1128] PrepMethod L: The compound was purified by preparative HPLC on a Waters? Sunfire? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1129] PrepMethod M: The compound was purified by preparative HPLC on a YMC-Actus Triart C18 column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1130] PrepMethod N: The compound was purified by preparative HPLC on a Xbridge? OBD Phenyl column (5 ?m, 150?19 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1131] PrepMethod 0: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1132] PrepMethod P: The compound was purified by preparative HPLC on a Waters Xselect CSH C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O as mobile phase; [1133] PrepMethod Q: The compound was purified by preparative HPLC on a Xbridge? Shield RP18 OBD column (5 ?m, 250?19 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1134] PrepMethod R: The compound was purified by preparative HPLC on a Waters? Sunfire? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/FA (10 mM) as mobile phase; [1135] PrepMethod S: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM) buffer system as mobile phase; [1136] PrepMethod T: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of 20 mM NaOH+10% MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1137] PrepMethod U: The compound was purified by preparative HPLC on a Xbridge? OBD Phenyl column (5 ?m, 250?19 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1138] PrepMethod V: The compound was purified by preparative HPLC on a Xbridge? OBD Phenyl column (5 ?m, 250?19 mm ID) using a gradient of MeCN in a H.sub.2O/TFA (0.05%) buffer system as mobile phase; [1139] PrepMethod X: The compound was purified by preparative HPLC on a YMC-Actus Triart C18 ExRS column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1140] PrepMethod Y: The compound was purified by preparative HPLC on a Xbridge? Shield RP18 OBD column (5 ?m, 100?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1141] PrepMethod Z: The compound was purified by preparative HPLC on a Waters Xselect Peptide CSH C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in H.sub.2O/FA (0.1%) buffer system as mobile phase; [1142] PrepMethod Z1: The compound was purified by preparative HPLC on a Waters Xselect Peptide CSH C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1143] PrepMethod Z2: The compound was purified by preparative HPLC on a Waters Xselect CSH C18 OBD column (5 ?m, 150?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1144] PrepMethod Z3: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 100?30 mm ID) using a gradient of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1145] PrepMethod Z4: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 250?19 mm ID) using a gradient of MeCN in a H.sub.2O/TFA (0.005%) buffer system as mobile phase; [1146] PrepMethod Z5: The compound was purified by preparative HPLC on a Waters Xselect CSH C18 OBD column (5 ?m, 250?19 mm ID) using a gradient of MeOH in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.05%, aq) buffer system as mobile phase; [1147] PrepMethod Z6: The compound was purified by preparative HPLC on a Xbridge? Shield RP18 OBD column (5 ?m, 100?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1148] PrepMethod Z7: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 100?50 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase; [1149] PrepMethod Z8: The compound was purified by preparative HPLC on a Xbridge? RP18 OBD column (5 ?m, 100?30 mm ID) using a gradient of MeCN in H.sub.2O/NH.sub.4HCO.sub.3 (10 mM)/NH.sub.3 (0.1%, aq) buffer system as mobile phase.

    [1150] PrepMethod Z9: The compound was purified by preparative HPLC on a Xbridge? 08 column (5 ?m, 250?20 mm ID) using a gradient of MeCN in H.sub.2O/MeCN/NH.sub.3 (95/5/0.2) buffer system as mobile phase; [1151] PrepMethod Z10: The compound was purified by preparative HPLC on a Xbridge? 08 column (5 ?m, 250?50 mm ID) using a gradient of MeCN in H.sub.2O/MeCN/NH.sub.3 (95/5/0.2) buffer system as mobile phase.

    Preparative SFC Methods:

    [1152] PrepMethod SFC-A: The compound was purified by preparative SFC on a Waters? BEH (5 ?m, 250?30 mm ID) using MeOH/H.sub.2O (NH.sub.3, 50 mM) (97/3) in CO.sub.2 as mobile phase; [1153] PrepMethod SFC-B: The compound was purified by preparative SFC on a Phenomenex Luna Hilic (3.5 ?m, 100?3 mm ID) using MeOH/NH.sub.3 20 mM in CO.sub.2 as mobile phase; [1154] PrepMethod SFC-C: The compound was purified by preparative SFC on a Waters? Acquity UPC2 BEH (3.5 ?m, 100?3 mm ID) using MeOH/H.sub.2O (NH.sub.3, 50 mM) (97/3) in CO.sub.2 as mobile phase; [1155] PrepMethod SFC-D: The compound was purified by preparative SFC on a Waters? BEH (5 ?m, 250?30 mm ID) using MeOH/NH.sub.3 (20 mM) in CO.sub.2 as mobile phase; [1156] PrepMethod SFC-E: The compound was purified by preparative SFC on a Phenomenex Luna Hilic (5 ?m, 250?30 mm ID) using MeOH/NH.sub.3 20 mM in CO.sub.2 as mobile phase.

    Preparative HPLC Methods for Parallel Experiment Set-Up:

    [1157] PrepMethod Parallel A: The compound was purified by preparative HPLC on a Waters? Xbridge? C18 column (5 ?m, 100?10 mm ID) using a gradient (2-94%) of MeCN in H.sub.2O/NH.sub.3 (pH 10) buffer system as mobile phase; [1158] PrepMethod Parallel B: The compound was purified by preparative HPLC on a Waters? Xselect? CSH Fluoro Phenyl column (5 ?m, 100?10 mm ID) using a gradient (2-94%) of MeCN in H.sub.2O/FA (pH 3) buffer system as mobile phase; [1159] PrepMethod Parallel C: The compound was purified by preparative HPLC on a Waters? Xbridge? C18 OBD column (5 ?m, 150?19 mm ID) using a gradient (5-95%) of MeCN in H.sub.2O/MeCN/NH.sub.3 (95/5/0.2) (pH 10) buffer system as mobile phase; [1160] PrepMethod Parallel D: The compound was purified by preparative HPLC on a Xbridge? C18 OBD column (5 ?m, 150?19 mm ID) using a gradient (5-95%) of MeCN in a H.sub.2O/NH.sub.4HCO.sub.3 (10 mM) (pH 9) buffer system as mobile phase.

    Synthesis Methods

    General Method 1 (GM1): Nucleophilic Aromatic Substitution (S.SUB.N.Ar)

    Condition a (GM1A): Conventional Heating

    [1161] To a solution of the respective amine nucleophile or its salt (1 eq.) in DMSO (alternatively NMP or n-BuOH or 1,4-dioxane) is added base (1-7 eq.) and the respective heteroaryl electrophile (0.9-2 eq.) at rt and the resulting mixture stirred under heating (100-130? C.) until TLC and/or LCMS indicate complete consumption of the starting material (typically overnight). The reaction mixture is either concentrated under reduced pressure and the obtained crude material subjected to chromatography or prep. TLC and/or prep. HPLC to give the desired aniline product.

    [1162] In an alternative aqueous work-up, the reaction mixture is poured into sat. brine or water and extracted with EtOAc. The combined organic layers are washed with water or brine, dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained crude material subjected to chromatography on silica to give the desired aniline product.

    Condition B (GM1B): Microwave Heating

    [1163] To a mixture of the respective amine nucleophile or its salt (1 eq.) and the respective heteroaryl electrophile (1-1.5 eq.) in a microwave vial is added NMP and base (1-3 eq.), the vial capped and heated under microwave radiation until TLC and/or LCMS indicate consumption of the starting material (typically 0.5-2 h). The reaction mixture is concentrated under reduced pressure and the obtained crude material subjected to prep. HPLC to give the desired aniline product.

    General Method 2 (GM2): Buchwald-Hartwiq Amination

    [1164] A solution of the respective amine nucleophile or its salt (1 eq.) in 1,4-dioxane under nitrogen at rt is treated with the respective heteroaryl electrophile (0.5-4 eq.), Cs.sub.2CO.sub.3 (1.2-5 eq.) and Pd PEPPSI-IpentCl [CAS 1612891-29-8] (3-7 mol %) and the reaction mixture stirred under heating (100? C.) until TLC and/or LCMS indicate complete consumption of the starting material (typically overnight). The reaction mixture is either filtered through a pad of Celite or silica, the filter cake washed with EtOAc and the combined filtrates concentrated under reduced pressure. The obtained crude material is either triturated with PE/EtOAc or subjected to prep. TLC and/or prep. HPLC to give the desired aniline product.

    [1165] In an alternative aqueous work-up, the reaction mixture is concentrated under reduced pressure and the residue partitioned between EtOAc and water. The phases are separated and the aqueous phase is extracted with EtOAc. The combined organic layers are washed with water and/or brine, dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained crude material subjected to prep. TLC and/or prep. HPLC to give the desired aniline product.

    General Method 3 (GM3): Ullmann Coupling

    [1166] A solution of the respective aryl halide (1 eq.) in 1,4-dioxane under nitrogen at rt is treated with the respective heteroatom nucleophile H-D (A4) (1-10 eq.), Cs.sub.2CO.sub.3 (3-6 eq.), Cu(I)I (0.2-2 eq.) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine [CAS 67579-81-1] (0.2-2 eq.) and the reaction mixture stirred under heating (80-100? C.) until TLC and/or LCMS indicate complete consumption of the starting material (typically 15-18). The reaction mixture is diluted with EtOAc and washed sequentially with water and brine. Alternatively, the reaction mixture is diluted with water or brine and the aqueous layer extracted with EtOAc. The organic layer is dried over Na.sub.2SO.sub.4, filtered and evaporated. The obtained crude material is either triturated with PE/EtOAc or subjected to prep. TLC and/or prep. HPLC to give the desired coupling product.

    [1167] In an alternative non-aqueous work-up, the reaction mixture is filtered through a pad of Celite, the filter cake washed with DCM and the combined filtrates concentrated under reduced pressure. The obtained crude material is subjected to prep. TLC and/or prep. HPLC to give the desired coupling product.

    General Method 4 (GM4): Suzuki Coupling

    [1168] Condition a (GM4A): Coupling with Boronic Acid Derivatives

    [1169] A solution of the respective aryl halide (1 eq.) in a mixture of 1,4-dioxane and water under nitrogen at rt is treated with the respective boronic acid derivative (A5) (1.5-2 eq.) or (A26) (10 eq.), Cs.sub.2CO.sub.3 (3 eq.) or K.sub.2CO.sub.3 (3 eq.) or K.sub.3PO.sub.4 (2-3 eq.) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride [CAS 95408-45-0] (5-10 mol %) or 1,1-bis(diphenylphosphino)ferrocene palladium dichloride [CAS 72287-26-4] (10 mol %) and the reaction mixture stirred under heating (80-100? C.) until TLC and/or LCMS indicate complete consumption of the starting material (2-18). The reaction mixture is filtered through a pad of Celite, the filter cake washed with DCM and the combined filtrates concentrated under reduced pressure. The obtained crude material is subjected to prep. TLC and/or prep. HPLC to give the desired coupling product.

    [1170] In an alternative aqueous work-up, the reaction mixture is diluted with water, the phases separated and the aqueous phase extracted with EtOAc. The combined organic layers are dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained crude material subjected to prep. TLC and/or C18-flash chromatography or prep. HPLC to give the desired coupling product.

    Condition B (GM4B): Coupling with Trifluoroborates

    [1171] A solution of the respective aryl halide (1 eq.) in 1,4-dioxane under nitrogen at rt is treated with the respective potassium trifluoroborate (A25) (4 eq.), Cs.sub.2CO.sub.3 (4 eq.) and CataCXium A Pd G3 [CAS 1651823-59-4] (20 mol %) and the reaction mixture stirred under heating (100? C.) until TLC and/or LCMS indicate complete consumption of the starting material (typically 15). The reaction mixture is filtered through a pad of Celite, the filter cake washed with DCM and the combined filtrates concentrated under reduced pressure. The obtained crude material is subjected to prep. TLC and/or prep. HPLC to give the desired coupling product.

    General Method 5 (GM5): Chan-Lam Coupling

    [1172] A mixture of the respective heteroatom nucleophile H-D (A4) (1 eq.) in 1,4-dioxane at rt is treated with the respective boronic acid (2-3 eq.), TMEDA (3 eq.) and Cu(Otf).sub.2 (1.2-2 eq.) and the reaction mixture stirred under heating (100? C.) until TLC and/or LCMS indicate complete consumption of the starting material (typically 16). The reaction mixture is filtered through a pad of Celite, the filtrate concentrated under reduced pressure and the residue partitioned between EtOAc and water. The aqueous layer is extracted with EtOAc, the combined organic layers washed with water, dried over Na.sub.2SO.sub.4, filtered and evaporated. The obtained crude material is subjected to C18-flash chromatography to give the desired coupling product.

    General Method 6 (GM6): Boc Deprotection

    [1173] Condition A (GM6A): Deprotection with HCl

    [1174] A solution of the respective Boc protected amine (1 eq.) in MeOH at rt is treated with 4 M HCl in MeOH (13-77 eq.) and the reaction mixture stirred under heating (60-80? C.) until TLC and/or LCMS indicate complete consumption of the starting material (typically 2-3). The reaction mixture is concentrated under reduced pressure to give the desired amine as (an unspecified) HCl salt.

    Condition B (GM6B): Deprotection with TFA

    [1175] A solution of the respective Boc protected amine (1 eq.) in DCM at rt is treated with TFA (11-190 eq.) and the reaction mixture stirred at rt until TLC and/or LCMS indicate complete consumption of the starting material (3-16). The reaction mixture is concentrated under reduced pressure to give the desired amine as (an unspecified) TFA salt.

    General Method 7 (GM7): Amide Formation

    [1176] In a microwave vial a solution of the respective ester (A35) in MeOH is treated with the respective amine or its salt (A36) (4-100 eq., neat or as a solution in THF) and where applicable additionally with DIPEA (4-8 eq.) at rt. The vial is capped, and the reaction mixture stirred at rt or heating (60-70? C.) until TLC and/or LCMS indicate complete consumption of the starting material (3). The reaction mixture is concentrated under reduced pressure and the obtained crude material subjected to preparative HPLC to give the desired amide.

    General Method 8 (GM8): Methyl-thioether Oxidation

    [1177] A solution of the methyl-thioether (1 eq.) in DCM is cooled to 0? C. and treated slowly with 3-chlorobenzoperoxoic acid (m-CPBA) [CAS 937-14-41 (0.9-1.2 eq.) and the resulting mixture stirred at rt until TLC and/or LCMS indicate complete consumption of the starting material (0.5-2). The reaction mixture is directly used in the next step.

    [1178] Alternatively, the reaction mixture is concentrated under reduced pressure and the obtained crude material is subjected to flash chromatography on silica to give the desired oxidation product.

    INTERMEDIATES

    Intermediate 1

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    Step A. i-1a

    tert-Butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate

    [1179] ##STR00511##

    [1180] According to GM1A 2-fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (2.23 g, 9.99 mmol) was added to tert-butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (2.00 g, 9.99 mmol) and K.sub.2CO.sub.3 (2.76 g, 20 mmol) in DMSO (30 mL). The resulting solution was stirred at 125? C. for 18 h under a nitrogen atmosphere. The reaction mixture was diluted with EtOAc (50 mL) and washed with water (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated. The crude material was purified by flash chromatography on silica (gradient: 0-50% EtOAc in PE) to give the title compound (2.70 g, 67%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 403.9.

    Step B. i-1b

    tert-Butyl ((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate

    [1181] ##STR00512##

    [1182] In a slight modification of GM3 rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (CAS Reg. No. 67579-81-1) (0.212 g, 1.49 mmol) and Cu(I)I (0.283 g, 1.49 mmol) were added to tert-butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate compound i-1a (3.0 g, 7.44 mmol), K.sub.2CO.sub.3 (3.08 g, 22.3 mmol) and pyridin-2(1H)-one (CAS Reg. No. 142-08-5) (1.42 g, 14.9 mmol) in 1,4-dioxane (20 mL). The resulting solution was stirred at 110? C. for 18 h under a nitrogen atmosphere. The reaction mixture was diluted with EtOAc (25 mL) and washed sequentially with water (3?25 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated. The crude material was triturated with EtOAc:PE (5:1) to give a solid which was collected by filtration and dried under vacuum to give the title compound (2.70 g, 98%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 371.2.

    Step C. i-1c

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    [1183] ##STR00513##

    [1184] In a modification of GM6A HCl (2 M in diethyl ether, 27 mL, 54 mmol) was added slowly to tert-butyl ((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-1b (1.0 g, 2.70 mmol) in DCM (10 mL) at 25? C. The resulting mixture was stirred at 25? C. for 3 h. This synthesis procedure was repeated for a second batch of tert-butyl ((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-1b (1.7 g, 4.6 mmol). The two batches were combined and concentrated. The crude product was recrystallised with EtOAc:PE (5:1) to give a solid which was collected by filtration and dried under vacuum to give an unspecified HCl salt of the title compound (2.5 g, 100%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 270.9.

    Intermediate 3

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-3-methoxy-2H-[1,3-bipyridin]-2-one?2 HCl

    Step A. i-3a

    tert-Butyl ((1S,3S)-3-((3-methoxy-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate

    [1185] ##STR00514##

    [1186] According to GM3 tert-butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate compound i-1a (500 mg, 1.24 mmol), 3-methoxypyridin-2(1H)-one (CAS Reg. No. 20928-63-6) (776 mg, 6.20 mmol), rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (176 mg, 1.24 mmol), Cs.sub.2CO.sub.3 (2020 mg, 6.20 mmol) and Cu(I)I (236 mg, 1.24 mmol) were reacted in 1,4-dioxane (5 mL) at 100? C. for 15 h to give after aqueous work-up and preparative TLC (MeOH:DCM=1:20) the title compound (387 mg, 78%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 401.3.

    Step B. i-3b

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-3-methoxy-2H-[1,3-bipyridin]-2-one?2 HCl

    [1187] ##STR00515##

    [1188] According to GM6A3 tert-butyl ((1S,3S)-3-((3-methoxy-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-3a (370 mg, 0.92 mmol) was reacted with 4 M HCl in MeOH (10 mL, 40 mmol) in MeOH (15 mL) at 60? C. for 2 h to give the crude title compound (340 mg, 99%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 301.1.

    Intermediate 6

    i-6a

    1-(6-Chloropyridin-3-yl)-1,8-naphthyridin-2(1H)-one

    [1189] ##STR00516##

    [1190] According to GM5 (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. 444120-91-6) (1.29 g, 8.21 mmol), 1,8-naphthyridin-2(1H)-one (CAS Reg. No. 15936-09-1) (600 mg, 4.11 mmol), N.sup.1,N.sup.1,N.sup.2,N.sup.2-tetramethylethane-1,2-diamine (1431 mg, 12.32 mmol) and Cu(Otf).sub.2 (1782 mg, 4.93 mmol) were reacted in 1,4-dioxane (10 mL) at 100? C. for 16 h to give upon purification by C18-flash chromatography (gradient: 5-43% MeCN in water+0.1% NH.sub.3 (aq)) the title compound (252 mg, 23%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 257.9.

    Intermediate 7

    3-(6-Chloropyridin-3-yl)-1-methylimidazolidine-2,4-dione

    Step A. i-7a

    4-Nitrophenyl (6-chloropyridin-3-yl)carbamate

    [1191] ##STR00517##

    [1192] 4-Nitrophenyl carbonochloridate (CAS Reg. No. 7693-46-1) (1.73 g, 8.56 mmol) was added to 6-chloropyridin-3-amine (CAS Reg. No. 5350-93-6) (1.0 g, 7.8 mmol) in MeCN (20 mL) at 20? C. and the resulting solution stirred at this temperature for 30 min. The reaction mixture was diluted with MeCN (200 mL), filtered through an organic phase filter and evaporated to give the crude title compound (2.18 g, 96%) as a purple solid. MS (ESI): m/z [M+H].sup.+ 293.9.

    Step B. i-7b

    3-(6-Chloropyridin-3-yl)-1-methylimidazolidine-2,4-dione

    [1193] ##STR00518##

    [1194] DIPEA (3.90 mL, 22.3 mmol) was added to methyl methylglycinate HCl (CAS Reg. No. 13515-93-0) (1.04 g, 7.44 mmol) in MeCN (20 mL) at 20? C. The resulting suspension was stirred at 20? C. for 15 min upon which 4-nitrophenyl (6-chloropyridin-3-yl)carbamate compound i-7a (2.18 g, 7.44 mmol) was added and stirring at 20? C. continued for 10 min. The mixture was concentrated under reduced pressure and the obtained crude material purified by flash chromatography on silica (gradient: 65-70% EtOAc in PE) to give the title compound (1.55 g, 92%) as a white solid. MS (ESI): m/z [M+H].sup.+ 225.8.

    Intermediate 8

    6-Chloro-2-oxo-2H-[1,3-bipyridine]-5-carbonitrile

    Step A. i-8a

    Methyl 6-chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxylate

    [1195] ##STR00519##

    [1196] 6-Chloropyridin-3-amine (CAS Reg. No. 5350-93-6) (1.0 g, 7.8 mmol) was added to a solution of methyl 2-oxo-2H-pyran-5-carboxylate (CAS Reg. No. 6018-41-3) (1.2 g, 7.8 mmol) in EtOH (20 mL) at 15? C. and it was stirred at 80? C. for 16 h. The reaction mixture was diluted with EtOH (20 mL), filtered through an organic phase filter and evaporated to give the crude title compound (1.53 g, 74%) as a purple solid. MS (ESI): m/z [M+H].sup.+ 265.2.

    Step B. i-8b

    6-Chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxylic acid

    [1197] ##STR00520##

    [1198] Methyl 6-chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxylate compound i-8a (300 mg, 1.13 mmol) was added to NaOH (91 mg, 2.3 mmol) in a mixture of THE (8 mL) and water (2 mL) at 20? C. and the resulting solution stirred at 20? C. for 15 h. The reaction mixture was concentrated und reduced pressure, the residue diluted with water (5 mL) and the pH adjusted to pH<7 with 1 M HCl. The mixture was further diluted with water (100 mL) and extracted with EtOAc (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated to give crude title compound (230 mg, 81%) as a white solid. MS (ESI): m/z [M+H].sup.+ 251.

    Step C. i-8c

    6-Chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxamide

    [1199] ##STR00521##

    [1200] 6-Chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxylic acid compound i-8b (160 mg, 0.64 mmol) was added to HATU (485 mg, 1.28 mmol), TEA (0.712 mL, 5.11 mmol) and NH.sub.4Cl (137 mg, 2.55 mmol) in DMF (10 mL) under a nitrogen atmosphere. The resulting mixture was stirred at 60? C. for 3 h, subsequently cooled to rt, quenched with sat brine (100 mL) and extracted with EtOAc (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained residue purified by preparative TLC (DCM:MeOH=10:1) to give the title compound (130 mg, 82%) as a white solid. MS (ESI): m/z [M+H].sup.+ 250.

    Step D. i-8d

    6-Chloro-2-oxo-2H-[1,3-bipyridine]-5-carbonitrile

    [1201] ##STR00522##

    [1202] 6-Chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxamide compound i-8c (700 mg, 2.80 mmol) was added to a solution of pyridine (0.68 mL, 8.4 mmol) in DCM (10 mL). TFAA (1.19 mL, 8.41 mmol) was slowly added to the mixture at 0? C. and it was stirred at 20? C. for 1 h. The synthesis procedure was repeated with a second batch of 6-chloro-2-oxo-2H-[1,3-bipyridine]-5-carboxamide compound i-8c (100 mg, 0.40 mmol). The two batches were combined, concentrated under reduced pressure and purified by preparative TLC (EtOAc:PE=3:1) to give the title compound (540 mg, 72%) as a white solid. MS (ESI): m/z [M+H].sup.+ 232.1.

    Intermediate 9

    3-(Trifluoromethoxy)pyridin-2-ol

    Step A. i-9a

    2-((4-Methoxybenzyl)oxy)-3-(trifluoromethoxy)pyridine

    [1203] ##STR00523##

    [1204] KotBu (682 mg, 6.07 mmol) was added to (4-methoxyphenyl)methanol (CAS Reg. No. 105-13-5) (629 mg, 4.56 mmol) in 1,4-dioxane (2 mL) at 20? C. and it was stirred at 20? C. for 2 h. 2-Chloro-3-(trifluoromethoxy)pyridine (CAS Reg. No. 1206980-39-3) (600 mg, 3.04 mmol) was added to the reaction mixture and the resulting suspension was stirred at 100? C. for 15 h. The reaction mixture was poured into sat. brine (125 mL) and extracted with EtOAc (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained residue was purified by preparative TLC (EtOAc:PE=1:5) to give the title compound (600 mg, 66%) as a pale yellow liquid. MS (ESI): m/z [M+H].sup.+ 300.0.

    Step B. i-9b

    3-(Trifluoromethoxy)pyridin-2-ol

    [1205] ##STR00524##

    [1206] 2-((4-Methoxybenzyl)oxy)-3-(trifluoromethoxy)pyridine compound i-9a (500 mg, 1.67 mmol) was added to TFA (10 mL) at 25? C., it was warmed to 60? C. and the resulting solution stirred at this temperature for 15 h. The solvent was removed under reduced pressure and the obtained residue purified by preparative TLC (EtOAc:PE=1:1) to give the title compound (150 mg, 50%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 180.0.

    Intermediate 10

    i-10a

    6-Chloro-2-oxo-2H-[1,3-bipyridine]-3-carbonitrile

    [1207] ##STR00525##

    [1208] In a variation of GM5 pyridine (0.81 mL, 10 mmol) was added to a mixture of 2-oxo-1,2-dihydropyridine-3-carbonitrile (CAS Reg. No. 20577-27-9) (600 mg, 5.00 mmol), (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. 444120-91-6) (1.57 g, 10 mmol), Cu(Oac).sub.2 (1.82 g, 10 mmol) and 5A molecular sieves (500 mg, dried 24 h at 200? C.) in DCM (100 mL) and DMF (15 mL) at 25? C. Air was allowed to diffuse into the reaction mixture via a CaCl.sub.2 tube. The resulting mixture was stirred at 25? C. for 15 h and subsequently filtered through Celite. The filter cake was washed with DCM (3?10 mL), the combined filtrates concentrated under reduced pressure and the residue partitioned between EtOAc (400 mL) and water (150 mL). The aqueous layer was extracted with EtOAc (5?200 mL), the combined organic layers were washed with sat. brine (5?100 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated. The dry solid was triturated with DMF (3?5 mL), the solid filtered off and the filter cake washed with MTBE (3?5 mL). The solid was dried under vacuum to give the title compound (105 mg, 9%) as a grey solid. MS (ESI): m/z [M+H].sup.+ 232.1.

    Intermediate 11

    i-11a

    2-(5-Bromopyrazin-2-yl)pyridazin-3(2H)-one

    [1209] ##STR00526##

    [1210] In a slight variation of GM3 2-bromo-5-iodopyrazine (CAS Reg. No. 622392-04-5) (1.00 g, 3.51 mmol), pyridazin-3(2H)-one (CAS Reg. No. 504-30-3) (0.337 g, 3.51 mmol), Cs.sub.2CO.sub.3 (2.287 g, 7.02 mmol), Cu(I)I (0.669 g, 3.51 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (0.499 g, 3.51 mmol) were reacted in 1,4-dioxane (25 mL) at 60? C. for 1 h to give upon non-aqueous work-up followed by preparative TLC (EtOAc:PE=1:1) the title compound (300 mg, 33%) as a white solid. The product contained the corresponding iodo compound as well. MS (ESI): m/z [M+H].sup.+ 252.9.

    Intermediate 12

    i-12a

    6-Chloro-1-methyl-[3,3-bipyridin]-2 (1H)-one

    [1211] ##STR00527##

    [1212] According to GM4A (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. 444120-91-6) (301 mg, 1.91 mmol), 3-bromo-1-methylpyridin-2(1H)-one (81971-38-2) (200 mg, 1.06 mmol), Cs.sub.2CO.sub.3 (1.04 g, 3.19 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (CAS Reg. No. 95408-45-0) (34.7 mg, 0.05 mmol) were reacted in a mixture of 1,4-dioxane (12 mL) and water (3 mL) at 80? C. for 15 h to give upon non-aqueous work-up followed by preparative TLC (100% EtOAc) the title compound (230 mg, 98%) as a light yellow solid. MS (ESI): m/z [M+H].sup.+ 221.0.

    Intermediate 13

    i-13a

    3-Chloro-6-fluoro-2H-[1,3-bipyridin]-2-one

    [1213] ##STR00528##

    [1214] In a slight variation of GM3 2-fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (560 mg, 2.51 mmol), 3-chloropyridin-2(1H-one (CAS Reg. No. 13466-35-8) (651 mg, 5.02 mmol), potassium phosphate, tribasic (1.60 g, 7.53 mmol), Cu(I)I (478 mg, 2.51 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (357 mg, 2.51 mmol) were reacted in 1,4-dioxane (60 mL) at 100? C. for 18 h. The reaction mixture was poured into sat. brine (350 mL) and filtered through Celite. The filtrate was extracted with EtOAc (3?250 mL), the organic layer dried over Na.sub.2SO.sub.4, filtered and evaporated. The crude material was purified by flash chromatography on silica (gradient: 0-30% EtOAc in PE) to give the title compound (258 mg, 45%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 224.9.

    Intermediate 14

    i-14a

    6-Chloro-3-fluoro-[2,3-bipyridine]-6-carbonitrile

    [1215] ##STR00529##

    [1216] According to GM4A, 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (49 mg, 0.07 mmol) was added to 6-bromo-5-fluoropicolinonitrile (CAS Reg. No. 1416713-45-5) (300 mg, 1.49 mmol), (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. 444120-91-6) (352 mg, 2.24 mmol) and K.sub.3PO.sub.4 (950 mg, 4.48 mmol) in water (2 mL) and 1,4-dioxane (8 mL). The resulting solution was stirred at 100? C. for 2 h. Aqueous work-up and purification by preparative TLC (EtOAc:PE=2:1) gave the title compound (214 mg, 61%) as a white solid; MS (ESI) m/z [M+H].sup.+=234.0.

    Intermediate 17

    (1S,3S)N.SUP.1.-(5-Chloropyrazin-2-yl)-N.SUP.1.-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine

    Step A. i-17a

    (1S,3S)N.SUP.1.-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine?3 HCl

    [1217] ##STR00530##

    [1218] According to GM6A tert-butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate compound i-1a (Intermediate 1, Step A) (1.29 g, 3.19 mmol) was reacted with HCl in MeOH (4 M, 10 mL, 40 mmol) in MeOH (20 mL) at 80? C. for 2 h to afford the title compound (1.27 g, 96%) as a beige solid. MS (ESI): m/z [M+H].sup.+ 303.90.

    Step B. i-17b

    (1S,3S)N.SUP.1.-(5-Chloropyrazin-2-yl)-N.SUP.1.-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine

    [1219] ##STR00531##

    [1220] According to GM1A (1S,3S)N-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-17a (1.26 g, 3.05 mmol), 2,5-dichloropyrazine (CAS Reg. No. 19745-07-4) (0.910 g, 6.11 mmol) and Na.sub.2CO.sub.3 (1.62 g, 15.3 mmol) were reacted in DMSO (25 mL) at 120? C. for 15 h. The mixture was filtered through a Celite pad and the filtrate purified by flash C18-flash chromatography (gradient: 10-61% MeCN in water, containing 0.1% NH.sub.3, aq) to give the title compound (0.78 g, 61%) as a beige solid. MS (ESI): m/z [M+H].sup.+ 415.90.

    Intermediate 21

    1-(6-(((1S,3S)-3-Aminocyclopentyl)amino)pyridin-3-yl)quinolin-2(1H)-one

    Step A. i-21a

    1-(6-Chloropyridin-3-yl)quinolin-2(1H)-one

    [1221] ##STR00532##

    [1222] According to GM5 quinolin-2(1H-one (CAS Reg. No. (59-31-4) (500 mg, 3.44 mmol), (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. (444120-91-6) (1.63 g, 10.3 mmol), Cu(Otf).sub.2 (2.49 g, 6.89 mmol) and N,N,N,Ntetramethylethylenediamine (1.20 g, 10.3 mmol) were reacted in 1,4-dioxane (20 mL) at 100? C. for 16 h to give upon purification by C18-flash chromatography (gradient: 5-46% MeCN in water, containing 0.1% NH.sub.3, aq) 1-(6-chloropyridin-3-yl)quinolin-2(1H-one (211 mg, 24%) as a green solid. MS (ESI): m/z [M+H].sup.+ 256.95.

    Step B. i-21b

    tert-Butyl ((1S,3S)-3-((5-(2-oxoquinolin-1(2H)-yl)pyridin-2-yl)amino)cyclopentyl)carbamate

    [1223] ##STR00533##

    [1224] According to GM2 1-(6-chloropyridin-3-yl)quinolin-2(1H)-one compound i-21a (90 mg, 0.35 mmol), tert-butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (211 mg, 1.05 mmol), Cs.sub.2CO.sub.3 (571 mg, 1.75 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (29.5 mg, 0.04 mmol) were reacted in 1,4-dioxane (10 mL) at 100? C. for 15 h to give upon aqueous work-up and purification by preparative TLC (MeOH:DCM=1:40) tert-butyl ((1S,3S)-3-((5-(2-oxoquinolin-1(2H)-yl)pyridin-2-yl)amino)cyclopentyl)carbamate (122 mg, 83%) as a white solid. MS (ESI): m/z [M+H].sup.+ 421.00.

    Step C. i-21c

    1-(6-(((1S,3S)-3-Aminocyclopentyl)amino)pyridin-3-yl)quinolin-2(1H)-one

    [1225] ##STR00534##

    [1226] According to GM6A tert-butyl ((1S,3S)-3-((5-(2-oxoquinolin-1(2H)-yl)pyridin-2-yl)amino)cyclopentyl)carbamate compound i-21b (110 mg, 0.26 mmol) was reacted with HCl in methanol (4 M, 5.0 mL, 20 mmol) in MeOH (10 mL) at 80? C. for 2 h to afford an unspecified HCl salt of 1-(6-(((1S,3S)-3-aminocyclopentyl)amino)pyridin-3-yl)quinolin-2(1H-one (90 mg, 96%) as a brown gum. MS (ESI): m/z [M+H].sup.+ 321.00.

    Intermediate 22

    (1S,3S)N.SUP.1.-(6-Cyclopropyl-1,2,4-triazin-3-yl)-NM-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine

    Step A. i-22a

    tert-Butyl ((1S,3S)-3-((1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1227] ##STR00535##

    [1228] m-CPBA (5.60 g, 25.95 mmol) was added in small portions to a solution of 3-(methylthio)-1,2,4-triazine (CAS Reg. No. 28735-21-9) (3.0 g, 23.6 mmol) in DCM (80 mL) at 0? C. and the resulting suspension was stirred at 20? C. for 2 h. The solvent was removed under reduced pressure without heating, the residue dissolved in n-butanol (40 mL) and tert-butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (5.20 g, 26.0 mmol) was added and the resulting solution was stirred at 120? C. for 18 h. The reaction mixture was poured into 1 M NaOH (250 mL) and extracted with EtOAc (3?200 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product as a brown solid which was purified by flash chromatography on silica (gradient: 5-60% EtOAc in PE) to give (3.7 g, 56%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 280.

    Step B. i-22b

    tert-Butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1229] ##STR00536##

    [1230] A solution of Br.sub.2 in DCM (1 M, 15.9 mL, 15.9 mmol) was added dropwise to a solution of tert-butyl ((1S,3S)-3-((1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22a (3.7 g, 13.2 mmol) in a mixture of MeOH (60 mL) and water (30 mL) and the mixture was stirred at rt for 15 h. The solvent was removed under reduced pressure and the residue was poured into sat. Na.sub.2SO.sub.3(aq) (150 mL) and extracted with EtOAc (3?100 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product as brown solid which was purified by flash chromatography on silica (gradient: 5-30% EtOAc in PE) to give (3.5 g, 74%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 358.

    Step C. i-22c

    tert-Butyl ((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1231] ##STR00537##

    [1232] According to GM4B tert-butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22b (1.5 g, 4.2 mmol), potassium cyclopropyltrifluoroborate (2.48 g, 16.8 mmol), Cs.sub.2CO.sub.3 (5.46 g, 16.8 mmol) and CataCXium A Pd G3 (CAS Reg. No. 1651823-59-4) (0.61 g, 0.84 mmol) were reacted in dioxane (70 mL) at 100? C. for 15 h. Upon combination with a second batch (prepared in the same manner, 1.12 mmol scale) the material was purified by preparative TLC (EtOAc:PE=1:3) to afford (1.12 g, 66%) of the title compound as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 320.

    Step D. i-22d

    (1S,3S)N-(6-Cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine?4 TFA

    [1233] ##STR00538##

    [1234] According to GM6B tert-butyl ((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22c (500 mg, 1.57 mmol) was reacted with TFA (5.0 mL, 65 mmol) in DCM (20 mL) at rt for 15 h to give (940 mg, 89%) of the title compound as a yellow gum (contains 4 mol eq of residual TFA). MS (ESI): m/z [M+H].sup.+ 220.

    Step E. i-22e

    (1S,3S)N.SUP.1.-(6-Cyclopropyl-1,2,4-triazin-3-yl)-NM-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine

    [1235] ##STR00539##

    [1236] According to GM1A (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 4TFA compound i-22d (880 mg, 1.30 mmol), 2-fluoro-5-iodopyridine (436 mg, 1.95 mmol) and K.sub.2CO.sub.3 (900 mg, 6.51 mmol) were reacted in DMSO (10 mL) at 120? C. for 15 h to give upon aqueous work-up and purification by preparative TLC (EtOAc:PE=3:1) the title compound (369 mg, 67%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 423.

    Intermediate 23

    i-23a

    1-(6-Chloropyridin-3-yl)-3-methylimidazolidine-2,4-dione

    [1237] ##STR00540##

    [1238] CuI (0.230 g, 1.57 mmol) was added to a mixture of 2-chloro-5-iodopyridine (CAS Reg. No. 69045-79-0) (0.50 g, 2.09 mmol), 3-methylimidazolidine-2,4-dione (CAS Reg. No. 6843-45-4) (0.48 g, 4.18 mmol), N,N-dimethylglycine hydrochloride (0.22 g, 1.57 mmol) and Cs.sub.2CO.sub.3 (1.36 g, 4.18 mmol) in dioxane (20 mL) and the resulting suspension was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was poured into brine (125 mL) and extracted with EtOAc (3?100 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product as yellow gum which was purified by preparative TLC (EtOAc:PE=1:1) to give (0.25 g, 53%) of the title compound as a pale yellow oil which solidified on standing. MS (ESI): m/z [M+H].sup.+ 226.

    Intermediate 24

    i-24a

    3-(6-Chloropyridin-3-yl)-1-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one

    [1239] ##STR00541##

    [1240] According to GM5 (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. 444120-91-6) (2.93 g, 18.6 mmol), 1-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one (CAS Reg. No. 50339-06-5) (1.11 g, 7.44 mmol), Cu(Otf).sub.2 (4.04 g, 11.2 mmol) and TMEDA (2.59 g, 22.3 mmol) were reacted in dioxane (100 mL) at 100? C. for 16 h to give upon work-up and purification by C18-flash chromatography (gradient: 5-40% MeCN in water, containing 0.1% NH.sub.3, aq) (0.235 g, 12%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 261.

    Intermediate 25

    i-25a

    6-Chloro-3-methoxy-2H-[1,3-bipyridin]-2-one

    [1241] ##STR00542##

    [1242] 3-Methoxypyridin-2(1H)-one (CAS Reg. No. 20928-63-6) (1.35 g, 10.8 mol) and 2-chloro-5-iodopyridine (CAS Reg. No. 69045-72-0) (1.03 g, 4.32 mmol) were added to dimethylglycine hydrochloride (301 mg, 2.16 mmol), CuI (411 mg, 2.16 mmol) and Cs.sub.2CO.sub.3 (4.22 g, 13.0 mmol) in dioxane (20 mL) and the resulting solution was stirred at 100? C. for 15 h. The solvent was removed under reduced pressure and the crude product was purified by preparative TLC (PE:EtOAc=1:2) to afford (250 mg, 55%) of the title compound as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 237.

    Intermediate 26

    i-26a

    6-Chloro-5-methoxy-2H-[1,3-bipyridin]-2-one

    [1243] ##STR00543##

    [1244] CuI (159 mg, 0.84 mmol) and N,N-dimethylglycine hydrochloride (117 mg, 0.84 mmol) were added to a mixture of 2-chloro-5-iodopyridine (400 mg, 1.67 mmol), 5-methoxypyridin-2(1H-one (CAS Reg. No. 61941-79-5) (523 mg, 4.18 mmol) and Cs.sub.2CO.sub.3 (1.63 mg, 5.01 mmol) in dioxane (8 mL) and the resulting suspension was stirred at 100? C. for 15 h under nitrogen. The mixture was filtered through a Celite pad, the solvent removed under reduced pressure and the crude product purified by preparative TLC (EtOAc:PE=3:1) to afford (179 mg, 45%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 237.

    Intermediate 27

    i-27a

    6-Chloro-3-methyl-2H-[1,3-bipyridin]-2-one

    [1245] ##STR00544##

    [1246] In a slight variation of GM3 2-chloro-5-iodopyridine (600 mg, 2.51 mmol), 3-methylpyridin-2(1H)-one (CAS Reg. No. 1003-56-1) (273 mg, 2.51 mmol), K.sub.3PO.sub.4 (1.60 g, 7.52 mmol), Cu(I)I (239 mg, 1.25 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (178 mg, 1.25 mmol) were reacted in dioxane (20 mL) at 100? C. for 1 h to give upon aqueous work-up and purification by preparative TLC (DCM:MeOH=20:1) the title compound (261 mg, 47%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 221.

    Intermediate 28

    (1S,3S)N.SUP.1.-(6-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine?2 TFA

    Step A. i-28a

    tert-Butyl ((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1247] ##STR00545##

    [1248] According to GM4A tert-butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22b (300 mg, 0.84 mmol), 2,4,6-trimethyl-1,3,5,2,4,6-trioxatriborinane in THE (2.10 g, 8.37 mmol), K.sub.3PO.sub.4 (356 mg, 1.67 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (CAS Reg. No. 95408-45-0) (55 mg, 0.08 mmol) were reacted in a mixture of dioxane (4 mL) and water (1 mL) at 100? C. for 15 h to give upon aqueous work-up and purification by preparative TLC (MeOH:DCM=1:20) followed by C18-flash chromatography (gradient: 0-49% MeOH in water) the title compound (103 mg, 42%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 294.

    Step B. i-28b

    (1S,3S)N.SUP.1.-(6-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine?2 TFA

    [1249] ##STR00546##

    [1250] According to GM6B tert-butyl ((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-28a (100 mg, 0.34 mmol) was reacted with TFA (5 mL) in DCM (5 mL) at rt for 15 h to afford (100 mg, 95%) of title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 194.

    Intermediate 29

    i-29a

    6-Chloro-2H-[1,3-bipyridin]-2-one

    [1251] ##STR00547##

    [1252] According to GM3 2-chloro-5-iodopyridine (3.0 g, 12.5 mmol), pyridin-2(1H-one (CAS Reg. No. 142-08-5) (3.57 g, 37.6 mmol), Cu(I)I (1.19 g, 6.26 mmol), Cs.sub.2CO.sub.3 (8.16 g, 25.1 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (0.891 g, 6.26 mmol) were reacted in dioxane (80 mL) at 100? C. for 15 h to give upon aqueous work-up and trituration with PE:EtOAc (1:1, 30 mL) a solid which was collected by filtration and dried under vacuum to yield (0.60 g, 23%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 207.

    Intermediate 30

    i-30a

    3-(((1S,3S)-3-((2-Oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxylic acid

    [1253] ##STR00548##

    [1254] Ethyl 3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxylate compound 10 (22 mg, 0.05 mmol), finely-ground NaOH (10 mg, 0.26 mmol) and water (0.5 mL) was added to a vial and the mixture was stirred at room temperature for 0.5 h. The compound was purified by preparative HPLC (PrepMethod G, gradient: 5-45%) to give (17 mg, 86%) of the title compound as an off-white solid. MS (ESI): m/z [M+H].sup.+ 394.

    Intermediate 31

    (1S,3S)N.SUP.1.-(5-Methylpyrazin-2-yl)cyclopentane-1,3-diamine

    Step A. i-31a

    tert-Butyl ((1S,3S)-3-((5-methylpyrazin-2-yl)amino)cyclopentyl)carbamate

    [1255] ##STR00549##

    [1256] The reaction was run in 3 parallel batches.

    [1257] According to GM2 tert-butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (420 mg, 2.10 mmol), 2-bromo-5-methylpyrazine (CAS Reg. No. 98006-90-7) (363 mg, 2.10 mmol), Cs.sub.2CO.sub.3 (1.03 g, 3.15 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (62 mg, 0.07 mmol) were reacted in 1,4-dioxane (20 mL) at 100? C. for 15 h. Upon combination of batches, non-aqueous work-up and trituration (PE:EtOAc=2:1, 20 mL) a solid was collected by filtration which was dried under vacuum to yield the title compound (1.2 g, 63%) as a grey solid. MS (ESI): m/z [M+H].sup.+ 293.3. .sup.1H NMR (300 MHz, CDCl.sub.3) ? ppm 1.46 (11H, s), 1.93 (2H, td), 2.25 (2H, ddt), 2.39 (3H, d), 4.15 (1H, d), 4.23 (1H, p), 4.47 (1H, d), 4.57 (1H, s), 7.80 (1H, d), 7.85-7.90 (1H, m).

    Step B. i-31b

    (1S,3S)N.SUP.1.-(5-Methylpyrazin-2-yl)cyclopentane-1,3-diamine

    [1258] ##STR00550##

    [1259] According to GM6B tert-butyl ((1S,3S)-3-((5-methylpyrazin-2-yl)amino)cyclopentyl)carbamate compound i-31a (350 mg, 1.20 mmol) was reacted with TFA (2 mL, 26 mmol) in DCM (10 mL) at 20? C. for 15 h to afford an unspecified TFA salt of the title compound (704 mg, 91%) as a brown gum. MS (ESI): m/z [M+H].sup.+ 193.0. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.64 (2H, m), 1.91 (2H, m), 2.06-2.19 (2H, m), 2.26 (3H, s), 3.60-3.73 (1H, m), 4.21-4.32 (1H, m), 7.74-7.94 (5H, m).

    Intermediate 35

    Step A. i-35a

    tert-Butyl ((1S,3S)-3-((3-cyano-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate

    [1260] ##STR00551##

    [1261] In a slight variation of GM2 6-chloro-2-oxo-2H-[1,3-bipyridine]-3-carbonitrile compound i-10a (560 mg, 1.89 mmol), tert-butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (1.13 g, 5.66 mmol), Cs.sub.2CO.sub.3 (1.84 g, 5.66 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (79 mg, 0.09 mmol) were reacted in DMF (30 mL) at 100? C. for 15 h. The reaction mixture was filtered through a pad of Celite, the filter cake washed with DCM (3?10 mL) and the combined filtrates concentrated under reduced pressure. The obtained material was purified by C18-flash chromatography (gradient: 10-100% MeCN in water+0.1% NH.sub.3 (aq), 910 mg material isolated) followed by preparative TLC (EtOAc:PE=3:1) to give the title compound (174 mg, 23%) as a grey solid. MS (ESI): m/z [M+H].sup.+ 396.20.

    Step B. i-35b

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-3-carbonitrile?4 HCl

    [1262] ##STR00552##

    [1263] According to GM6A tert-butyl ((1S,3S)-3-((3-cyano-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-35a (865 mg, 2.19 mmol) was reacted with HCl in methanol (4 M 8.0 mL, 32 mmol) in MeOH (20 mL) at 80? C. for 2 h to give the title compound (966 mg, 100%) as a brown gum. MS (ESI): m/z [M+H].sup.+ 296.00.

    Intermediate 36

    Step A. i-36a

    6-Methyl-3-(methylthio)-1,2,4-triazine

    [1264] ##STR00553##

    [1265] Methyl hydrazinecarbimidothioate HI (CAS Reg. No. 35600-34-1) (9.87 g, 42.4 mmol) was added to a stirred solution of 1,1-dimethoxypropan-2-one (CAS Reg. No. 6342-56-9) (5.00 g, 42.3 mmol) in ethanol (250 mL) at rt and the resulting solution stirred at 80? C. for 16 h. The solvent was removed under reduced pressure and the obtained residue purified by flash chromatography on silica (gradient: 40-50% EtOAc in PE) to give the title compound (2.77 g, 46%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 141.9. H NMR (300 MHz, DMSO-d.sub.6) ? ppm 2.56 (3H, s), 2.59 (3H, s), 8.56 (1H, s).

    Step B. i-36b

    6-Methyl-3-(methylsulfinyl)-1,2,4-triazine

    [1266] ##STR00554##

    [1267] According to GM8 6-methyl-3-(methylthio)-1,2,4-triazine compound i-36a (1.99 g, 14.1 mmol) was treated with 3-chlorobenzoperoxoic acid (3.65 g, 16.9 mmol) in DCM (25 mL) at rt for 2 h to give upon purification by flash chromatography on silica (gradient: 10-20% MeOH in DCM) the title compound (1.36 g, 61%) as a yellow oil. MS (ESI): m/z [M+H].sup.+ 157.8. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 2.71 (3H, s), 2.96 (3H, s), 8.95 (1H, s).

    Intermediate 37

    i-37a

    6-Fluoro-5-methyl-2H-[1,3-bipyridin]-2-one

    [1268] ##STR00555##

    [1269] According to GM3 2-fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (150 mg, 0.67 mmol), 2-hydroxy-5-methylpyridine (CAS Reg. No. 1003-68-5) (367 mg, 3.36 mmol), Cs.sub.2CO.sub.3 (658 mg, 2.02 mmol), Cu(I)I (128 mg, 0.67 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (96 mg, 0.67 mmol) were reacted in 1,4-dioxane (15 mL) at 100? C. for 15 h. The reaction mixture was filtered through a pad of Celite, the filter cake washed with EtOAc (3?5 mL) and the combined filtrates diluted with water (50 mL). The phases were separated and the aqueous phase was extracted with EtOAc (4?100 mL). The combined organic layers were were washed with water (2?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (EtOAc) to give the title compound (116 mg, 84%) as a white solid. MS (ESI): m/z [M+H].sup.+ 204.9. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 2.06 (3H, s), 6.47 (1H, d), 7.36 (1H, dd), 7.43 (1H, dd), 7.53-7.54 (1H, m), 8.12 (1H, ddd), 8.33 (1H, dd).

    Intermediate 38

    i-38a

    6-Fluoro-3-methyl-2H-[1,3-bipyridin]-2-one

    [1270] ##STR00556##

    [1271] According to GM3 2-fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (105 mg, 0.47 mmol), 2-hydroxy-3-methylpyridine (CAS Reg. No. 1003-56-1) (257 mg, 2.35 mmol), Cs.sub.2CO.sub.3 (460 mg, 1.41 mmol), Cu(I)I (90 mg, 0.47 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (67 mg, 0.47 mmol) were reacted in 1,4-dioxane (10 mL) at 100? C. for 15 h. The reaction mixture was filtered through a pad of Celite, the filter cake washed with EtOAc (3?5 mL) and the combined filtrates diluted with water (50 mL). The phases were separated and the aqueous phase was extracted with EtOAc (4?75 mL). The combined organic layers were washed with water (2?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (EtOAc) to give the title compound (85 mg, 88%) as a white solid. MS (ESI): m/z [M+H].sup.+ 205.0. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 2.05 (3H, s), 6.29 (1H, t), 7.36 (1H, dd), 7.42-7.45 (1H, m), 7.58 (1H, dd), 8.13 (1H, ddd), 8.32-8.34 (1H, m).

    Intermediate 39

    i-39a

    (1S,3S)N-(5-Iodopyridin-2-yl)-NM-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine

    [1272] ##STR00557##

    [1273] According to GM1A 2-fluoro-5-iodopyridine (203 mg, 0.91 mmol) was added to a mixture of the 2HCl salt of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (220 mg, 0.83 mmol) and Na.sub.2CO.sub.3 (263 mg, 2.48 mmol) in DMSO (15 mL). The resulting mixture was stirred at 100? C. for 15 h under a nitrogen atmosphere. The reaction mixture was concentrated under reduced pressure and the obtained material was taken up with EtOAc (300 mL). The organic layer was washed with saturated brine (4?125 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (EtOAc:PE=1:1) to give the title compound (140 mg, 43%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 396.7. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.39-1.59 (2H, m), 1.79-1.95 (2H, m), 2.06-2.16 (2H, m), 2.37 (3H, s), 4.17-4.39 (2H, m), 6.37 (1H, dd), 6.83 (1H, d), 7.53-7.59 (2H, m), 8.10 (1H, d), 8.16 (1H, s).

    Intermediate 42

    Step A. i-42a

    tert-Butyl ((1S,3S)-3-((5-methoxy-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate

    [1274] ##STR00558##

    rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (53 mg, 0.37 mmol) was added to tert-butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate compound i-1a (300 mg, 0.74 mmol), 5-methoxypyridin-2-ol (233 mg, 1.86 mmol), Cs.sub.2CO.sub.3 (727 mg, 2.23 mmol) and Cu(I)I (70.8 mg, 0.37 mmol) in 1,4-dioxane (15 mL) at 25? C. The resulting suspension was stirred at 100? C. for 18 h under a nitrogen atmosphere. The reaction mixture was diluted with EtOAc (50 mL) and washed sequentially with water (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated. The residue was purified by preparative TLC (EtOAc) to give the title compound (263 mg, 88%) as a brown solid. MS (ESI) m/z [M+H].sup.+ 401.0.

    Step B. i-42b

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-5-methoxy-2H-[1,3-bipyridin]-2-one

    [1275] ##STR00559##

    [1276] TFA (5 ml, 64.90 mmol) was added to tert-butyl ((1S,3S)-3-((5-methoxy-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-42a (400 mg, 1.00 mmol) in DCM (15 mL) at 25? C. The resulting suspension was stirred at 25? C. for 18 h. The solvent was removed under reduced pressure to give the TFA salt of the crude title compound (1.1 g, 100%) as a black gum. MS (ESI) m/z [M+H].sup.+ 301.0.

    Intermediate 44

    Step A. i-44a

    tert-Butyl ((1S,3S)-3-((5-chloro-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate

    [1277] ##STR00560##

    [1278] rel-(1R,2R)N.sup.1/N.sup.2-Dimethylcyclohexane-1,2-diamine (106 mg, 0.74 mmol) was added to tert-butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate compound i-1a (300 mg, 0.74 mmol), 5-chloropyridin-2(1H)-one (193 mg, 1.49 mmol), Cu(I)I (142 mg, 0.74 mmol) and Cs.sub.2CO.sub.3 (727 mg, 2.23 mmol) in 1,4-dioxane (25 mL) at 26? C. The resulting solution was stirred at 100? C. for 18 h. The reaction mixture was diluted with EtOAc (75 mL) and washed sequentially with water (3?25 mL) and sat brine (3?20 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated. The residue was purified by preparative TLC (EtOAc:PE=2:1) to give the title compound (298 mg, 99%) as a green solid. MS (ESI) m/z [M+H].sup.+ 405.0.

    Step B. i-44b

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-5-chloro-2H-[1,3-bipyridin]-2-one

    [1279] ##STR00561##

    [1280] TFA (5 mL, 64.90 mmol) was added to tert-butyl ((1S,3S)-3-((5-chloro-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-44a (220 mg, 0.54 mmol) in DCM (20 mL) at 25? C. The resulting solution was stirred at 100? C. for 18 h. The solvent was removed under reduced pressure to give the TFA salt of the crude title compound (432 mg, 91%) as a brown gum. MS (ESI) m/z [M+H].sup.+ 304.9.

    Intermediate 47 i-47a (1S,3S)N-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.SUP.3.-(5-iodopyrimidin-2-yl)cyclopentane-1,3-diamine

    [1281] ##STR00562##

    [1282] K.sub.2CO.sub.3 (126 mg, 0.91 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (200 mg, 0.91 mmol), 2-chloro-5-iodopyrimidine (CAS Reg. No. 32779-38-7) (329 mg, 1.37 mmol) in DMSO (5 mL) at rt and the resulting suspension was stirred at 120? C. for 15 h. The reaction mixture was diluted with EtOAc (100 mL), and washed sequentially with water (2?25 mL) and brine (25 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product which was purified by flash C18-flash chromatography (elution gradient: 0-60% MeCN in water) to afford (150 mg, 39%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 424.0.

    Intermediate 48

    Step A. i-48a

    Methyl 4-((6-chloropyridin-3-yl)amino)-3-nitrobenzoate

    [1283] ##STR00563##

    [1284] The reaction was run in 3 parallel batches (2?500 mg and 1?600 mg 6-chloropyridin-3-amine). Methyl 4-fluoro-3-nitrobenzoate (CAS Reg. No. 329-59-9) (929 mg, 4.67 mmol) was added to 6-chloropyridin-3-amine (CAS Reg. No. 5350-93-6) (500 mg, 3.89 mmol), XantPhos (338 mg, 0.58 mmol), Pd(OAc).sub.2 (66 mg, 0.29 mmol) and K.sub.2CO.sub.3 (1.61 g, 11.7 mmol) in 1,4-dioxane (25 mL) at rt and the resulting mixture was stirred at 80? C. for 18 h under nitrogen. The three reaction mixtures were combined, taken up with EtOAc (200 mL), loaded onto silica gel and subjected to flash chromatography on silica (gradient: 10-20% EtOAc in n-heptane) to afford (851 mg, 71% combined yield) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 307.9.

    Step B. i-48b

    Methyl 3-amino-4-((6-chloropyridin-3-yl)amino)benzoate

    [1285] ##STR00564##

    Methyl 4-((6-chloropyridin-3-yl)amino)-3-nitrobenzoate compound i-48a (420 mg, 1.37 mmol) was added to zinc (535 mg, 8.19 mmol) and NH.sub.4Cl (730 mg, 13.65 mmol) in EtOAc (10 mL) and EtOH (10 mL) at rt and the resulting mixture was stirred at 60? C. for 18 h. The reaction mixture was filtered through celite. The celite was washed with EtOAc (3?25 mL). The filtrate was concentrated under reduced pressure to afford (761 mg) of the crude title compound (containing salts) as a light pink solid which was used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 277.9.

    Step C. i-48c

    Methyl 1-(6-chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylate

    [1286] ##STR00565##

    [1287] Methyl 3-amino-4-((6-chloropyridin-3-yl)amino)benzoate compound i-48b (300 mg, 1.08 mmol) was added to CDI (771 mg, 4.75 mmol) in DMF (20 mL) at rt and the resulting solution was stirred at 80? C. for 18 h. The reaction mixture was concentrated, diluted with EtOAc (200 mL) and washed sequentially with brine (3?100 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The crude solid was triturated with MeCN to give a solid which was collected by filtration and dried under vacuum to give (226 mg, 69%) of the title compound as a pink solid. MS (ESI): m/z [M+H].sup.+ 303.8.

    Step D. i-48d

    Methyl 1-(6-chloropyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylate

    [1288] ##STR00566##

    [1289] CH.sub.3I (246 mg, 1.73 mmol) was added to methyl 1-(6-chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylate compound i-48c (351 mg, 1.16 mmol) and Na.sub.2CO.sub.3 (367 mg, 3.47 mmol) in DMF (20 mL) at rt and the resulting mixture was stirred at 100? C. for 18 h. The reaction mixture was concentrated, diluted with EtOAc (250 mL) and washed sequentially with brine (3?100 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford (92 mg, 25%) of the crude product as a pale yellow solid which was used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 317.9.

    Step E. i-48e

    Methyl 1-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylate

    [1290] ##STR00567##

    [1291] Pd-PEPPSI-IpentCl 2-methylpyridine (CAS Reg. No. 1612891-29-8) (29 mg, 0.03 mmol) was added to methyl 1-(6-chloropyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylate compound i-48d (110 mg, 0.35 mmol), Cs.sub.2CO.sub.3 (338 mg, 1.04 mmol) and (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (76 mg, 0.35 mmol) in 1,4-dioxane (20 mL) at rt and the resulting mixture was stirred at 100? C. for 18 h under nitrogen. The reaction mixture was concentrated, diluted with EtOAc (200 mL) and washed sequentially with brine (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained residue purified by preparative TLC (EtOAc:PE=1:1) to afford (90 mg, 52%) of the title compound as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 510.1.

    Intermediate 49

    Step A. i-49a

    6-Chloro-5-(1-(4-methoxybenzyl)-1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one

    [1292] ##STR00568##

    [1293] Cu(I)I (103 mg, 1.04 mmol) was added to 6-chloro-5-ethynyl-2H-[1,3-bipyridin]-2-one compound i-63b (240 mg, 1.04 mmol) and 1-(azidomethyl)-4-methoxybenzene (255 mg, 1.56 mmol) in 1,4-dioxane (10 mL) at rt and the resulting suspension was stirred at 100? C. for 16 h under nitrogen. The mixture was filtered through a Celite pad and the filter cake washed with EtOAc (20 mL). The filtrate was concentrated under reduced pressure and the residue purified by preparative TLC (MeOH:DCM=1:20) to afford (410 mg, 100%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 394.0.

    Step B. i-49b

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1-(4-methoxybenzyl)-1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one

    [1294] ##STR00569##

    [1295] Pd-PEPPSI-IpentCl 2-methylpyridine (CAS Reg. No. 1612891-29-8) (21 mg, 0.03 mmol) was added to 6-chloro-5-(1-(4-methoxybenzyl)-1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-49a (200 mg, 0.51 mmol), (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (167 mg, 0.76 mmol) and Cs.sub.2CO.sub.3 (331 mg, 1.02 mmol) in 1,4-dioxane (10 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with EtOAc (100 mL) and washed sequentially with water (50 mL) and brine (25 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the obtained residue purified by preparative TLC (MeOH:DCM=1:10) to afford (166 mg, 57%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 577.2.

    Step C. i-49c

    5-(1-(4-Methoxybenzyl)-1H-1,2,3-triazol-4-yl)-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    [1296] ##STR00570##

    [1297] Prepared in a similar way as described for compound i-49b from 6-chloro-5-(1-(4-methoxybenzyl)-1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-49a (109 mg, 0.28 mmol), the 4?TFA salt of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (340 mg, 0.55 mmol), Cs.sub.2CO.sub.3 (451 mg, 1.38 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (23 mg, 0.03 mmol) in 1,4-dioxane (5 mL) and purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to give the title compound (22 mg, 14%) as a brown solid.

    [1298] MS (ESI): m/z [M+H].sup.+ 551.0.

    Intermediate 50

    Step A. i-50a

    5-(1-(4-Methoxybenzyl)-1H-pyrazol-4-yl)pyridin-2-ol

    [1299] ##STR00571##

    [1300] XPhos (0.431 g, 0.90 mmol), XPhos Pd G3 (CAS Reg. No. 1445085-55-1) (0.383 g, 0.45 mmol), 1-(4-methoxybenzyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (CAS Reg. No. 110539-88-0) (2.13 g, 6.79 mmol), 5-iodopyridin-2-ol (CAS Reg. No. 13472-79-2) (1.0 g, 4.5 mmol) and Cs.sub.2CO.sub.3 (4.42 g, 13.6 mmol) in dioxane (10 mL) and water (2 mL) were stirred under an atmosphere of nitrogen at 80? C. for 15 h. The mixture was filtered through a Celite pad. The filter cake was washed with EtOAc (20 mL) and the filtrate was concentrated under reduced pressure to give the crude product which was purified by flash C18-flash chromatography (elution gradient: 0-50% MeCN in water) to afford (160 mg, 13%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 282.0.

    Step B. i-50b

    6-Chloro-5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one

    [1301] ##STR00572##

    [1302] Cu(I)I (102 mg, 0.53 mmol) was added to 5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)pyridin-2-ol compound i-50a (150 mg, 0.53 mmol), 2-chloro-5-iodopyridine (CAS Reg. No. 69045-79-0) (128 mg, 0.53 mmol), rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (114 mg, 0.80 mmol) and Cs.sub.2CO.sub.3 (347 mg, 1.07 mmol) in 1,4-dioxane (10 mL) at rt and the resulting suspension was stirred at 60? C. for 5 h under nitrogen. The mixture was filtered through a Celite pad. The filter cake was washed with EtOAc (20 mL) and the filtrate concentrated under reduced pressure. The obtained residue was first purified by preparative TLC (MeOH:DCM=1:10) and then by flash C18-flash chromatography (elution gradient: 0-30% MeCN in water) to afford (150 mg, 72%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 393.0.

    Step C. i-50c

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one

    [1303] ##STR00573##

    [1304] Pd-PEPPSI-IpentCl 2-methylpyridine (CAS Reg. No. 1612891-29-8) (14 mg, 0.02 mmol) was added to 6-chloro-5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-50b (130 mg, 0.33 mmol), (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (109 mg, 0.50 mmol) and Cs.sub.2CO.sub.3 (216 mg, 0.66 mmol) in 1,4-dioxane (10 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with EtOAc (100 mL) and washed sequentially with water (50 mL) and brine (25 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to give the crude product which was purified by preparative TLC (MeOH:DCM=1:10) to afford (117 mg, 61%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 576.3.

    Step D. i-50d

    5-(1-(4-Methoxybenzyl)-1H-pyrazol-4-yl)-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    [1305] ##STR00574##

    [1306] Prepared in a similar way as described for compound i-50c from 6-chloro-5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-50b and (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b and purified by preparative TLC (MeOH:DCM=1:15), to give the title compound (82 mg, 73%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 550.0.

    Step E. i-50e

    5-(1-(4-Methoxybenzyl)-1H-pyrazol-4-yl)-6-(((1S,3S)-3-((5-methylpyrazin-2-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    [1307] ##STR00575##

    [1308] Prepared in a similar way as described for compound i-50c from 6-chloro-5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-50b and (1S,3S)N.sup.1-(5-methylpyrazin-2-yl)cyclopentane-1,3-diamine compound i-31b and purified by preparative TLC (MeOH:DCM=1:15) to give the title compound (150 mg, 43%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 549.0.

    Intermediate 51

    Step A. i-51a

    5-Bromo-3-(6-fluoropyridin-3-yl)-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one

    [1309] ##STR00576##

    [1310] TMEDA (1.33 mL, 8.81 mmol) was added to 5-bromo-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one (CAS Reg. No. 84712-08-3) (1.0 g, 4.4 mmol), (6-fluoropyridin-3-yl)boronic acid (CAS Reg. No. 351019-18-6) (1.55 g, 11.0 mmol) and Cu(OTf).sub.2 (3.19 g, 8.81 mmol) in DCM (30 mL) at rt. Air was allowed to diffuse into the reaction mixture via a CaCl.sub.2-tube on top of the flask and the resulting mixture was stirred at rt for 15 h. The reaction mixture was diluted with water (150 mL) and extracted with DCM (4?300 mL). The combined organic layers were washed with water (2?200 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated. The obtained material was purified by purified by flash chromatography on silica (gradient: 0-60% EtOAc in n-heptane) to afford (0.38 g, 27%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 321.8/323.8 (Br isotope pattern).

    Step B. i-51b

    5-Bromo-3-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one

    [1311] ##STR00577##

    [1312] K.sub.2CO.sub.3 (219 mg, 1.59 mmol) was added to 5-bromo-3-(6-fluoropyridin-3-yl)-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one compound i-51a (358 mg, 1.11 mmol) and (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (116 mg, 0.53 mmol) in DMSO (5 mL) at rt and the resulting mixture was stirred at 120? C. for 15 h. The mixture was filtered through a Celite pad and the filter cake washed with DCM (4?5 mL). The filtrate was concentrated under reduced pressure and purified by flash C18-flash chromatography (elution gradient: 0-100% MeOH in water) to afford (95 mg, 34%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 521/523 (Br isotope pattern).

    Intermediate 52

    Step A. i-52a

    tert-Butyl ((1S,3S)-3-((5-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1313] ##STR00578##

    [1314] m-CPBA (733 mg, 3.40 mmol) was added portion-wise to a stirred solution of 5-methyl-3-(methylthio)-1,2,4-triazine (CAS Reg. No. 28735-24-2) (400 mg, 2.83 mmol) in DCM (8 mL) at rt and the resulting solution was stirred at this temperature for 2 h. The solvent was removed under reduced pressure to afford a pale-yellow solid which was dissolved in n-BuOH (8 mL). tert-Butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (567 mg, 2.83 mmol) was added and the resulting solution was stirred at 120? C. for 15 h. The reaction mixture was quenched with 1 M NaOH (aq) (150 mL) and extracted with EtOAc (3?100 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue purified by preparative TLC (EtOAc:PE=3:1) to afford (220 mg, 26%) of the title compound as an orange solid. MS (ESI): m/z [M+H].sup.+ 294.2.

    Step B i-52b

    (1S,3S)N.SUP.1.-(5-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine

    [1315] ##STR00579##

    [1316] tert-Butyl ((1S,3S)-3-((5-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-52a (210 mg, 0.72 mmol) was treated with DCM (6 mL) and TFA (2 mL) and the resulting mixture stirred at rt for 3 h. The reaction mixture was quenched with sat. NaHCO.sub.3 (100 mL) and extracted with (7 M NH.sub.3 in MeOH:DCM=1:20) (3?75 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford (120 mg, 87%) of the title compound as an orange solid which was used without further purification. MS (ESI): m/z [M+H].sup.+ 194.1.

    Intermediate 53

    Step A. i-53a

    tert-Butyl ((1S,3S)-3-((5,6-dimethyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1317] ##STR00580##

    [1318] 5,6-Dimethyl-3-(methylthio)-1,2,4-triazine (CAS Reg. No. 7275-70-9) (400 mg, 2.58 mmol) was added portion-wise to a stirred solution of 3-chlorobenzoperoxoic acid (667 mg, 3.09 mmol) in DCM (10 mL) at rt and the resulting solution was stirred at this temperature for 2 h. The solvent was removed under reduced pressure to afford a pale-yellow solid which was dissolved in n-BuOH (10 mL). tert-Butyl ((1S,3S)-3-aminocyclopentyl)carbamate (CAS Reg. No. 645400-44-8) (567 mg, 2.83 mmol) was added and the resulting solution was stirred at 120? C. for 15 h. The reaction mixture was quenched with 1 M NaOH aq (100 mL) and extracted with EtOAc (3?75 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the obtained material purified by preparative TLC (EtOAc:PE=2:1) to afford (115 mg, 14%) of the title compound as an orange solid. MS (ESI): m/z [M+H].sup.+ 308.2.

    Step B. i-53b

    (1S,3S)N.SUP.1.-(5,6-Dimethyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine?3 TFA

    [1319] ##STR00581##

    [1320] tert-Butyl ((1S,3S)-3-((5,6-dimethyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-53a (100 mg, 0.33 mmol) was treated with TFA (2 mL) and DCM (6 mL).The resulting mixture was stirred at rt for 3 h and the organic solvents were removed by evaporation to afford (112 mg, 63%) of the crude title compound as a brown oil which was used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 208.0.

    Intermediate 54

    Step A. i-54a

    tert-Butyl ((1S,3S)-3-((2-oxo-3-(trifluoromethyl)-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate

    [1321] ##STR00582##

    [1322] 3-(Trifluoromethyl)pyridin-2(1H-one (CAS Reg. No. 22245-83-6) (324 mg, 1.98 mmol) was added to tert-butyl ((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)carbamate compound i-1a (400 mg, 0.99 mmol), Cu(I)I (94 mg, 0.50 mmol), Cs.sub.2CO.sub.3 (970 mg, 2.98 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (70 mg, 0.50 mmol) in 1,4-dioxane (20 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was poured into water (150 mL), extracted with EtOAc (5?100 mL) and the combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The residue was first purified by preparative TLC (MeOH:EtOAc=1:1) and then by flash C18-flash chromatography (gradient: 0-100% MeCN in water) to afford (235 mg, 54%) of the title compound as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 439.2.

    Step B. i-54b

    6-(((1S,3S)-3-Aminocyclopentyl)amino)-3-(trifluoromethyl)-2H-[1,3-bipyridin]-2-one

    [1323] ##STR00583##

    [1324] tert-Butyl ((1S,3S)-3-((2-oxo-3-(trifluoromethyl)-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)carbamate compound i-54a (220 mg, 0.50 mmol) was added to a mixture of 4M HCl in MeOH (2 mL, 8 mmol) and MeOH (8 mL) at rt and the resulting mixture was stirred at 60? C. for 2 h. The solvent was removed under reduced pressure and the material purified by flash C18-flash chromatography (gradient: 0-100% MeCN in water) to give (148 mg, 87%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 339.0.

    Intermediate 57

    i-57a

    3-(5-Bromopyrazin-2-yl)-1-methylpyridin-2(1H)-one

    [1325] ##STR00584##

    [1326] 2-Bromo-5-iodopyrazine (CAS Reg. No. 622392-04-5) (1.68 g, 5.88 mmol) was added to (1-methyl-2-oxo-1,2-dihydropyridin-3-yl)boronic acid (CAS Reg. No. 1454558-46-3) (300 mg, 1.96 mmol), KOAc (578 mg, 5.88 mmol) and PdCl.sub.2(dppf)?DCM (160 mg, 0.20 mmol) in 1,4-dioxane (16 mL) and water (4 mL) at rt and the resulting mixture was stirred at 100? C. for 2 h under nitrogen. The reaction mixture was poured into water (150 mL) and extracted with EtOAc (4?100 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the obtained material was purified by flash chromatography on silica (gradient: 0-100% EtOAc in n-heptane) to afford (360 mg, 69%) of the title compound as a brown solid. MS (ESI): m/z [M+H].sup.+ 265.8/267.8.

    Intermediate 58

    i-58a

    3-(6-Chloropyridin-3-yl)pyrimidin-4(3H)-one

    [1327] ##STR00585##

    [1328] TMEDA (0.942 mL, 6.24 mmol) was added to (6-chloropyridin-3-yl)boronic acid (CAS Reg. No. 444120-91-6) (983 mg, 6.24 mmol), pyrimidin-4(3H)-one (CAS Reg. No. 4562-27-0) (300 mg, 3.12 mmol) and Cu(OTf).sub.2 (2.26 g, 6.24 mmol) in DCM (35 mL) at rt. Air was allowed to diffuse into the reaction mixture via a CaCl.sub.2-tube on top of the flask. The resulting suspension was stirred at rt for 18 h. The reaction mixture was diluted with DCM (150 mL), and washed sequentially with water (2?50 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was purified by preparative TLC (EtOAc:PE=2:1) to afford (243 mg, 37%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 207.9.

    Intermediate 59

    i-59a

    3-(2-Chloropyrimidin-5-yl)-1-methylpyridin-2(1H)-one

    [1329] ##STR00586##

    [1330] 3-Bromo-1-methylpyridin-2(1H-one (CAS Reg. No. 81971-38-2) (300 mg, 1.60 mmol) was added to (2-chloropyrimidin-5-yl)boronic acid (CAS Reg. No. 1003845-06-4) (505 mg, 3.19 mmol), K.sub.2CO.sub.3 (662 mg, 4.79 mmol) and Pd-118/PdCl.sub.2(dtbpf) (104 mg, 0.16 mmol) in 1,4-dioxane (8 mL) and water (2 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was poured into water (150 mL) and the aqueous layer was extracted with EtOAc (5?150 mL).The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was purified by preparative TLC (MeOH:DCM=1:20) to afford (105 mg, 30%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 221.9.

    Intermediate 60

    Step A. i-60a

    3-((6-Chloropyridin-3-yl)amino-4-nitrobenzonitrile

    [1331] ##STR00587##

    [1332] K.sub.2CO.sub.3 (6.45 g, 46.7 mmol) was added to 3-fluoro-4-nitrobenzonitrile (CAS Reg. No 218632-01-0) (3.10 g, 18.7 mmol), 6-chloropyridin-3-amine (CAS Reg. No. 5350-93-6) (2.0 g, 15.6 mmol) and Pd(OAc).sub.2 (0.262 g, 1.17 mmol) and XantPhos (1.35 g, 2.33 mmol) in MeCN (40 mL) at rt and the resulting mixture was stirred at 80? C. for 15 h under nitrogen. The reaction mixture was filtered through celite and the filter cake washed with DCM (3?50 mL). The combined filtrates were concentrated under reduced pressure and taken up with EtOAc (250 mL). The organic layer was washed sequentially with sat. NaHCO.sub.3 (3?250 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated. The obtained residue was purified by preparative TLC (DCM) to afford (0.63 g, 15%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 275.1.

    Step B. i-60b

    4-Amino-3-((6-chloropyridin-3-yl)amino)benzonitrile

    [1333] ##STR00588##

    [1334] Zinc (971 mg, 14.9 mmol) was added to 3-((6-chloropyridin-3-yl)amino)-4-nitrobenzonitrile compound i-60a (510 mg, 1.86 mmol) and NH.sub.4Cl (795 mg, 14.8 mmol) in EtOH (15 mL) at rt and the resulting mixture was stirred at 60? C. for 5 h. The reaction mixture was filtered through celite and the filter cake washed with EtOH (3?50 mL). The combined filtrates were concentrated under reduced pressure to afford (363 mg, 80%) of the title compound as a brown solid which was used in the next step directly without further purification. MS (ESI): m/z [M+H].sup.+ 245.1.

    Step C. i-60c

    3-(6-Chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile

    [1335] ##STR00589##

    [1336] CDI (795 mg, 4.90 mmol) was added to 4-amino-3-((6-chloropyridin-3-yl)amino)benzonitrile compound i-60b (300 mg, 1.23 mmol) in DMF (2 mL) at rt and the resulting mixture was stirred at 80? C. for 24 h. The solid was filtered off to afford the crude product which was triturated with MeCN and dried under vacuum to give (242 mg, 73%) of the title compound as a pink solid. MS (ESI): m/z [M+H].sup.+ 271.0.

    Step D. i-60d

    3-(6-Chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile

    [1337] ##STR00590##

    [1338] Cs.sub.2CO.sub.3 (542 mg, 1.66 mmol) was added to a mixture of 3-(6-chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile compound i-60c (150 mg, 0.55 mmol) and CH.sub.3I (118 mg, 0.83 mmol) in DMF (5 mL) at rt and it was stirred at 100? C. for 18 h. The reaction mixture was diluted with EtOAc (50 mL) and washed sequentially with brine (3?50 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the obtained material was triturated with MeCN. The formed solid was collected by filtration and dried under vacuum to give (110 mg, 70%) of the title compound as a pink solid. MS (ESI): m/z [M+H].sup.+ 285.1.

    Intermediate 61

    Step A. i-61a

    4-((6-Chloropyridin-3-yl)amino)-3-nitrobenzonitrile

    [1339] ##STR00591##

    [1340] Pd(OAc).sub.2 (0.262 g, 1.17 mmol) was added to a mixture of K.sub.2CO.sub.3 (6.45 g, 46.7 mmol), 4-fluoro-3-nitrobenzonitrile (CAS Reg. No. 1009-35-4) (2.84 g, 17.1 mmol), 6-chloropyridin-3-amine CAS Reg. No. 5350-93-6 (2.0 g, 15.6 mmol) and XantPhos (1.35 g, 2.33 mmol) in MeCN (40 mL) at rt and it was stirred at 80? C. for 15 h under nitrogen. The reaction mixture was filtered through Celite and the filter cake washed with DCM (3?200 mL). The combined filtrates were concentrated under reduced pressure and taken up with EtOAc (300 mL). The organic layer was washed sequentially with sat. NaHCO.sub.3 (3?400 mL), dried over (Na.sub.2SO.sub.4), filtered and evaporated. The obtained material was purified by preparative TLC (DCM) to afford (0.70 g, 16%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 275.0

    Step B. i-61b

    3-Amino-4-((6-chloropyridin-3-yl)amino)benzonitrile

    [1341] ##STR00592##

    [1342] Zinc (1.33 g, 20.4 mmol) was added to NH.sub.4Cl (1.09 g, 20.4 mmol), 4-((6-chloropyridin-3-yl)amino)-3-nitrobenzonitrile compound i-61a (0.70 g, 2.54 mmol) in EtOH (15 mL) at rt and the resulting mixture was stirred at 60? C. for 5 h. The reaction mixture was filtered through Celite and the filter cake washed with EtOH (3?50 mL). The combined filtrates were concentrated under reduced pressure to afford (0.51 g, 81%) of the title compound as a brown solid which was used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 245.1.

    Step C. i-61c

    1-(6-Chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile

    [1343] ##STR00593##

    [1344] CDI (1.19 g, 7.36 mmol) was added to 3-amino-4-((6-chloropyridin-3-yl)amino)benzonitrile compound i-61b (450 mg, 1.84 mmol) in DMF (10 mL) at rt and the resulting mixture was stirred at 80? C. for 24 h. The solid was filtered off to afford the crude product which was triturated with MeCN and dried under vacuum to give (342 mg, 69%) of the title compound as a pink solid. MS (ESI): m/z [M+H].sup.+ 270.9.

    Step D. i-61d

    1-(6-Chloropyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile

    [1345] ##STR00594##

    [1346] CH.sub.3I (157 mg, 1.11 mmol) was added to a mixture of 1-(6-chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile compound i-61c (200 mg, 0.74 mmol) and Cs.sub.2CO.sub.3 (722 mg, 2.22 mmol) in DMF (8 mL) at rt and it was stirred at 100? C. for 15 h. The reaction mixture was diluted with EtOAc (100 mL) and washed sequentially with brine (3?100 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford (119 mg, 57%) of the title compound as a yellow solid which was used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 285.0.

    Intermediate 62

    i-62a

    2-(6-Fluoropyridin-3-yl)pyridazin-3(2H)-one

    [1347] ##STR00595##

    [1348] 2-Fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (300 mg, 1.35 mmol) was added to a mixture of pyridazin-3(2H)-one (CAS Reg. No. 504-30-3) (259 mg, 2.69 mmol), Cu(I)l (128 mg, 0.67 mmol), Cs.sub.2CO.sub.3 (1315 mg, 4.04 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (96 mg, 0.67 mmol) in 1,4-dioxane (20 mL) at rt and it was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with water (50 mL) and the aqueous layer extracted with EtOAc (8?30 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue purified by preparative TLC (EtOAc) to afford (242 mg, 94%) of the title compound as a brown solid. MS (ESI): m/z [M+H].sup.+ 191.9.

    Intermediate 63

    Step A. i-63a

    5-((tert-Butyldimethylsilyl)ethynyl)-6-chloro-2H-[1,3-bipyridin]-2-one

    [1349] ##STR00596##

    [1350] Cs.sub.2CO.sub.3 (2.23 g, 6.86 mmol) was added to 5-((tert-butyldimethylsilyl)ethynyl)pyridin-2(1H)-one (CAS Reg. No. 2448766-74-1) (800 mg, 3.43 mmol), 2-chloro-5-iodopyridine (CAS Reg. No. 69045-79-0) (821 mg, 3.43 mmol), Cu(I)l (653 mg, 3.43 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (731 mg, 5.14 mmol) in 1,4-dioxane (20 mL) at rt and the resulting suspension was stirred at 60? C. for 5 h under nitrogen. The mixture was combined with a second batch made in the same way and filtered through a Celite pad. The filter cake was washed with EtOAc (100 mL) and the combined filtrates were concentrated under reduced pressure. The crude product was purified by flash chromatography on silica (gradient: 0-50% EtOAc in n-heptane) to afford (590 mg, 25%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 345.0.

    Step B. i-63b

    6-Chloro-5-ethynyl-2H-[1,3-bipyridin]-2-one

    [1351] ##STR00597##

    [1352] A solution of TBAF in THE (1 M, 8.55 mL, 8.55 mmol) was added to 5-((tert-butyldimethylsilyl)ethynyl)-6-chloro-2H-[1,3-bipyridin]-2-one compound i-63a (590 mg, 1.71 mmol) in THE (15 mL) at rt and the resulting solution was stirred at for 2 h. The solvent was removed under reduced pressure and the residue was purified by preparative TLC (EtOAc:PE=2:1) followed by flash C18-flash chromatography (elution gradient: 0-30% MeCN in water) to afford (290 mg, 74%) of the title compound as a beige solid. MS (ESI): m/z [M+H].sup.+ 231.0.

    Intermediate 67

    Step A. i-67a

    5-(1-Methyl-1H-pyrazol-4-yl)pyridin-2-ol

    [1353] ##STR00598##

    [1354] A mixture of 5-iodo-2(1H)-pyridinone (CAS Reg. No. 13472-79-2) (500 mg, 2.26 mmol), 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (CAS Reg. No. 761446-44-0) (565 mg, 2.71 mmol) and XPhos (CAS Reg. No. 564483-18-7) (108 mg, 0.23 mmol) in 1,4-dioxane (10 mL) and water (1 mL) was treated with XPhos Pd G3 (CAS Reg. No. 1445085-55-1) (192 mg, 0.23 mmol) under nitrogen and stirred at 100? C. for 18 h. The reaction mixture was cooled to rt and filtered through a pad of Celite. The filter cake was washed with EtOAc (100 mL) and the combined filtrates concentrated under reduced pressure. The obtained material was purified by flash chromatography on silica (gradient: 10-20% MeOH in DCM) to afford the title compound (250 mg, 63%) as a green solid. MS (ESI): m/z [M+H].sup.+ 175.9.

    Step B. i-67b

    6-Chloro-5-(1-methyl-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one

    [1355] ##STR00599##

    [1356] According to GM3 5-(1-methyl-1H-pyrazol-4-yl)pyridin-2-ol compound i-67a (250 mg, 1.43 mmol), 2-chloro-5-iodopyridine (342 mg, 1.43 mmol), rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclo-hexane-1,2-diamine (203 mg, 1.43 mmol), Cs.sub.2CO.sub.3 (1.4 g, 4.3 mmol) and Cu(I)I (272 mg, 1.43 mmol) were reacted in 1,4-dioxane (8 mL) at 100? C. for 18 h to give upon non-aqueous work-up (EtOAc) and flash chromatography on silica (gradient: 0-10% MeOH in DCM) the title compound (250 mg, 61%) as a green solid. m/z [M+H].sup.+ 287.1/289 (Cl isotope pattern).

    Intermediate 68a

    i-68a

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(2-(tetrahydro-2H-pyran-2-yl)-2H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one

    [1357] ##STR00600##

    [1358] 3-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one Example 129 (280 mg, 0.70 mmol) was added to a mixture of 1-(tetrahydro-2H-pyran-2-yl)-5-(4,4,5,5-tetramethyl-1,3,2doxaborolan-2-yl)-1H-1,2,3-triazole (CAS Reg. No. 2710298-24-9) (393 mg, 1.41 mmol), Cs.sub.2CO.sub.3 (688 mg, 2.11 mmol), XPhos (CAS Reg. No. 564483-18-7) (34 mg, 0.07 mmol) and XPhos Pd G3 (CAS Reg. No. 1445085-55-1) (59 mg, 0.07 mmol) in 1,4-dioxane (16 mL) and water (4 mL) under nitrogen. The resulting reaction mixture was stirred at 100? C. for 15 h and subsequently poured into saturated brine (150 mL). It was extracted with EtOAc (4?150 mL) and the combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated. The crude material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to give the title compound (335 mg, 93%) as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 515.1.

    Intermediate 76

    i-76a

    (6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid

    [1359] ##STR00601##

    [1360] tert-Butyl ((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-28a (1.32 g, 4.50 mmol) was dissolved in DCM (15 mL) and TFA (5 mL). After stirring for 1 h toluene was added, and the resulting mixture was concentrated. The residue was dissolved in DMSO (10 mL) and treated with 2-fluoro-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine (CAS Reg. No. 444120-95-0) (1.81 g, 8.11 mmol) and K.sub.2CO.sub.3 (2.25 g, 16.3 mmol), and the resulting mixture was stirred at 80? C. for 20 h. The mixture was cooled to rt, solids were filtered off and the filtrate purified by preparative HPLC (PrepMethod G, gradient 0-50%) to afford (1.07 g, 66%) of the title compound as a red solid MS (ESI) m/z [M+H].sup.+ 315.

    Intermediate 77

    Step. A i-77a

    (1S,3S)N.SUP.1.-(5-(2,4-Dimethyl-1H-imidazol-1-yl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine

    [1361] ##STR00602##

    [1362] A mixture of (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (0.126 g, 0.40 mmol), 2,4-dimethyl-1H-imidazole (CAS Reg. No. 930-62-1), Cu(OAc).sub.2 (0.175 g, 0.96 mmol) and pyridine (0.178 mL, 2.21 mmol) in DCM (4 mL) and DMF (0.8 mL) was stirred at rt for 24 h. Solids were filtered off and washed with MeOH. The combined filtrates were concentrated and purified by preparative HPLC (PrepMethod F, gradient 20-60%) to afford (52 mg, 36%) of the title compound as a beige solid. MS (ESI) m/z [M+H].sup.+ 365.

    Step. B i-77b

    (1S,3S)N.SUP.1.-(5-(5-lodo-2,4-dimethyl-1H-imidazol-1-yl)pyridin-2-yl)-AP-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine

    [1363] ##STR00603##

    [1364] A mixture of compound i-77a (0.051 g, 0.14 mmol) and NIS (0.063 g, 0.28 mmol) in MeCN (2 mL) was stirred at rt for 2 h. The mixture was concentrated, the residue dissolved in DCM and washed with water. The organic layer was concentrated and purified by preparative HPLC (PrepMethod H, gradient 20-60%) to afford (55 mg, 80%) of the title compound as a beige solid. MS (ESI) m/z [M+H].sup.+ 491.

    Intermediate 80

    i-80a

    6-Methyl-3-(methylsulfinyl)-1,2,4-triazin-5(4H)-one

    [1365] ##STR00604##

    [1366] According to GM8 6-methyl-3-(methylthio)-1,2,4-triazin-5(4H)-one (CAS Reg. No. 1566-32-1) (300 mg, 1.91 mmol) was treated portionwise with 3-chlorobenzoperoxoic acid (494 mg, 2.29 mmol) in DCM (25 mL) at rt for 2 h to give upon purification by preparative TLC (DCM:MeOH=10:1) the title compound (200 mg, 61%) as a white solid. MS (ESI): m/z [M+H].sup.+ 174. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 2.15 (3H, s), 2.71 (3H, s).

    Intermediate 81

    Step A. i-81a

    N-(6-Chloropyridin-3-yl)-6-methyl-3-nitropyridin-2-amine

    [1367] ##STR00605##

    [1368] XantPhos (CAS Reg. No. 161265-03-8) (34 mg, 0.06 mmol) was added to a mixture of 2-chloro-6-methyl-3-nitropyridine (CAS Reg. No. 56057-19-3) (1.00 g, 8.69 mmol), 6-chloropyridin-3-amine (CAS Reg. No. 5350-93-6) (1.12 g, 7.8 mmol), Na.sub.2CO.sub.3 (1.84 g, 17.4 mmol) and Pd(OAc).sub.2 (13 mg, 0.06 mmol) in THF (15 mL) at rt under nitrogen and it was stirred at 80? C. for 15 h. The reaction mixture was concentrated under reduced pressure and taken up with EtOAc (250 mL). The organic layer was washed with sat. brine (4?125 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated. The crude material was purified by flash chromatography on silica (gradient: 0-10% EtOAc in PE) to give the title compound (1.43 g, 93%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 265.0/267 (Cl isotope pattern).

    Step B. i-81b

    N.SUP.2.-(6-chloropyridin-3-yl)-6-methylpyridine-2,3-diamine

    [1369] ##STR00606##

    [1370] N-(6-Chloropyridin-3-yl)-6-methyl-3-nitropyridin-2-amine compound I-81a (1.4 g. 5.3 mmol) was added to a mixture of zinc (2.08 g, 31.7 mmol) and NH.sub.4Cl (2.83 g, 52.9 mmol) in a mixture of EtOH (8 mL) and EtOAc (8 mL) at rt and it was stirred at 60? C. for 15 h. The reaction mixture was filtered through a pad of Celite, the filtrate concentrated under reduced pressure and the crude material purified by preparative TLC (EtOAc) to give the title compound (1.2 g, 97%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 235.0/237 (Cl isotope pattern).

    Step C. i-81c

    3-(6-Chloropyridin-3-yl)-5-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one

    [1371] ##STR00607##

    [1372] N.sup.2-(6-chloropyridin-3-yl)-6-methylpyridine-2,3-diamine compound i-81b (65 mg, 0.28 mmol) in DMF (5 nL) was treated with CDI (CAS Reg. No. 530-62-1) (225 mg, 1.38 mmol) at rt under nitrogen and it was stirred at 80? C. for 2 h. The reaction mixture was diluted with EtOAc (100 mL) and washed with water (3?50 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material purified by preparative HPLC to give the title compound (42 mg, 58%) as a pale-yellow powder. MS (ESI): m/z [M+H].sup.+ 260.9/263 (Cl isotope pattern).

    Step D. i-81d

    3-(6-Chloropyridin-3-yl)-1,5-dimethyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one

    [1373] ##STR00608##

    [1374] In a vial a mixture of 3-(6-chloropyridin-3-yl)-5-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one compound i-81c (340 mg, 1.30 mmol) and K.sub.2CO.sub.3 (541 mg, 3.01 mmol) in DMF (25 nL) was treated with iodomethane (1.85 g, 13.0 mmol) at rt under nitrogen and it was stirred at 80? C. for 1 h. The reaction mixture was diluted with EtOAc (200 mL) and washed with water (3?50 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material purified by flash chromatography on silica (gradient: 0-50% EtOAc in PE) to give the title compound (305 mg, 85%) as a pink film. MS (ESI): m/z [M+H].sup.+ 275.0/277 (Cl isotope pattern).

    Step E. i-81e

    3-(6-Chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-5-carbonitrile

    [1375] ##STR00609##

    [1376] The reaction was run in 3 parallel batches (2? starting from 100 mg and 1?starting from 150 mg of compound i-81d). In a vial a mixture of 3-(6-chloropyridin-3-yl)-1,5-dimethyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one compound i-81d (150 mg, 0.55 mmol), 2-hydroxyisoindoline-1,3-dione (CAS Reg. No. 524-38-9) (45 mg, 0.27 mmol) and tert-butyl nitrite (CAS Reg. No. 540-80-7) (169 mg, 1.64 mmol) in MeCN (4 mL) was treated with Pd(OAc).sub.2 (12 mg, 0.05 mmol) at rt under nitrogen and it was stirred at 80? C. for 24 h. The reaction mixtures of the three parallel batches were combined, poured into water (200 mL) and the mixture extracted with EtOAc (3?150 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material purified by preparative TLC (EtOAc:PE=1:3) to give the title compound (180 mg, 44% average yield) as a brown solid. MS (ESI): m/z [M+H].sup.+ 286.2/288 (Cl isotope pattern).

    Intermediate 82

    Step A. i-82a

    6-((6-Chloropyridin-3-yl)amino)-5-nitronicotinonitrile

    [1377] ##STR00610##

    [1378] Na.sub.2CO.sub.3 (1.73 g, 16.3 mmol) was added to a mixture of 6-chloro-5-nitronicotinonitrile (CAS Reg. No. 160906-98-9) (1.00 g, 5.45 mmol), 6-chloropyridin-3-amine (CAS Reg. No. 5350-93-6) (1.40 g, 10.9 mmol), XantPhos (CAS Reg. No. 161265-03-8) (315 mg, 0.54 mmol) and Pd(OAc).sub.2 (61 mg, 0.27 mmol) in 1,4-dioxane (15 mL) at rt under nitrogen and it was stirred at 80? C. for 3 h. The reaction mixture was filtered through a filter membrane, concentrated under reduced pressure and the crude material was purified by preparative TLC (EtOAc:PE=1:1) to give the title compound (1.28 g, 85%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 275.8/278 (Cl isotope pattern).

    Step B. i-82b

    5-Amino-6-((6-chloropyridin-3-yl)amino)nicotinonitrile

    [1379] ##STR00611##

    [1380] 6-((6-Chloropyridin-3-yl)amino)-5-nitronicotinonitrile compound i-82a (1.28 g, 4.64 mmol) was added to a mixture of zinc (1.52 g, 23.2 mmol) and acetic acid (2.79 g, 46.4 mmol) in EtOH (15 mL) at rt and it was stirred at 60? C. for 2 h. The reaction mixture was filtered through a filter membrane, the filtrate concentrated under reduced pressure and the crude material purified by preparative TLC (EtOAc:PE=1:1) to give the title compound (1.26 g, 100%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 246.0/248 (Cl isotope pattern).

    Step C. i-82c

    3-(6-Chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-6-carbonitrile

    [1381] ##STR00612##

    [1382] 5-Amino-6-((6-chloropyridin-3-yl)amino)nicotinonitrile compound i-82b (1.26 g, 5.13 mmol) in DMF (15 mL) was treated with CDI (CAS Reg. No. 530-62-1) (4.16 g, 25.6 mmol) at rt under nitrogen and it was stirred at 80? C. for 2 h. The reaction mixture was poured into water (100 mL) and the mixture extracted with EtOAc (3?75 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material purified by preparative TLC (DCM:MeOH=10:1) to give the title compound (590 mg, 38%) as a yellow oil. MS (ESI): m/z [M+H].sup.+ 271.9/274 (Cl isotope pattern).

    Step D. i-82d

    3-(6-Chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-6-carbonitrile

    [1383] ##STR00613##

    [1384] In a vial a mixture of 3-(6-chloropyridin-3-yl)-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-6-carbonitrile compound i-82c (580 mg, 2.13 mmol) and K.sub.2CO.sub.3 (885 mg, 6.40 mmol) in DMF (2 nL) was treated with iodomethane (3.03 g, 21.4 mmol) at rt under nitrogen and it was stirred at 60? C. for 1 h. The reaction mixture was poured into water (100 mL) and the mixture extracted with EtOAc (3?75 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material purified by preparative TLC (DCM:PE=10:1) to give the title compound (401 mg, 66%) as a brown oil. MS (ESI): m/z [M+H].sup.+ 285.9/288 (Cl isotope pattern).

    Intermediate 83

    Step A. i-83a

    (1S,3S)N.SUP.1.-(1,2,4-Triazin-3-yl)cyclopentane-1,3-diamine

    [1385] ##STR00614##

    [1386] HCl (4 M in MeOH, 4 mL, 16 mmol) was added slowly to tert-butyl ((1S,3S)-3-((1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22a (200 mg, 0.72 mmol) in MeOH (10 mL) at 20? C. and the resulting solution was stirred at 60? C. for 1 h. The solvent was removed under reduced pressure to give an unspecified HCl salt of the crude title compound (265 mg, 100%) as a brown gum that was directly used in the next step. MS (ESI): m/z [M+H].sup.+ 179.8.

    Step B. i-83b

    6-(((1S,3S)-3-((1,2,4-Triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    [1387] ##STR00615##

    [1388] (1S,3S)N.sup.1-(1,2,4-Triazin-3-yl)cyclopentane-1,3-diamine compound i-83a (255 mg, 0.69 mmol) was added to 6-fluoro-2H-[1,3-bipyridin]-2-one compound i-100a (197 mg, 1.04 mmol) and K.sub.2CO.sub.3 (477 mg, 3.45 mmol) in DMSO (5 mL) at 25? C. The resulting mixture was stirred at 120? C. for 15 h under a nitrogen atmosphere. The crude product was purified by C18 flash chromatography (gradient: 40-55% MeCN in water) to give the title compound (175 mg, 72%) as a brown gum. MS (ESI): m/z [M+H].sup.+ 349.9.

    Intermediate 84

    Step A. i-84a

    [1389] (1S,3S)N.sup.1-(6-Bromo-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine

    ##STR00616##

    [1390] TFA (2.2 mL, 29 mmol) was added to tert-butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22b (1.2 g, 3.4 mmol) in DCM (20 mL) at 30? C. and the resulting mixture stirred at this temperature for 5 h. The reaction mixture was concentrated, diluted with MeOH:DCM=1:10 (300 mL) and washed sequentially with sat. NaHCO.sub.3 (3?125 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated to give the crude title compound (0.563 g, 65%) as a black gum that was directly used in the next step. MS (ESI): m/z [M+H].sup.+ 259.8.

    Step B. i-84b

    6-(((1S,3S)-3-((6-Bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one

    [1391] ##STR00617##

    [1392] (1S,3S)N.sup.1-(6-bromo-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-84a (530 mg, 2.05 mmol) was added to 6-fluoro-2H-[1,3-bipyridin]-2-one compound i-100a (781 mg, 4.11 mmol) and Na.sub.2CO.sub.3 (653 mg, 6.16 mmol) in DMSO (20 mL) at 30? C. and the resulting mixture was stirred at 120? C. for 15 h. The reaction mixture was concentrated, diluted with EtOAc (250 mL) and washed sequentially with sat. brine (3?100 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained residue was purified by preparative TLC (EtOAc) to give the title compound (117 mg, 13%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 427.8.

    Intermediate 85

    Step A. i-85a

    tert-Butyl ((1S,3S)-3-((6-(1-(tetrahydro-2H-pyran-2-yl)-1H-pyrazol-5-yl)-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1393] ##STR00618##

    [1394] Cs.sub.2CO.sub.3 (819 mg, 2.51 mmol) was added to a mixture of tert-butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22b (300 mg, 0.84 mmol), 1-(tetrahydro-2H-pyran-2-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (CAS Reg. No. 903550-26-5) (466 mg, 1.67 mmol) and PdCl.sub.2(dtbpf) (55 mg, 0.08 mmol) in 1,4-dioxane (5 mL) at 20? C. and the resulting suspension was stirred at 100? C. for 2 h under a nitrogen atmosphere. The reaction mixture was poured into water (100 mL) and extracted with EtOAc (2?100 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to give the title compound (273 mg, 76%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 430.1.

    Step B. i-85b

    (1S,3S)N.SUP.1.-(6-(1H-Pyrazol-5-yl)-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine

    [1395] ##STR00619##

    tert-Butyl ((1S,3S)-3-((6-(1-(tetrahydro-2-pyran-2-yl)-1H-pyrazol-5-yl)-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-85a (263 mg, 0.61 mmol) was added to TFA (2 mL) and DCM (2 mL) at 20? C. and the resulting solution stirred at 60? C. for 2 h. The solvent was removed under reduced pressure and the residue purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to give the title compound (431 mg, 100%) as a brown gum. MS (ESI): m/z [M+H].sup.+ 245.9.

    Intermediate 86

    Step A. i-86a

    tert-Butyl ((1S,3S)-3-((6-(ethylthio)-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1396] ##STR00620##

    [1397] Sodium ethanethiolate (141 mg, 1.67 mmol) was added to tert-butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-22b (200 mg, 0.56 mmol) in EtOH (5 mL) at 20? C. and the resulting solution was stirred at 60? C. for 16 h. The solvent was removed under reduced pressure and the residue purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to give the title compound (84 mg, 44%) as an orange solid. MS (ESI): m/z [M+H].sup.+ 339.9.

    Step B. i-86b

    (1S,3S)N.SUP.1.-(6-(Ethylthio)-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine?3.3TFA

    [1398] ##STR00621##

    [1399] TFA (2 mL, 26 mmol) was added to tert-butyl ((1S,3S)-3-((6-(ethylthio)-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-86a (73.8 mg, 0.22 mmol) in DCM (2 mL) at 20? C. and the resulting solution was stirred at this temperature for 16 h. The solvent was removed under reduced pressure to give the title compound (133 mg, 99%) as a brown gum.

    [1400] The compound was used directly in the next step. MS (ESI): m/z [M+H].sup.+ 239.9.

    Intermediate 87

    Step A. i-87a

    rel-tert-Butyl ((1R,3R)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1401] ##STR00622##

    [1402] DIPEA (0.94 mL, 5.4 mmol) and rel-tert-butyl ((1R,3R)-3-aminocyclopentyl)carbamate (CAS Reg. No. 947732-58-3) (0.446 g, 2.23 mmol) were added to a solution of crude 6-methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (0.283 g, 1.8 mmol) in MeCN (6 mL) and the resulting mixture was stirred at 50? C. for 5 days. The reaction solution was cooled to rt, concentrated under reduced pressure and the residue was dissolved in DCM and washed with 1 M NaOH (aq). The phases were separated and the aqueous phase was re-extracted with DCM (3?). The organic phases were combined, passed through a phase separator and concentrated. The obtained brown solid was further purified by flash chromatography on silica (gradient: 0-100% EtOAc:MeOH=95:5 in n-heptane) to give the title compound (0.280 g, 53%) as an yellow solid. MS (ESI): m/z [M+H].sup.+ 294.1.

    Step B. i-87b

    rel-(1 R,3R)N.SUP.1.-(6-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 3HCl

    [1403] ##STR00623##

    [1404] A solution of rel-tert-butyl ((1 R,3R)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-87a (280 mg, 0.95 mmol) in dioxane (4 mL) was treated with HCl (4 M in dioxane, 5 mL, 20 mmol) at rt and the formed slurry was stirred at rt for 20 h. The mixture was concentrated to dryness to give the crude title compound (312 mg) as a light-yellow solid. MS (ESI): m/z [M+H].sup.+ 194.1.

    Intermediate 90

    Step A. i-90a

    6-Bromo-3-(methylthio)-1,2,4-triazine

    [1405] ##STR00624##

    [1406] tert-Butyl nitrite (10.6 g, 103 mmol) was added dropwise to a mixture of 6-bromo-1,2,4-triazin-3-amine (CAS Reg. No. 58-4-028-01) (3.0 g, 17 mmol) and 1,2-dimethyldisulfane (16.2 g, 171 mmol) in MeCN (60 mL) at rt over a period of 10 minutes under air and the resulting solution was stirred at this temperature for 16 h. The solvent was removed under reduced pressure. The crude product was combined with three other equal batches prepared in the same way and purified by flash chromatography on silica (gradient: 0-20% EtOAc in n-heptane) to afford (8.60 g, 60%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 205.8/207.8 (Br isotope pattern).

    Step B. i-90b

    Ethyl 3-(methylthio)-1,2,4-triazine-6-carboxylate

    [1407] ##STR00625##

    [1408] Pd(OAc).sub.2 (0.142 g, 0.63 mmol) and XantPhos (0.584 g, 1.01 mmol) were added to a mixture of 6-bromo-3-(methylthio)-1,2,4-triazine compound i-90a (2.6 g, 12.6 mmol) and TEA (5.3 mL, 38 mmol) in EtOH (26 mL) at rt under air. The resulting suspension was put under an atmosphere of carbon monoxide (20 atm) and stirred at 85? C. for 16 h. The mixture was combined with three other equal batches prepared in the same way and filtered through a Celite pad. The filter cake was washed with EtOAc (100 mL) and the combined filtrates were concentrated under reduced pressure. The obtained material was purified by flash chromatography on silica (gradient: 0-20% EtOAc in n-heptane) to afford (6.10 g, 73%) of the title compound as a yellow oil. MS (ESI): m/z [M+H].sup.+ 200.

    Step C. i-90c

    3-(Methylthio)-1,2,4-triazine-6-carboxylic acid

    [1409] ##STR00626##

    [1410] NaOH (1 M aq) (18 mL, 18 mmol) was added dropwise to ethyl 3-(methylthio)-1,2,4-triazine-6-carboxylate compound i-90b (3.0 g, 15 mmol) in THE (20 mL) and water (10 mL) at 0? C. and the resulting solution was stirred at rt for 1 h. The reaction mixture was diluted with water/ice (150 mL), the aqueous layer was adjusted to pH 2 with 2 M HCl (aq) and extracted with EtOAc (3?100 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford (2.5 g, 97%) of the title compound as a brown gum which was used without further purification. MS (ESI): m/z [M+H].sup.+ 172.

    Step D. i-90d

    3-(Methylthio)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide

    [1411] ##STR00627##

    [1412] T3P in EtOAc (50% w/w) (18.6 g, 29.2 mmol) was added to a mixture of crude 3-(methylthio)-1,2,4-triazine-6-carboxylic acid compound i-90c (2.5 g, 14.6 mmol), oxetan-3-amine (2.14 g, 29.2 mmol) and DIPEA (7.65 mL, 43.8 mmol) in EtOAc (75 mL) at rt and the resulting solution was stirred at 60? C. for 15 h. The reaction mixture was poured into sat. NaHCO.sub.3 (aq) (150 mL) and extracted with EtOAc (3?125 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford yellow gum. Th is material was triturated with EtOAc:PE=1:3 (10 mL) to afford (1.0 g, 30%) of the title compound as a pale yellow solid. MS (ESI): m/z [M+H].sup.+ 227.1.

    Step E. i-90e

    3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide

    [1413] ##STR00628##

    [1414] m-CPBA (1.05 g, 4.86 mmol) was added dropwise to 3-(methylthio)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90d (1.0 g, 4.42 mmol) in DCM (10 mL) at rt and the resulting solution was stirred at rt for 30 min. (1S,3S)N.sup.1-(5-Iodopyridin-2-yl)cyclopentane-1,3-diamine?2HCl compound i-17a (1.08 g, 2.87 mmol) and TEA (3.1 mL, 22 mmol) were added to the reaction mixture and it was stirred at rt for another 8 h. The reaction mixture was poured into 1 M NaOH aq (150 mL) and extracted with DCM (3?100 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford yellow oil which solidified on standing. This material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to afford (0.50 g, 23%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 481.7.

    Intermediate 91

    Step A. i-91a

    Methyl 3-(6-chloropyridin-3-yl)-4-fluoro-2-methoxybenzoate

    [1415] ##STR00629##

    [1416] CataCXium A Pd G3 (55 mg, 0.08 mmol) was added to a mixture of methyl 3-bromo-4-fluoro-2-methoxybenzoate (CAS Reg. No. 1935415-04-05) (200 mg, 0.76 mmol), 2-chloropyridine-5-boronic acid (CAS Reg. No. 444120-91-6) (179 mg, 1.14 mmol), K.sub.2CO.sub.3 (210 mg, 1.52 mmol) and water (2 mL) in 1,4-dioxane (8 mL) at rt under nitrogen and it was stirred at 80? C. for 8 h. The reaction mixture was poured into water (50 mL) and filtered through a Celite pad. The filtrate was extracted with EtOAc (3?25 mL) and the combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated. The obtained material was purified by preparative TLC (PE:EtOAc=3:1) to afford (160 mg, 71%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 296.0.

    Step B. i-91b

    Methyl 3-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-4-fluoro-2-methoxybenzoate

    [1417] ##STR00630##

    [1418] (1S,3S)N.sup.1-(6-Cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (133 mg, 0.61 mmol) was added to a mixture of methyl 3-(6-chloropyridin-3-yl)-4-fluoro-2-methoxybenzoate compound i-91a (150 mg, 0.51 mmol), Pd-PEPPSI-IPentCl 2-methylpyridine (43 mg, 0.05 mmol) and Cs.sub.2CO.sub.3 (496 mg, 1.52 mmol) in 1,4-dioxane (10 mL) at rt under nitrogen and it was stirred at 100? C. for 8 h. The reaction mixture was poured into water (20 mL) and filtered through a Celite pad. The filtrate was extracted with EtOAc (3?10 mL) and the combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated. The obtained material was purified by preparative TLC (EtOAc:PE=1:1) to afford (90 mg, 37%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 479.2.

    Intermediate 92

    Step A. i-92a

    3-Bromo-4-fluoro-2-methoxybenzamide

    [1419] ##STR00631##

    [1420] Sodium methoxide (30% w/w in MeOH, 458 mg, 2.54 mmol) was added dropwise to 3-bromo-2,4-difluorobenzamide (CAS Reg. No. 1518200-63-9) (500 mg, 2.12 mmol) in DMSO (30 mL) at rt and the resulting mixture was stirred at rt for 1 h. The reaction mixture was quenched with water (50 mL) and extracted with EtOAc (3?50 mL). The combined organic layers were washed with sat. NH.sub.4Cl aq (3?50 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was purified by preparative TLC (DCM:MeOH=30:1) to afford (400 mg, 76%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 249.8.

    Step B. i-92b

    3-(6-Chloropyridin-3-yl)-4-fluoro-2-methoxybenzamide

    [1421] ##STR00632##

    [1422] 3-Bromo-4-fluoro-2-methoxybenzamide compound i-92a (320 mg, 1.29 mmol) was added to a mixture of PdCl.sub.2(dppf) DCM adduct (105 mg, 0.13 mmol), Na.sub.2CO.sub.3 (273 mg, 2.58 mmol) and 2-chloropyridine-5-boronic acid (CAS Reg. No. 444120-91-6) (305 mg, 1.94 mmol) in 1,4-dioxane (15 mL) and water (2.5 mL) at rt and it was stirred at 80? C. for 8 h. The reaction mixture was poured into water (50 mL) and filtered through Celite. The filtrate was extracted with EtOAc (3?) and the combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated. The obtained material was purified by preparative TLC (EtOAc:PE=1:2) to afford (130 mg, 36%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 281.

    Step C. i-92c

    3-(6-Chloropyridin-3-yl)-4-fluoro-2-methoxybenzonitrile

    [1423] ##STR00633##

    [1424] TFAA (0.13 mL, 0.93 mmol) was added to a mixture of TEA (0.258 mL, 1.85 mmol) and 3-(6-chloropyridin-3-yl)-4-fluoro-2-methoxybenzamide compound i-92b (130 mg, 0.46 mmol) in DCM (10 mL) at 0? C. The reaction was allowed to reach rt and stirred at rt for 4 h. The reaction mixture was poured into water (50 mL) and extracted with DCM (3?20 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the obtained material was purified by preparative TLC (PE:EtOAc=3:1) to afford (100 mg, 82%) of the title compound as a yellow solid. MS (ESI): m/z [M+H].sup.+ 263.

    Intermediate 100

    i-100a

    6-Fluoro-2H-[1,3-bipyridin]-2-one

    [1425] ##STR00634##

    [1426] rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (1.50 g, 10.5 mmol) was added to a mixture of pyridin-2(1H-one (CAS Reg. No. 142-08-5) (5.0 g, 52.6 mmol), 2-fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (17.6 g, 78.9 mmol), Cu(I)I (4.01 g, 21.0 mmol) and K.sub.2CO.sub.3 (14.53 g, 105.2 mmol) in 1,4-dioxane (50 mL) and it was stirred at 90? C. for 18 h under a nitrogen atmosphere. The solvent was removed under reduced pressure and the residue purified by flash chromatography on silica (gradient: 0-50% EtOAc in PE) to give the title compound (11.6 g, 116%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 191.1. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 6.36 (1H, dt), 6.52 (1H, d), 7.36 (1H, dd), 7.54 (1H, ddd), 7.73 (1H, dd), 8.14 (1H, ddd), 8.35 (1H, dd).

    Intermediate 104

    Step A. i-104a

    tert-Butyl ((1S,3S)-3-((6-(1-ethoxyvinyl)-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate

    [1427] ##STR00635##

    [1428] Bis(triphenylphosphine)palladium (II) dichloride (CAS Reg. No. 13965-03-2) (59 mg, 0.08 mmol) was added to a mixture of tert-butyl ((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclo-pentyl)carbamate compound i-22b (300 mg, 0.84 mmol), tributyl(1-ethoxyvinyl)tin (CAS Reg. No. 97674) (605 mg, 1.67 mmol) and lithium chloride (177 mg, 4.19 mmol) in 1,4-dioxane (20 mL) at 20? C. under a nitrogen atmosphere and it was stirred at 100? C. for 6 h. The solvent was removed under reduced pressure and the residue purified by flash chromatography on silica (gradient: 2-25% EtOAc in PE) to give the title compound along with tin impurities (500 mg) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 350.1.

    Step B. i-104b

    1-(3-(((1S,3S)-3-Aminocyclopentyl)amino)-1,2,4-triazin-6-yl)ethan-1-one

    [1429] ##STR00636##

    [1430] 4 M HCl in dioxane (4.0 mL, 16 mmol) was added to tert-butyl ((1S,3S)-3-((6-(1-ethoxyvinyl)-1,2,4-triazin-3-yl)amino)cyclopentyl)carbamate compound i-104a (250 mg, 1.05 mmol) in EtOAc (3 mL) at 20? C. and the resulting suspension was stirred at 20? C. for 18 h. The solvent was removed under reduced pressure to give an unspecified HCl salt of the title compound (200 mg) as a yellow gum which was used without further purification. MS (ESI) m/z [M+H].sup.+ 222.

    Intermediate 107

    Step A. i-107a

    4-Bromo-6-chloro-2-(4-methoxybenzyl)pyridazin-3(2H-one

    [1431] ##STR00637##

    [1432] 1-(Chloromethyl)-4-methoxybenzene (7.48 g, 47.8 mmol) was added to a mixture of 4-bromo-6-chloro-3(2H-pyridazinone (CAS Reg. No. 933041-13-5) (5.0 g, 24 mmol) and Cs.sub.2CO.sub.3 (15.6 g, 47.8 mmol) in MeCN (80 mL) at 15? C. and it was stirred at 60? C. for 3 h. The mixture was filtered through a pad of Celite, the filter cake washed with DCM (3?20 mL) and the combined filtrates were concentrated under reduced pressure. The obtained material was triturated with EtOAc:PE=1:5 (25 mL), the formed solid collected by filtration and dried under vacuum to give the title compound (7.8 g, 98%) as a yellow solid. MS (ESI): m/z [M+H].sup.+ 329/331 (Br/Cl isotope pattern).

    Step B. i-107b

    6-Chloro-4-hydroxy-2-(4-methoxybenzyl)pyridazin-3(2H)-one

    [1433] ##STR00638##

    [1434] RockPhos Pd G3 (CAS Reg. No. 2009020-38-4) (1.97 g, 2.35 mmol) was added to a mixture of 4-bromo-6-chloro-2-(4-methoxybenzyl)pyridazin-3(2H)-one compound i-107a (7.75 g, 23.5 mmol), (E)-benzaldehyde oxime (3.70 g, 30.6 mmol) and Cs.sub.2CO.sub.3 (15.6 g, 47.8 mmol) in DMF (40 mL) and water (10 mL) at 15? C. and it was stirred at 80? C. for 15 h. The reaction mixture was poured into sat. brine (100 mL) and the aqueous layer was extracted with EtOAc (3?100 mL). The combined organic layers were washed with sat. brine (3?100 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue was purified by flash chromatography on silica (gradient: 0-100% EtOAc in PE) to give the title compound (4.0 g, 64%) as a tan solid. MS (ESI): m/z [M+H].sup.+ 267/269 (Cl isotope pattern).

    Step C. i-107c

    6-Chloro-4-(difluoromethoxy)-2-(4-methoxybenzyl)pyridazin-3(2H)-one

    [1435] ##STR00639##

    [1436] Cs.sub.2CO.sub.3 (293 mg, 0.90 mmol) was added to a mixture of 6-chloro-4-hydroxy-2-(4-methoxybenzyl)pyridazin-3(2H)-one compound i-107b (200 mg, 0.75 mmol) and it was stirred at 20? C. for 1.5 h. Sodium chlorodifluoroacetate (CAS Reg. No. 1895-39-2) (343 mg, 2.25 mmol) was added and the resulting mixture was stirred at 100? C. for 3.5 h. The reaction mixture was poured into sat. brine (50 mL) and the aqueous layer was extracted with EtOAc (3?50 mL). The combined organic layers were washed with sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue was purified by reparative TLC (EtOAc:PE=1:3) to give the title compound (175 mg, 74%) as a yellow gum. MS (ESI): m/z [M+H].sup.+ 317/319 (Cl isotope pattern).

    Step D. i-107d

    4-(Difluoromethoxy)-2-(4-methoxybenzyl)pyridazin-3(2H)-one

    [1437] ##STR00640##

    [1438] PdC (11 mg, 0.11 mmol) was added to a mixture of 6-chloro-4-(difluoromethoxy)-2-(4-methoxybenzyl)pyridazin-3(2H)-one compound i-107c (680 mg, 2.15 mmol) in MeOH (30 mL) at 20? C. and the resulting suspension was stirred at this temperature for 2 h under a hydrogen atmosphere. The reaction mixture was concentrated under reduced pressure to afford the title compound (576 mg, 95%) as a white solid which was directly used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 283.0.

    Step E. i-107e

    4-(Difluoromethoxy)pyridazin-3(2H)-one

    [1439] ##STR00641##

    [1440] TFA (20 mL) was added to 4-(difluoromethoxy)-2-(4-methoxybenzyl)pyridazin-3(2H)-one compound i-107d (546 mg, 1.93 mmol) at 20? C. and the mixture was stirred at 80? C. for 15 h.

    [1441] The reaction mixture was concentrated under reduced pressure to give an unspecified TFA salt of the title compound (483 mg, 90%) as a black gum which was used without further purification. MS (ESI): m/z [M+H].sup.+ 162.9.

    Intermediate 108

    Step A. i-108a

    2-Bromo-1-(6-fluoropyridin-3-yl)propan-1-one

    [1442] ##STR00642##

    [1443] A solution of 1-(6-fluoropyridin-3-yl)propan-1-one (CAS Reg. No. 949154-27-2) (201 mg, 1.31 mmol) in HOAc (2 mL) was treated with HBr (CAS Reg. No. 10035-10-6) (33 wt % in HOAc, 238 ?L, 1.31 mmol) and bromine (67 ?L, 1.3 mmol) and the mixture stirred at rt for 2 h. The reaction mixture was concentrated under reduced pressure to give the crude title compound (410 mg) which was used in the next step without further purification.

    Step B. i-108b

    4-(6-Fluoropyridin-3-yl)-2,5-dimethyloxazole

    [1444] ##STR00643##

    [1445] A mixture of crude 2-bromo-1-(6-fluoropyridin-3-yl)propan-1-one compound i-108a (270 mg, 1.2 mmol) in xylenes (4 mL) was treated with acetamide (593 mg, 11.6 mmol) and stirred at 135? C. for 20 h. The reaction mixture was concentrated under reduced pressure and the obtained residue purified by preparative HPLC (PrepMethod Z9, gradient: 20-60%) to give the title compound (83 mg, 37%) as a brown solid. MS (ESI): m/z [M+H].sup.+ 193.0. .sup.1H NMR (500 MHz, CDCl.sub.3) ? ppm 2.44 (3H, s), 2.47 (3H, s), 6.96 (1H, dd), 8.04 (1H, dt), 8.42 (1H, d).

    Intermediate 109

    Step A. i-109a

    2-(2-(Benzyloxy)ethyl)malonamide

    [1446] ##STR00644##

    [1447] The reaction was run in 10 parallel batches of identical size.

    [1448] Diethyl 2-(2-(benzyloxy)ethyl)malonate (CAS Reg. No. 41478-45-9) (2.0 g, 6.8 mmol) was treated with NH.sub.3 (7 M in MeOH, 25 mL, 140 mmol) at rt and the mixture was stirred at 60? C. for 16 h. The 10 reaction mixtures were combined and concentrated under reduced pressure. The obtained material was triturated with EtOAc (50 mL), the solid isolated by filtration and dried under reduced pressure to give the title compound (14.7 g, 92%) as a white solid. MS (ESI): m/z [M+H].sup.+ 237.3.

    Step B. i-109b

    Di-tert-butyl (2-(2-(benzyloxy)ethyl)propane-1,3-diyl)dicarbamate

    [1449] ##STR00645##

    [1450] A solution of 2-(2-(benzyloxy)ethyl)malonamide compound i-109a (13.5 g, 57.1 mmol) in THE (250 mL) was treated with BH3xSMe.sub.2 (10 M in SMe.sub.2, 45.7 mL, 457 mmol) at 20? C. and the reaction mixture stirred at 60? C. for 16 h. The mixture was quenched with MeOH (400 mL) and concentrated under reduced pressure to give a pale-yellow gum. This material was dissolved in 1,4-dioxane (250 mL) at 20? C. and treated with Na.sub.2CO.sub.3 (18.2 g, 171 mmol) in water (250 mL) followed by Boc.sub.2O (39.8 mL, 171 mmol) and the resulting suspension stirred at 20? C. for 15 h. The reaction mixture was poured into sat. brine (500 mL) and the aqueous layer was extracted with EtOAc (3?300 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained material purified by flash chromatography on silica (gradient: 2-20% EtOAc in PE) to give the title compound (9.0 g, 39%) as a colourless gum. MS (ESI): m/z [M+H].sup.+ 409.3.

    Step C. i-109c

    Di-tert-butyl (2-(2-hydroxyethyl)propane-1,3-diyl)dicarbamate

    [1451] ##STR00646##

    [1452] Pd(OH).sub.2C (15%, 928 mg, 0.99 mmol) was added to a mixture of di-tert-butyl (2-(2-(benzyloxy)ethyl)propane-1,3-diyl)dicarbamate compound i-109b (9.0 g, 22 mmol) and TFA (3.0 mL, 39 mmol) in MeOH (50 mL) at 20? C. The resulting suspension was evacuated and backfilled with hydrogen gas 3 times and stirred at 20? C. for 16 h under a hydrogen atmosphere. The mixture was concentrated under reduced pressure to afford the title compound (7.0 g, quant.) as a colourless gum which was directly used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 319.2.

    Step D. i-109d

    rac-tert-Butyl (2-(aminomethyl)-4-hydroxybutyl)carbamate

    [1453] ##STR00647##

    [1454] A solution of crude di-tert-butyl (2-(2-hydroxyethyl)propane-1,3-diyl)dicarbamate compound i-109c (7.0 g, 22 mmol) in MeOH (20 mL) was treated with HCl in MeOH (4 M, 20 mL, 80 mmol) at 20? C. and the reaction mixture was stirred at 60? C. for 5 h. The mixture was concentrated under reduced pressure and the obtained material was triturated with EtOAc (20 mL). The formed solid (fully deprotected title compound) was filtered off and the filtrate concentrated under reduced pressure to give an unspecified HCl salt of the title compound (1.4 g, purity 70%) as a pale-yellow gum which was directly used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 219.2.

    Step E. i-109e

    rac-tert-Butyl (4-hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)carbamate

    [1455] ##STR00648##

    [1456] A suspension of crude rac-tert-butyl (2-(aminomethyl)-4-hydroxybutyl)carbamate compound i-109d (1.4 g) and K.sub.2CO.sub.3 (1.55 g, 11.2 mmol) in i-PrOH (40 mL) was treated with 6-methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (0.283 g, 1.8 mmol) at 20? C. and the reaction mixture was stirred at 100? C. for 15 h. The mixture was cooled to rt and concentrated under reduced pressure and the obtained material was purified by flash chromatography on silica (gradient: 0-5% 7 M NH.sub.3 in MeOH:DCM) to give the title compound (700 mg, 10% over three steps) as a pale-yellow gum. MS (ESI): m/z [M+H].sup.+ 312.

    Step F. i-109f

    rac-4-Amino-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl butan-1-ol

    [1457] ##STR00649##

    [1458] A solution of rac-tert-butyl (4-hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)carbamate compound i-109e (700 mg, 2.25 mmol) in MeOH (15 mL) was treated with HCl in MeOH (4 M, 3.0 mL, 12 mmol) at 20? C. and the reaction mixture was stirred at 60? C. for 15 h. The mixture was concentrated under reduced pressure to give an unspecified HCl salt of the title compound (530 mg) as a yellow gum which was directly used in the next step without further purification. MS (ESI): m/z [M+H].sup.+ 212.1.

    Step G. i-109g

    rac-4-((5-Iodopyridin-2-yl)amino)-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol

    [1459] ##STR00650##

    [1460] According to GM1A 2-fluoro-5-iodopyridine (CAS Reg. No. 171197-80-1) (499 mg, 2.24 mmol) was added to crude rac-4-amino-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109f (530 mg, 1.86 mmol) and K.sub.2CO.sub.3 (515 mg, 3.73 mmol) in DMSO (10 mL) at 20? C. The resulting mixture was stirred at 120? C. for 15 h, cooled to rt and poured into sat. brine (250 mL). The aqueous layer was extracted with EtOAc (3?100 mL) and the combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated to afford a brown gum. The obtained material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) to give the title compound (230 mg, 25% over two steps) as a yellow gum. MS (ESI): m/z [M+H].sup.+ 415.1. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.49 (2H, q), 1.99 (1H, quint), 2.38 (3H, s), 3.23-3.39 (4H, m), 3.49 (2H, t), 5.75 (1H, s), 6.41 (1H, d), 6.78 (1H, brs), 7.44 (1H, brs), 7.56 (1H, dd), 8.06 (1H, d), 8.14 (1H, s).

    EXAMPLES

    Example 10

    Ethyl 3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxylatecompound 10

    [1461] ##STR00651##

    [1462] According to GM1B 6-(((1S,3S)-3-aminocyclopentyl)amino)-2H-[1,3-bipyridin]-2-one compound i-1c (226 mg, 0.84 mmol), ethyl 3-bromo-1,2,4-triazine-6-carboxylate (CAS Reg. No. 2091717-09-6) (194 mg, 0.84 mmol) and DIPEA (0.437 mL, 2.51 mmol) were reacted in NMP (2 mL) under microwave irradiation at 100? C. for 1 h to give upon purification by preparative HPLC (PrepMethod F, gradient: 15-55%) the title compound (182 mg, 52%) as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21H.sub.24N.sub.7O.sub.3: 422.1936, found: 422.1924. .sup.1H NMR (500 MHz, DMSO-d.sub.6, mixture of two rotamers ca 1.4/1) ? ppm 1.32 (3H, t), 1.5-1.58 (1H, m), 1.58-1.67 (1H, m), 1.87-2.04 (2H, m), 2.11-2.24 (2H, m), 4.29-4.44 (4H, m), 6.27 (1H, td), 6.44 (1H, dt), 6.53 (1H, d), 6.94-7.02 (1H, m), 7.40 (1H, dd), 7.44-7.51 (1H, m), 7.57-7.63 (1H, m), 7.93 (1H, d), 8.58 (d, minor rotamer), 8.63-8.71 (1H, m), 9.09 (1H, d, major rotamer).

    Example 50

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 50

    [1463] ##STR00652##

    [1464] K.sub.3PO.sub.4 (60 mg, 0.28 mmol) was added to a mixture of (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (40 mg, 0.09 mmol), pyridin-2(1H)-one (CAS Reg. No. 142-08-5) (27 mg, 0.28 mmol), Cu(I)I (9.0 mg, 0.05 mmol) and N.sup.1,N.sup.2-dimethylethane-1,2-diamine (4.2 mg, 0.05 mmol) in dioxane (2 mL) and the resulting suspension was heated at 100? C. for 16 h under nitrogen. The solvent was removed under reduced pressure and the residue was poured into water (50 mL), extracted with EtOAc (2?100 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated to afford a crude product which was purified by preparative TLC (MeOH:DCM=1:40) followed by preparative HPLC (PrepMethod A, gradient: 33-58%) to give (12.4 mg, 34%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21H.sub.24N.sub.7O: 390.2036, found: 390.2042. .sup.1H NMR (300 MHz, DMSO-d.sub.6) b ppm 0.82-1.01 (4H, m), 1.42-1.63 (2H, m,), 1.90 (2H, m), 1.99-2.22 (3H, m), 4.21-4.42 (2H, m), 6.25 (1H, td), 6.43 (1H, ddd), 6.51 (1H, dd), 6.91 (1H, d), 7.38 (1H, dd), 7.42-7.63 (3H, m), 7.91 (1H, d), 8.17 (1H, s).

    Example 51

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(trifluoromethyl)-2H-[1,3-bipyridin]-2-onecompound 51

    [1465] ##STR00653##

    [1466] According to GM3 (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (90 mg, 0.21 mmol), 3-(trifluoromethyl)pyridin-2(1H-one (CAS Reg. No. 22245-83-6) (695 mg, 4.26 mmol), Cs.sub.2CO.sub.3 (417 mg, 1.28 mmol), Cu(I)I (162 mg, 0.85 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (121 mg, 0.85 mmol) were reacted in 1,4-dioxane (10 mL) at 100? C. for 15 h to give upon aqueous work-up and purification by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod B, 34-54%) the title compound (33 mg, 33%) as a pale yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23F.sub.3N.sub.7O: 458.1910, found: 458.1928. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.87-1.00 (4H, m), 1.45-1.65 (2H, m), 1.85-2.24 (5H, m), 4.29-4.42 (2H, m), 6.43 (1H, t), 6.55 (1H, d), 7.03 (1H, d), 7.46 (1H, dd), 7.55 (1H, br d), 7.97-8.04 (3H, m), 8.19 (1H, s).

    Example 52

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(trifluoromethoxy)-2H-[1,3-bipyridin]-2-onecompound 52

    [1467] ##STR00654##

    [1468] Prepared in analogy to Example 51 from (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (90 mg, 0.21 mmol) and 3-(trifluoromethoxy)pyridin-2-ol compound i-9b (382 mg, 2.13 mmol) and purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod B, gradient: 38-58%) to give a white solid (20 mg, 19%). HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23F.sub.3N.sub.7O.sub.2: 474.1860, found: 474.1816. .sup.1H NMR (300 MHz, DMSO-de) b ppm 0.87-1.00 (4H, m), 1.45-1.61 (2H, m), 1.88-2.21 (5H, m), 4.28-4.39 (2H, m), 6.33 (1H, t), 6.55 (1H, d), 7.02 (1H, d), 7.45 (1H, dd), 7.50-7.60 (1H, m), 7.69-7.74 (2H, m), 7.98 (1H, d), 8.19 (1H, s).

    Example 53

    (1S,3S)N.SUP.1.-(6-Cyclopropyl-1,2,4-triazin-3-yl)-N.SUP.1.-(5-(2,6-difluorophenyl)pyridin-2-yl)cyclopentane-1,3-diaminecompound 53

    [1469] ##STR00655##

    [1470] According to GM4A (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.1-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (95 mg, 0.22 mmol), (2,6-difluorophenyl)boronic acid (CAS Reg. No. 162101-25-9) (71 mg, 0.45 mmol), PdCl.sub.2(dppf) (CAS Reg. No 72287-26-4) (16 mg, 0.02 mmol) and K.sub.2CO.sub.3 (93 mg, 0.67 mmol) were reacted in a mixture of 1,4-dioxane (8 mL) and water (2 mL) at 100? C. for 15 h. Aqueous work-up of the reaction mixture and purification by preparative TLC (EtOAc:PE=1:1) followed by preparative HPLC (PrepMethod D, gradient: 44-59%) gave the title compound (18 mg, 19%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23F.sub.2N.sub.6: 409.1946, found: 409.1960. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.94 (m, 4H), 1.45-1.66 (m, 2H), 1.92 (m, 2H), 1.99-2.24 (m, 3H), 4.37 (d, 2H), 6.53-6.61 (m, 1H), 6.93 (d, 1H), 7.12-7.24 (m, 2H), 7.34-7.49 (m, 2H), 7.55 (s, 1H), 8.04 (d, 1H), 8.19 (s, 1H).

    Example 54

    (1S,3S)N.SUP.1.-(6-Cyclopropyl-1,2,4-triazin-3-yl)-N.SUP.1.-(5-(2-fluoro-6-methoxyphenyl)pyridin-2-yl)cyclopentane-1,3-diaminecompound 54

    [1471] ##STR00656##

    [1472] Prepared in analogy to Example 53 from (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.1-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (95 mg, 0.22 mmol) and (2-fluoro-6-methoxyphenyl)boronic acid (CAS Reg. No. 78495-63-3) (76 mg, 0.45 mmol) applying 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (CAS Reg. No. 95408-45-0) (15 mg, 0.02 mmol) and purified by preparative TLC (EtOAc:PE=2:1) followed by preparative HPLC (PrepMethod C, gradient: 40-65%) to give a white solid (46 mg, 48%). HRMS (ESI) m/z [M+H]+ calcd for C.sub.23H.sub.26FN.sub.6O: 421.2146, found: 421.2166. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.7-1.08 (4H, m), 1.42-1.77 (2H, m), 1.81-1.99 (2H, m), 1.99-2.32 (3H, m), 3.75 (3H, s), 4.19-4.57 (2H, m), 6.51 (1H, d), 6.73 (1H, d), 6.8-7.07 (2H, m), 7.2-7.45 (2H, m), 7.55 (1H, d), 7.83-8.03 (1H, m), 8.19 (1H, s).

    Example 55

    3-Chloro-6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 55

    [1473] ##STR00657##

    [1474] According to GM1A (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 4TFA compound i-22d (80 mg, 0.36 mmol), 3-chloro-6-fluoro-2H-[1,3-bipyridin]-2-one compound i-13a (164 mg, 0.73 mmol) and K.sub.2CO.sub.3 (151 mg, 1.09 mmol) were reacted in DMSO (15 mL) at 120? C. for 15 h to give upon non-aqueous work-up and purification by preparative TLC (EtOAc:PE=2:1) followed by preparative HPLC (PrepMethod D, gradient: 24-44%) the title compound (45 mg, 29%) as a pale yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.23ClN.sub.7O: 424.1648, found: 424.1650. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.87-1.00 (4H, m), 1.42-1.66 (2H, m), 1.87-2.21 (5H, m), 4.28-4.39 (2H, m), 6.31 (1H, t), 6.54 (1H, d), 7.01 (1H, d), 7.44 (1H, dd), 7.50-7.61 (1H, m), 7.67 (1H, dd), 7.82 (1H, dd), 7.96 (1H, d), 8.19 (1H, s).

    Example 56

    Example

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-5-carbonitrilecompound 56

    [1475] ##STR00658##

    [1476] According to GM2 (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 4TFA compound i-22d (292 mg, 0.43 mmol), 6-chloro-2-oxo-2H-[1,3-bipyridine]-5-carbonitrile compound i-8d (100 mg, 0.43 mmol), Cs.sub.2CO.sub.3 (563 mg, 1.73 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (18 mg, 0.02 mmol) were reacted in 1,4-dioxane (12 mL) at 100? C. for 15 h to give upon non-aqueous work-up and purification by preparative HPLC (PrepMethod D, gradient: 23-43%) the title compound (71 mg, 39%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23N.sub.8O: 415.1990, found: 415.1970. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.77-1.04 (4H, m), 1.38-1.68 (2H, m), 1.8-1.97 (2H, m), 1.97-2.23 (3H, m), 4.2-4.45 (2H, m), 6.53 (2H, t), 7.02 (1H, d), 7.42 (1H, dd), 7.53 (1H, d), 7.72 (1H, dd), 7.97 (1H, d), 8.17 (1H, s), 8.55 (1H, d).

    Example 57

    3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1-methylimidazolidine-2,4-dionecompound 57

    [1477] ##STR00659##

    [1478] According to GM2 Cs.sub.2CO.sub.3 (238 mg, 0.73 mmol) was added to a mixture of (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (128 mg, 0.59 mmol), 3-(6-chloropyridin-3-yl)-1-methylimidazolidine-2,4-dione compound i-7b (110 mg, 0.49 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (20.50 mg, 0.02 mmol) in 1,4-dioxane (3 mL) at 25? C.

    [1479] The resulting suspension was stirred at 100? C. for 16 h under a nitrogen atmosphere. The solvent was removed under reduced pressure, the residue taken up with water (50 mL) and extracted with DCM (2?100 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the obtained residue was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod D, gradient: 20-35%) to give the title compound (10 mg, 5%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.25N.sub.8O.sub.2: 409.2094, found: 409.2104. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? 0.93 (m, 4H), 1.44-1.63 (m, 2H), 1.92 (m, 2H), 2.01-2.08 (m, 1H), 2.08-2.20 (m, 2H), 2.91 (s, 3H), 4.08 (s, 2H), 4.32 (m, 2H), 6.52 (m, 1H), 6.89 (d, 1H), 7.27 (m, 1H), 7.55 (d, 1H), 7.80-7.88 (m, 1H), 8.18 (s, 1H).

    TABLE-US-00014 TABLE 7 The following Examples (58-66) where prepared in analogy to Example 57 starting from compound i-22d and the given electrophile intermediate, applying Buchwald-Hartwig amination (GM2). For the preparation of Example 58 DMF was used as solvent. Work-Up/ Purification Ex Structure/Name Analytical Data Method/ Yield Intermediate 58 [00660]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.23N.sub.8O: 415.1990, found: 415.2022. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.81- 1.04 (4H, m), 1.4-1.7 (2H, m), 1.81-2.23 (5H, m), 4.24-4.44 (2H, m), 6.47 (1H, t), 6.55 (1H, d), 7.06 (1H, d), 7.46 (1H, dd), 7.55 (1H, d), 7.99 Aqueous work- up; Prep. TLC (EtOAc) and prep. HPLC applying PrepMethod B (gradient: 29- 49%); (15 mg, 2%) compound i-10a (DMF used as solvent) 6-(((1 S,3S)-3-((6-Cyclopropyl- (1H, d), 8.06 (1H, dd), 1,2,4-triazin-3-yl)amino)cyclo- 8.19 (1H, s), 8.23 (1H, pentyl)amino)-2-oxo-2H-[1,3- dd) bipyridine]-3-carbonitrile 59 [00661]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.19H.sub.22N.sub.9O: 392.1942, found: 392.1946. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.83- 1.07 (4H, m), 1.46-1.69 (2H, m), 1.85-2.29 (5H, m), 4.22-4.49 (2H, m), 7.06 (1H, dd), 7.50 (1H, dd), 7.58 (2H, d), 7.86 Non-aqueous work-up; Prep. TLC (MeOH: DCM = 1:20) and prep. HPLC applying PrepMethod B (gradient: 18- 36%); compound i-11a (1H, d), 8.02 (1H, dd), (50 mg, 18%) 2-(5-(((1 S,3S)-3-((6- 8.13 (1H, d), 8.19 (1H, Cyclopropyl-1,2,4-triazin-3- s). yl)amino)cyclo- pentyl)amino)pyrazin-2- yl)pyridazin-3(2H)-one 60 [00662]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.26N.sub.7O: 404.2194, found: 404.2190. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.84- 1.03 (4H, m), 1.4-1.67 (2H, m), 1.78-2 (2H, m), 2-2.22 (3H, m), 3.48 (3H, s), 4.24-4.44 (2H, m), 6.27 (1H, t), 6.46 Non-aqueous work-up; Prep. HPLC applying PrepMethod D (gradient: 24- 35%); (47 mg, 25%) compound i-12a (1H, d), 6.70 (1H, d), 6-(((1 S,3S)-3-((6-Cyclopropyl- 7.47-7.61 (2H, m), 7.64 1,2,4-triazin-3-yl)amino)cyclo- (1H, dd), 7.75 (1H, dd), pentyl)amino)-1-methyl-[3,3- 8.18 (1H, s), 8.33 (1H, bipyridin]-2(1H)-one d). 61 [00663]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.22FN.sub.8: 417.1946, found: 417.1958. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.85 ? 1.01 (m, 4H), 1.57 (m, 2H), 1.85 ? 2.07 (m, 3H), 2.16 (m, 2H), 4.39 (m, 2H), 6.62 (d, 1H), 7.32 (d, 1H), 7.56 (d, 1H), 7.91 ? 8.07 (m, 3H), 8.18 (s, 1H), 8.59 (m, 1H). Aqueous work- up; Prep. TLC (EtOAc:PE = 2:1) and prep. HPLC applying PrepMethod D (gradient: 35- 55%); (75 mg, 20%) compound i-14a 6-(((1 S,3S)-3-((6-Cyclopropyl- 1,2,4-triazin-3-yl)amino) cyclopentyl)amino)-3-fluoro-[2,3- bipyridine]-6-carbonitrile 62 [00664]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.20H.sub.25N.sub.8O.sub.2: 409.2094, found: 409.2054. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.84 - 1.03 (4H, m), 1.41 ? 1.63 (2H, m), 1.79 ? 1.98 (2H, m), 2.00 ? 2.21 (3H, m), 2.92 (3H, s), 4.18 ? 4.43 (4H, m), 6.50 (1H, d), Aqueous work- up; Prep. TLC (MeOH (7 M NH.sub.3):DCM = 1:25) and prep. HPLC applying PrepMethod B (gradient: 24- 44%); compound i-23a 6.62 (1H, d), 7.53 (1H, (28 mg, 22%) 1-(6-(((1 S,3S)-3-((6- s), 7.63 (1H, dd), 8.10 Cyclopropyl-1,2,4-triazin-3- (1H, d), 8.18 (1H, s). yl)amino)cyclo- pentyl)amino)pyridin-3-yl)-3- methylimidazolidine-2,4-dione 63 [00665]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.23H.sub.26N.sub.9O: 444.2254, found: 444.2226. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.78 - 1.04 (4H, m), 1.44 ? 1.65 (2H, m), 1.79 ? 2.28 (5H, m), 3.39 (3H, s), 4.34 (2H, t), 6.58 (1H, d), 6.91 (1H, d), 7.12 (1H, dd), Aqueous work- up; Prep. TLC (MeOH (7 M NH.sub.3):DCM = 1:25) and prep. HPLC applying PrepMethod D (gradient: 18- 48%); (50 mg, 33%) compound i-24a 7.43 ? 7.63 (3H, m), 7.92 3-(6-(((1 S,3S)-3-((6- (1H, d), 8.08 (1H, d), Cyclopropyl-1,2,4-triazin-3- 8.17 (1H, s). yl)amino)cyclo- pentyl)amino)pyridin-3-yl)-1- methyl-1,3-dihydro-2H- imidazo[4,5-b]pyridin-2-one 64 [00666]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.26N.sub.7O.sub.2: 420.2142, found: 420.2154. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.8-1.0 (4H, m), 1.43 ? 1.67 (2H, m), 1.84 ? 2.23 (5H, m), 3.73 (3H, s), 4.25 ? 4.45 (2H, m), 6.20 (1H, t), 6.53 (1H, d), 6.86 (1H, dd), 6.93 (1H, d), 7.17 Non-aqueous work-up; Prep. TLC (MeOH (7 M NH.sub.3):DCM = 1:20) and prep. HPLC applying PrepMethod B (gradient: 23- 41%); (51 mg, 19%) compound i-25a 6-(((1 S,3S)-3-((6-Cyclopropyl- (1H, dd), 7.38 (1H, dd), 1,2,4-triazin-3-yl)amino)cyclo- 7.55 (1H, d), 7.91 (1H, pentyl)amino)-3-methoxy-2H- d), 8.18 (1H, s). [1,3-bipyridin]-2-one 65 [00667]embedded image 6-(((1 S,3S)-3-((6-Cyclopropyl- 1,2,4-triazin-3-yl)amino)cyclopentyl) HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.26N.sub.7O.sub.2: 420.2142, found: 420.2148. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.70 - 1.07 (4H, m), 1.40 ? 1.60 (2H, m), 1.8 ? 2.0 (2H, m), 2.0 ? 2.25 (3H, m), 3.63 (3H, s), 4.03 ? 4.58 (2H, m), 6.46 (2H, dd), 6.89 (1H, d), 7.17 (1H, d), 7.26 ? 7.46 (2H, m), 7.53 (1H, s), 7.77 ? 8.05 (1H, m), 8.17 (1H, s). Aqueous work- up; Prep. TLC (MeOH (7 M NH.sub.3):DCM = 1:20) and prep. HPLC applying PrepMethod B (gradient: 26- 46%); (60 mg, 23%) compound i-26a amino)-5-methoxy-2H- [1,3-bipyridin]-2-one 66 [00668]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.26N.sub.7O: 404.2194, found: 404.2226. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.84 - 1.01 (4H, m), 1.4 ? 1.7 (2H, m), 1.8 ? 2.2 (8H, m), 4.51 ? 4.22 (2H, m), 6.19 (1H, t), 6.53 (1H, d), 6.92 (1H, d), 7.33 ? 7.42 (2H, m), 7.46 (1H, dd), Non-aqueous work-up; Prep. TLC (MeOH (7 M NH.sub.3):DCM = 1:20) and prep. HPLC applying PrepMethod B (gradient: 25- 55%); (51 mg, 28%) compound i-27a 7.50 ? 7.62 (1H, m), 7.92 6-(((1 S,3S)-3-((6-Cyclopropyl- (1H, d), 8.18 (1H, s). 1,2,4-triazin-3-yl)amino) cyclopentyl)amino)-3-methyl-2H- [1,3-bipyridin]-2-one

    Example 67

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 67

    [1480] ##STR00669##

    [1481] According to GM2 Cs.sub.2CO.sub.3 (329 mg, 1.01 mmol) was added to a mixture of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 2TFA compound i-28b (85 mg, 0.20 mmol), 6-chloro-2H-[1,3-bipyridin]-2-one compound i-29a (62 mg, 0.30 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (8.5 mg, 10 ?mol) in dioxane (5 mL) at rt and the resulting suspension was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with EtOAc (200 mL) and washed sequentially with saturated brine (2?15 mL) and water (2?15 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product which was purified by preparative TLC (MeOH:DCM=1:25) followed by preparative HPLC (PrepMethod C, gradient: 10-30%) to give (35 mg, 48%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.22N.sub.7O: 364.1880, found: 364.1866. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.66 (2H, m), 1.85-2.00 (2H, m), 2.06-2.24 (2H, m), 2.39 (3H, s), 4.25-4.45 (2H, m), 6.27 (1H, td), 6.44 (1H, ddd), 6.53 (1H, dd), 6.94 (1H, d), 7.37-7.65 (4H, m), 7.90-7.96 (1H, m), 8.17 (1H, s).

    Example 68

    N-(2-Amino-2-oxoethyl)-3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxamidecompound 68

    [1482] ##STR00670##

    [1483] According to GM7, ethyl 3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclo-pentyl)amino)-1,2,4-triazine-6-carboxylate compound 10 (33.3 mg, 0.08 mmol) was mixed with DMSO (0.5 mL), DIPEA (0.055 mL, 0.32 mmol) and 2-aminoacetamide HCl (CAS Reg. No. 1668-10-6) (17 mg, 0.16 mmol) and it was stirred at 70? C. overnight. The volatiles were removed and the residue redissolved in MeOH (1 mL). Another amount of DIPEA (55 PL, 0.32 mmol) and 2-aminoacetamide HCl (17 mg, 0.16 mmol) was added and the reaction mixture stirred at 70? C. for one week. Purification by preparative SFC (PrepMethod SFC-A) gave the title compound (1.8 mg, 5%). HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.24N.sub.9O.sub.3: 450.1996, found: 450.1984. .sup.1H NMR (600 MHz, DMSO-d.sub.6) ? ppm 1.51-1.66 (2H, m), 1.88-2.01 (2H, m), 2.1-2.22 (2H, m), 3.85 (2H, d), 6.27-6.31 (1H, m), 6.44 (1H, d), 6.53 (1H, d), 6.94 (1H, s), 7.08 (1H, s), 7.39 (1H, dd), 7.43 (1H, s), 7.48 (1H, ddd), 7.58 (1H, d), 7.90 (1H, d), 8.66 (1H, s), 8.80 (1H, s).

    TABLE-US-00015 TABLE 8 The following Examples (69-76) where prepared in analogy to Example 68 starting from compound 10 and the given amine, applying GM7. Amine (CAS Reg. Purification No.)/ Method/ Equivalents Ex Structure/Name Analytical Data Yield used 69 [00671]embedded image HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.23N.sub.8O.sub.2: 431.1938, found: 431.1970. .sup.1H NMR (600 MHz, DMSO-d.sub.6) ? ppm 1.58 (2H, d), 1.95 (2H, d), 2.18 (2H, tt), 3.04 (1H, t), 4.03 (2H, dd), 4.29-4.59 (2H, m), 6.29 (1H, td), 6.45 (1H, dt), 6.53 (1H, d), 6.94 (1H, d), 7.39 (1H, dd), 7.48 (1H, ddd), 7.58 (1H, dd), 7.90 (1H, d), 8.37 (0.5H, s, NH preparative SFC applying PrepMethod SFC-B; (6 mg, 19%) 2450-71-7; 12 eq. rotamer), 8.66 (1H, s), 3-(((1 S,3S)-3-((2-Oxo-2H-[1,3- 8.81 (0.5H, s, NH bipyridin]-6-yl)amino)cyclo- rotamer), 9.17 (1H, s). pentyl)amino)-N-(prop-2-yn-1- yl)-1,2,4-triazine-6- carboxamide 70 [00672]embedded image N-(Oxetan-3-yl)-3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxamide HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.22H.sub.25N.sub.8O.sub.3: 449.2044, found: 449.2052. .sup.1H NMR (600 MHz, DMSO-d.sub.6) ? ppm 1.58 (2H, d), 1.87-2.02 (2H, m), 2.11-2.19 (2H, m), 4.33 (1H, q), 4.62-4.68 (3H, m), 4.71 (2H, dd), 4.99-5.06 (1H, m), 6.29 (1H, td), 6.41-6.47 (1H, m), 6.53 (1H, d), 6.94 (1H, d), 7.39 (1H, dd), 7.46-7.5 (1H, m), 7.57 (1H, dd), 7.90 (1H, d), preparative SFC applying PrepMethod SFC-B; (9 mg, 27%) 21635-88-1; 12 eq. 8.37 (0.5H, s, NH rotamer), 8.63 (1H, s), 8.81 (0.5H, s, NH rotamer), 9.48 (1H, d). 71 [00673]embedded image N-(2,2-Difluoroethyl)-3- (((1 S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.21H.sub.23F.sub.2N.sub.8O.sub.2: 457.1906, found: 457.1920. .sup.1H NMR (600 MHz, DMSO-d.sub.6) ? ppm 1.48- 1.69 (2H, m), 1.92-2.03 (2H, m), 2.13-2.21 (2H, m), 3.1-3.22 (2H, m), 4.24-4.39 (2H, m), 6.10 (1H, s), 6.29 (1H, td), 6.45 (1H, d), 6.53 (1H, d), 6.94 (1H, d), 7.39 (1H, dd), 7.46-7.5 (1H, m), 7.58 (1H, dd), 7.90 (1H, d), 8.39 (0.43H, s, NH rotamer), 8.67 (1H, s), 8.85 (0.57H, s, NH rotamer), 9.08 (1H, s). preparative HPLC applying PrepMethod I (gradient: 5-95%); (13 mg, 41%) 430-67-1; 10 eq. (no additional DIPEA added) 72 [00674]embedded image N-(2-Hydroxyethyl)-3- (((1 S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6- HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.21H.sub.25N.sub.8O.sub.3: 437.2044, found: 437.2044. .sup.1H NMR (500 MHz, DMSO-d.sub.6) ? ppm 1.59 (2H, d), 1.95 (2H, d), 2.12-2.24 (2H, m), 3.37 (2H, d), 3.51 (2H, t), 4.29-4.61 (2H, m), 4.77 (1H, s), 6.27 (1H, td), 6.44 (1H, dt), 6.53 (1H, d), 6.97 (1H, d), 7.40 (1H, dd), 7.47 (1H, ddd), 7.60 (1H, dd), 7.92 (1H, d), 8.67 (2H, s), 8.82 (1H, s). preparative SFC applying PrepMethod SFC-C; (14 mg, 44%) 141-43-5; 12 eq. yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide 73 [00675]embedded image N-Ethyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.21H.sub.25N.sub.8O.sub.2: 421.2094, found: 421.2108. .sup.1H NMR (500 MHz, DMSO-d.sub.6) ? ppm 1.11 (3H, t), 1.46-1.69 (2H, m), 1.84-2.05 (2H, m), 2.11-2.24 (2H, m), 3.26- 3.32 (2H, m), 4.28-4.63 (2H, m), 6.27 (1H, td), 6.41-6.47 (1H, m), 6.5- 6.56 (1H, m), 6.96 (1H, d), 7.40 (1H, dd), 7.47 (1H, ddd), 7.60 (1H, ddd), 7.9-7.96 (1H, m), 8.66 (1H, s), 8.73-8.91 (2H, m). Prep. SFC applying PrepMethod SFC-C; (21 mg, 65%) 75-04-7; 26 eq. (no additional DIPEA added) 74 [00676]embedded image 3-(((1 S,3S)-3-((2-Oxo-2H-[1,3- bipyridin]-6-yl)amino)cyclo- pentyl)amino)-1,2,4-triazine-6- carboxamide HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.19H.sub.21N.sub.8O.sub.2: 393.1782, found: 393.1740. .sup.1H NMR (500 MHz, DMSO-d6, mixture of two rotamers ca 1/1) ? ppm 1.48-1.7 (2H, m), 1.87- 2.04 (2H, m), 2.12-2.25 (2H, m), 4.28-4.64 (2H, m), 6.27 (1H, td), 6.44 (1H, dt), 6.53 (1H, d), 6.97 (1H, d), 7.40 (1H, dd), 7.47 (1H, ddd), 7.54-7.63 (2H, m), 7.93 (1H, d), 8.16 (1H, s), 8.67 (1H, s), 8.34 and 8.79 correspond to (1H, Preparative HPLC applying PrepMethod H (gradient: 10-50%); (10 mg, 47%) 7664-41-7; 32 eq. (no additiona I DIPEA added and stirred at rt for 3 h) s (rotamers)). 75 [00677]embedded image N-Methyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6- yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxamide HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.20H.sub.23N.sub.8O.sub.2: 407.1938, found: 407.1916. .sup.1H NMR (500 MHz, DMSO-d.sub.6) ? ppm 1.5-1.7 (2H, m), 1.89-2.07 (2H, m), 2.13-2.24 (2H, m), 2.80 (3H, d), 3.44 (1H, qd), 4.15-4.48 (2H, m), 6.28 (1H, td), 6.45 (1H, dt), 6.54 (1H, d), 6.97 (1H, d), 7.41 (1H, dd), 7.48 (1H, ddd), 7.61 (1H, ddd), 7.91-7.95 (1H, m), 8.67 (1H, s), 8.79 (1H, s). preparative HPLC applying PrepMethod H (gradient: 15-55%); (20 mg, 99%) 74-89-5; 80 eq. (no additional DIPEA added and stirred at rt for 3 h) 76 [00678]embedded image N,N-Dimethyl-3-(((1 S,3S)-3- ((2-oxo-2H-[1,3-bipyridin]-6- HRMS (ESI) m/z [M + H].sup.+ calcd for C.sub.21H.sub.25N.sub.8O.sub.2: 421.2094, found: 421.2100. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.59- 1.76 (2H, m), 1.99-2.16 (2H, m), 2.31 (2H, tdd), 3.14 (3H, s), 3.25 (3H, s), 4.39 (1H, p), 4.56 (1H, s), 6.46 (1H, td), 6.59-6.66 (2H, m), 7.45 (1H, dd), 7.56-7.64 (2H, m), 7.92-7.98 (1H, m), 8.49 (1H, s). preparative HPLC applying PrepMethod H (gradient: 15-55%); (4.7 mg, 24%) 124-40-3; 40 eq. (no additiona I DIPEA added and stirred at 60? C. for 72 h) yl)amino)cyclopentyl)amino)- 1,2,4-triazine-6-carboxamide

    Example 129

    3-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 129

    [1484] ##STR00679##

    [1485] According to GM1A the free base of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 2TFA compound i-28b (60 mg, 0.31 mmol) was added to a mixture of 3-chloro-6-fluoro-2H-[1,3-bipyridin]-2-one compound i-13a (139 mg, 0.62 mmol) and K.sub.2CO.sub.3 (129 mg, 0.93 mmol) in DMSO (5 mL). The resulting mixture was stirred at 120? C. for 15 h under a nitrogen atmosphere. The reaction mixture was diluted with saturated brine (100 mL) and extracted with EtOAc (5?75 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (MeOH:DCM=1:10) followed by preparative HPLC (PrepMethod D, gradient: 18-32%) to give (15 mg, 12%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.21ClN.sub.7O: 398.1490, found: 398.1468. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.58-1.70 (2H, m), 1.98-2.09 (2H, m), 2.22-2.35 (2H, m), 2.44 (3H, s), 4.33-4.49 (2H, m), 6.24 (1H, dd), 6.62 (1H, d), 7.46 (1H, dd), 7.59 (1H, dd), 7.81 (1H, dd), 7.97 (1H, dd), 8.20 (1H, s).

    Example 132

    3-Methoxy-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 132

    [1486] ##STR00680##

    [1487] In a slight variation of GM1A the free base of 6-(((1S,3S)-3-aminocyclopentyl)amino)-3-methoxy-2H-[1,3-bipyridin]-2-one 2HCl compound i-3b (160 mg, 0.53 mmol) was added to a solution of 6-methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (167 mg, 1.07 mmol) in 1,4-dioxane (20 mL) at rt and the resulting mixture stirred at 100? C. for 15 h. The reaction mixture was poured into water (150 mL) and extracted with EtOAc (4?100 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (EtOAc:MeOH=2:1) followed by preparative HPLC (PrepMethod K, gradient: 21-31%) to give (32 mg, 15%) of the title compound as a white solid. MS (ESI): m/z [M+H].sup.+ 394.15. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.46-1.59 (2H, m), 1.83-1.98 (2H, m), 2.07-2.20 (2H, m), 2.37 (3H, s), 3.71 (3H, s), 4.28-4.39 (2H, m), 6.18 (1H, t), 6.52 (1H, d), 6.85 (1H, dd), 6.93 (1H, d), 7.15 (1H, dd), 7.36 (1H, dd), 7.56 (1H, br s), 7.90 (1H, d), 8.16 (1H, s).

    Example 128

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-5-carbonitrilecompound 128

    [1488] ##STR00681##

    [1489] In a slight variation of GM2 6-chloro-2-oxo-2H-[1,3-bipyridine]-5-carbonitrile compound i-8d (70 mg, 0.30 mmol) was added to a mixture of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 3TFA compound i-28b (162 mg, 0.30 mmol), K.sub.2CO.sub.3 (125 mg, 0.91 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (13 mg, 20 ?mol) in dioxane (10 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was filtered through a pad of Celite, the filter cake washed with EtOAc (3?20 mL) and the combined filtrates concentrated under reduced pressure. The obtained material was purified by preparative TLC (MeOH:DCM=1:10) followed by preparative HPLC (PrepMethod E, gradient: 8-28%) to give (30 mg, 26%) of the title compound as a white solid. HRMS (ESI) m/z [M+H]+ calcd for C.sub.20H.sub.21N.sub.8O: 389.1832, found: 389.1800. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.56-1.72 (2H, m), 1.96-2.11 (2H, m), 2.21-2.34 (2H, m), 2.44 (3H, s), 4.33-4.48 (2H, m), 6.62 (2H, t), 7.45 (1H, dd), 7.69 (1H, dd), 7.98 (1H, d), 8.20 (1H, s), 8.36 (1H, dd).

    Example 130

    5-Methyl-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 130

    [1490] ##STR00682##

    [1491] According to GM1A 6-fluoro-5-methyl-2H-[1,3-bipyridin]-2-one compound i-37a (100 mg, 0.49 mmol) was added to a mixture of the 2HCl salt of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (391 mg, 1.47 mmol) and Na.sub.2CO.sub.3 (415 mg, 3.92 mmol) in DMSO (5 mL). The resulting mixture was stirred at 120? C. for 16 h under a nitrogen atmosphere. The reaction mixture was concentrated under reduced pressure and the obtained material was purified by C18-flash chromatography (gradient: MeCN in water) followed by preparative HPLC (PrepMethod D, gradient: 17-34%) to give (50 mg, 27%) of the title compound as a pale yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O: 378.2036, found: 378.2034. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.63 (2H, m), 1.84-1.99 (2H, m), 2.03 (3H, s), 2.10-2.19 (2H, m), 2.38 (3H, s), 4.29-4.40 (2H, m), 6.39 (1H, d), 6.52 (1H, d), 6.91 (1H, d), 7.33-7.40 (3H, m), 7.56 (1H, brd), 7.91 (1H, d), 8.17 (1H, s).

    Example 131

    3-Methyl-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 131

    [1492] ##STR00683##

    [1493] According to GM1A 6-fluoro-3-methyl-2H-[1,3-bipyridin]-2-one compound i-38a (80 mg, 0.39 mmol) was added to a mixture of the 2HCl salt of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (209 mg, 0.78 mmol) and Na.sub.2CO.sub.3 (332 mg, 3.13 mmol) in DMSO (4 mL). The resulting mixture was stirred at 120? C. for 20 h under a nitrogen atmosphere. The reaction mixture was concentrated under reduced pressure and the obtained material was purified by C18-flash chromatography (gradient: MeCN in water) followed by preparative HPLC (PrepMethod D, gradient: 18-34%) to give (30 mg, 20%) of the title compound as a pale yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O: 378.2036, found: 378.2056. .sup.1H NMR (300 MHz, DMSO-de) b ppm 1.46-1.62 (2H, m), 1.86-1.97 (2H, m), 2.02 (3H, s), 2.07-2.19 (2H, m), 2.38 (3H, s), 4.27-4.40 (2H, m), 6.19 (1H, t), 6.53 (1H, d), 6.92 (1H, d), 7.34-7.40 (2H, m), 7.44-7.47 (1H, m), 7.56 (1H, brs), 7.91 (1H, d), 8.17 (1H, s).

    Example 136

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-3-carbonitrilecompound 136

    [1494] ##STR00684##

    [1495] In a slight variation of GM1A the free base of 6-(((1S,3S)-3-aminocyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-3-carbonitrile 4HCl compound i-35b (110 mg, 0.37 mmol) was added to a solution of 6-methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (117 mg, 0.74 mmol) in 1,4-dioxane (3 mL) at rt and the resulting mixture stirred at 100? C. for 15 h. The reaction mixture was concentrated under reduced pressure and the obtained material was purified by preparative TLC (MeOH:DCM=1:25) followed by preparative HPLC (PrepMethod D, gradient: 10-35%) to give (11 mg, 8%) of the title compound as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.21N.sub.8O: 389.1832, found: 389.1842. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.60 (2H, m), 1.89-1.97 (2H, m), 2.10-2.19 (2H, m), 2.38 (3H, s), 4.27-4.42 (2H, m), 6.46 (1H, t), 6.54 (1H, d), 7.06 (1H, d), 7.45 (1H, dd), 7.57 (1H, brs), 7.98 (1H, d), 8.05 (1H, dd), 8.17 (1H, s) 8.22 (1H, dd).

    Example 138

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(trifluoromethoxy)-2H-[1,3-bipyridin]-2-onecompound 138

    [1496] ##STR00685##

    [1497] According to GM3 (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (130 mg, 0.33 mmol), the 5HCl salt of 3-(trifluoromethoxy)pyridin-2-ol compound i-9b (142 mg, 0.39 mmol), Cs.sub.2CO.sub.3 (534 mg, 1.64 mmol), Cu(I)I (75 mg, 0.85 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (56 mg, 0.39 mmol) were reacted in 1,4-dioxane (20 mL) at 100? C. for 15 h. The reaction mixture was concentrated under reduced pressure and the obtained material was taken up with EtOAc (250 mL). The organic layer was washed with saturated brine (5?75 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (EtOAc) followed by preparative HPLC (PrepMethod C, 18-45%) the title compound (27 mg, 18%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.21F.sub.3N.sub.7O.sub.2: 448.1704, found: 448.1676. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.63 (2H, m), 1.84-1.99 (2H, m), 2.07-2.23 (2H, m), 2.38 (3H, s), 4.28-4.43 (2H, m), 6.32 (1H, t), 6.54 (1H, d), 7.03 (1H, d), 7.44 (1H, dd), 7.58 (1H, brd), 7.69-7.73 (2H, m), 7.97 (1H, d), 8.17 (1H, s).

    Example 112

    5-Chloro-6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 112

    [1498] ##STR00686##

    [1499] (1R,2R)N,N.sup.2-Dimethylcyclohexane-1,2-diamine (182 mg, 1.28 mmol) was added to (1S,3S)-M-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (180 mg, 0.43 mmol), 5-chloropyridin-2(1H-one (CAS Reg. No. 4214-79-3) (828 mg, 6.39 mmol), Cu(I)I (244 mg, 1.28 mmol) and Cs.sub.2CO.sub.3 (694 mg, 2.13 mmol) in 1,4-dioxane (25 mL) at rt and the resulting suspension was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with EtOAc (150 mL) and washed sequentially with water (3?75 mL) and brine (3?50 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product. The residue was first purified by preparative TLC (7 M NH.sup.3 in MeOH:DCM=1:20) and then by preparative HPLC (PrepMethod D, gradient 25-45%) to afford (40 mg, 22%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.23ClN.sub.7O: 424.1648, found: 424.1610. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.82-1.01 (4H, m), 1.42-1.62 (2H, m), 1.79-2.2 (5H, m), 4.27-4.38 (2H, m), 6.49 (2H, t), 6.96 (1H, d), 7.34-7.63 (3H, m), 7.91 (2H, dd), 8.17 (1H, s).

    Example 113

    3-(5-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyrazin-2-yl)-1-methylpyridin-2(1H)-onecompound 113

    [1500] ##STR00687##

    [1501] Pd-PEPPSI-IpentCl 2-methylpyridine (24 mg, 0.03 mmol) was added to 3-(5-bromopyrazin-2-yl)-1-methylpyridin-2(1H-one compound i-57a (150 mg, 0.56 mmol), (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (148 mg, 0.68 mmol) and Cs.sub.2CO.sub.3 (1.47 g, 4.51 mmol) in 1,4-dioxane (5 mL) at rt and the resulting solution was stirred at 100? C. for 18 h under nitrogen. The reaction mixture was diluted with EtOAc (75 mL) and washed sequentially with water (3?25 mL) and brine (3?20 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The residue was first purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) and then by preparative HPLC (PrepMethod D, gradient 19-39%) to afford (15 mg, 7%) of the title compound as a white solid. HRMS (ESI) m/z[M+H].sup.+ calcd for C.sub.21H.sub.25N.sub.8O: 405.2146, found: 405.2166. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.84-1.03 (4H, m), 1.44-1.68 (2H, m), 1.85-2.22 (5H, m), 3.52 (3H, s), 4.26-4.47 (2H, m), 6.35 (1H, t), 7.29 (1H, d), 7.55 (1H, d), 7.72 (1H, dd), 7.96 (1H, d), 8.08-8.25 (2H, m), 9.16 (1H, d).

    Example 114

    3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyrimidin-4(3H)-onecompound 114

    [1502] ##STR00688##

    [1503] (1S,3S)N.sup.1-(6-Cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (137 mg, 0.63 mmol) was added to 3-(6-chloropyridin-3-yl)pyrimidin-4(3H)-one compound i-58a (100 mg, 0.48 mmol), Pd-PEPPSI-IpentCl 2-methylpyridine (20 mg, 0.02 mmol) and Cs.sub.2CO.sub.3 (785 mg, 2.41 mmol) in 1,4-dioxane (5 mL) at rt and the resulting suspension was stirred at 100? C. for 18 h under nitrogen. The reaction mixture was diluted with EtOAc (75 mL) and washed sequentially with water (3?25 mL) and brine (2?20 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The residue was first purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) and then by preparative HPLC (PrepMethod C, gradient 17-37%) to afford (56 mg, 30%) of the title compound as a pale-yellow solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.75-1.06 (4H, m), 1.30-1.73 (2H, m), 1.80-1.96 (2H, m), 1.97-2.05 (1H, m), 2.07-2.23 (2H, m), 4.32 (2H, m), 6.46 (1H, d), 6.53 (1H, d), 7.03 (1H, d), 7.43 (1H, dd), 7.48-7.65 (1H, m), 7.89-8.00 (2H, m), 8.17-8.21 (1H, m), 8.41 (1H, s).

    Example 115

    3-(2-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyrimidin-5-yl)-1-methylpyridin-2(1H)-onecompound 115

    [1504] ##STR00689##

    [1505] 3-(2-Chloropyrimidin-5-yl)-1-methylpyridin-2(1H)-one compound i-59a (90 mg, 0.41 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (134 mg, 0.61 mmol), Cs.sub.2CO.sub.3 (397 mg, 1.22 mmol) Pd-PEPPSI-IpentCl 2-methylpyridine (17 mg, 0.02 mmol) in 1,4-dioxane (10 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was poured into water (150 mL) and the aqueous layer was extracted with EtOAc (4?150 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product. The residue was first purified by preparative TLC (MeOH:DCM=1:20) and then by preparative HPLC (PrepMethod A, gradient 35-50%) to afford (54 mg, 33%) of the title compound as a pale yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21H.sub.25N.sub.8O: 405.2146, found: 405.2142. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.84-1.00 (4H, m), 1.45-1.62 (2H, m), 1.90-2.16 (2H, m), 1.97-2.20 (3H, m), 3.48 (3H, s), 4.31-4.45 (2H, m), 6.28 (1H, t), 7.39 (1H, d), 7.52 (1H, d), 7.64 (2H, dd), 8.16 (1H, s), 8.62 (2H, s).

    Example 116

    3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrilecompound 116

    [1506] ##STR00690##

    [1507] 3-(6-Chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile compound i-60d (150 mg, 0.53 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (139 mg, 0.63 mmol), Cs.sub.2CO.sub.3 (515 mg, 1.58 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (22 mg, 0.03 mmol) in 1,4-dioxane (10 mL) at rt and the resulting suspension was stirred at 100? C. for 18 under nitrogen. The reaction mixture was filtered through Celite. The filter cake was washed with DCM (2?5 mL) and the combined filtrates were concentrated under reduced pressure to afford the crude product. The residue was first purified by preparative TLC (EtOAc:PE=1:1) and the by preparative HPLC (PrepMethod D, gradient 30-50%) to afford (48 mg, 20%) of the title compound as a grey solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.25H.sub.26N.sub.9O: 468.2254, found: 468.2266. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.82-1.05 (4H, m), 1.45-1.68 (2H, m), 1.84-2.01 (2H, m), 2.01-2.09 (1H, m), 2.11-2.2 (2H, m), 3.44 (3H, s), 4.28-4.45 (2H, m), 6.62 (1H, d), 7.04 (1H, d), 7.31 (1H, d), 7.42 (1H, d), 7.39-7.52 (1H, m), 7.57 (1H, d), 7.57-7.65 (1H, m), 8.07 (1H, d), 8.19 (1H, s).

    Example 117

    1-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrilecompound 117

    [1508] ##STR00691##

    [1509] 1-(6-Chloropyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile compound i-61d (100 mg, 0.35 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (92 mg, 0.42 mmol), Cs.sub.2CO.sub.3 (343 mg, 1.05 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (15 mg, 0.02 mmol) in 1,4-dioxane (10 mL) at rt and the resulting suspension was stirred at 100? C. for 18 h under nitrogen. The reaction mixture was filtered through Celite. The filter cake was washed with DCM (2?5 mL) and the combined filtrates were concentrated under reduced pressure to afford the crude product. The residue was first purified by preparative TLC (EtOAc:PE=1:1) and then by preparative HPLC (PrepMethod C, gradient 28-52%) to afford (30 mg, 18%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.25H.sub.26N.sub.9O: 468.2254, found: 468.2208. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.91 (2H, m), 0.96 (2H, m), 1.45-1.68 (2H, m), 1.90-2.25 (5H, m), 3.42 (3H, s), 4.36 (2H, dt), 6.62 (1H, d), 7.00-7.08 (2H, m), 7.45-7.51 (2H, m), 7.55 (1H, s), 7.79 (1H, d), 8.06 (1H, d), 8.19 (1H, s).

    Example 118

    2-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin-3(2H-onecompound 118

    [1510] ##STR00692##

    [1511] 2-(6-Fluoropyridin-3-yl)pyridazin-3(2H)-one compound i-62a (200 mg, 1.05 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (344 mg, 1.57 mmol) and K.sub.2CO.sub.3 (578 mg, 4.18 mmol) in DMSO (5 mL) at rt and the resulting mixture was stirred at 120? C. for 15 h. The reaction mixture was poured into brine (150 mL), extracted with EtOAc (4?100 mL). The organic layers were combined and washed with saturated brine (3?100 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product.

    [1512] The residue was first purified by preparative TLC (MeOH:DCM=1:20) and then by preparative HPLC (PrepMethod C, gradient 17-37%) to afford (70 mg, 17%) of the title compound as a pale-yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.23N.sub.8O: 391.1990, found: 391.1984. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.84-0.98 (4H, m), 1.53 (2H, m), 1.80-1.97 (2H, m), 2.01-2.22 (3H, m), 4.27-4.40 (2H, m), 6.51 (1H, d), 6.91-7.04 (2H, m), 7.40-7.59 (3H, m), 8.00 (1H, dd), 8.09 (1H, d), 8.17 (1H, s).

    Example 119

    2-(2-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyrimidin-5-yl)pyridazin-3(2H)-onecompound 119

    [1513] ##STR00693##

    [1514] Cu(I)I (63 mg, 0.33 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyrimidin-2-yl)cyclopentane-1,3-diamine compound i-47a (140 mg, 0.33 mmol), pyridazin-3(2H)-one (CAS Reg. No. 504-30-3) (33 mg, 0.35 mmol), Cs.sub.2CO.sub.3 (216 mg, 0.66 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (71 mg, 0.50 mmol) in 1,4-dioxane (10 mL) at rt under nitrogen. The resulting suspension was stirred at 80? C. for 16 h and subsequently filtered through a Celite pad. The filter cake was washed with EtOAc (20 mL) and the combined filtrates were concentrated under reduced pressure. The residue was first purified by preparative TLC (MeOH:DCM=1:10) and then by preparative HPLC (PrepMethod M, gradient 23-43%) to afford (80 mg, 62%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.22N.sub.9O: 392.1942, found: 392.1930. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.86-1.03 (4H, m), 1.50-1.63 (2H, m), 1.94 (2H, t), 2.01-2.09 (1H, m), 2.09-2.19 (2H, m), 4.30-4.45 (2H, m), 7.07 (1H, dd), 7.49 (2H, dd), 7.70 (1H, d), 8.06 (1H, dd), 8.18 (1H, s), 8.47 (2H, s).

    Example 120

    2-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-6H-[1,5-bipyrimidin]-6-onecompound 120

    [1515] ##STR00694##

    [1516] rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (118 mg, 0.83 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyrimidin-2-yl)cyclopentane-1,3-diamine compound i-47a (70 mg, 0.17 mmol), pyrimidin-4(3H)-one (CAS Reg. No. 4562-27-0) (79 mg, 0.83 mmol), Cu(I)I (157 mg, 0.83 mmol) and Cs.sub.2CO.sub.3 (108 mg, 0.33 mmol) in 1,4-dioxane (10 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with water (50 mL) and extracted with EtOAc (4?100 mL). The organic layers were combined, washed with water (2?50 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The residue was first purified by preparative TLC (EtOAc) and then by preparative HPLC (PrepMethod D, gradient 15-30%) to afford (4 mg, 6%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.22N.sub.9O: 392.1942, found: 392.1912. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.85-1 (4H, m), 1.47-1.63 (2H, m), 1.86-2.19 (5H, m), 4.24-4.46 (2H, m), 6.51 (1H, d), 7.54 (1H, s), 7.77 (1H, d), 7.98 (1H, d), 8.19 (1H, s), 8.37 (2H, s), 8.46 (1H, s).

    Example 121

    1-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylic acidcompound 121

    [1517] ##STR00695##

    [1518] Methyl 1-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylate compound i-48e (75 mg, 0.15 mmol) was added to a mixture of NaOH (10 mg, 0.25 mmol) in MeOH (9 mL) and water (3 mL) rt and the resulting mixture was stirred at 30? C. for 18 h. The solvent was removed under reduced pressure and the residue first purified by preparative TLC (EtOAc) and then by preparative HPLC (PrepMethod N, gradient 6-23%) to afford (6 mg, 8%) of the title compound as a pale-yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.25H.sub.27N.sub.8O.sub.3: 487.2200, found: 487.2182. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.81-1.03 (4H, m), 1.49-1.65 (2H, m), 1.84-2.22 (5H, m), 3.43 (4H, s), 4.31-4.44 (2H, m), 6.62 (1H, d), 6.92 (1H, d), 7.02 (1H, d), 7.48 (1H, dd), 7.57 (1H, d), 7.67-7.78 (2H, m), 8.06 (1H, d), 8.19 (1H, s).

    Example 122

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 122

    [1519] ##STR00696##

    [1520] 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1-(4-methoxybenzyl)-1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-49b (140 mg, 0.24 mmol) was dissolved in TFA (5 mL) at rt and the resulting solution was stirred at 80? C. for 2 h. Excess TFA was removed under reduced pressure and the residue adjusted to pH 8 with sat. Na.sub.2CO.sub.3(aq). The reaction mixture was extracted with DCM (100 mL) and the organic layer washed sequentially with water (2?25 mL) and brine (25 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was first purified by preparative TLC (DCM MeOH=15:1) and then by preparative HPLC (PrepMethod K, gradient 15-28%) to afford (27 mg, 24%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.25N.sub.10O: 457.2208, found: 457.2168. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.88-0.99 (4H, m), 1.55 (2H, ddt), 1.88-1.99 (2H, m), 2.02-2.21 (3H, m), 4.30-4.40 (2H, m), 6.56 (1H, br d), 6.60 (1H, d), 6.99 (1H, d), 7.48 (1H, dd), 7.56 (1H, br s), 7.99 (1H, dd), 8.02 (1H, d), 8.17 (1H, d), 8.19 (1H, s), 8.24 (1H, s), 15.04 (1H, s).

    Example 123

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 123

    [1521] ##STR00697##

    [1522] 6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-50c (110 mg, 0.19 mmol) was dissolved in TFA (5 mL) at rt and the resulting solution was stirred at 80? C. for 5 h. Excess TFA was removed under reduced pressure and the residue adjusted to pH 8 with sat. Na.sub.2CO.sub.3(aq). The reaction mixture was extracted with DCM (100 mL) and the organic layer washed sequentially with water (2?25 mL) and brine (25 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was first purified by preparative TLC (DCM MeOH=15:1) and then by preparative HPLC (PrepMethod C, gradient 18-38%) to afford (20 mg, 23%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.24H.sub.26N.sub.9O: 456.2254, found: 456.2242. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 0.87-1.02 (4H, m), 1.48-1.63 (2H, m), 1.88-1.98 (2H, m), 2.02-2.21 (3H, m), 4.18-4.44 (2H, m), 6.51 (1H, d), 6.55 (1H, d), 6.96 (1H, d), 7.45 (1H, dd), 7.57 (1H, s), 7.82 (1H, dd), 7.95 (3H, d), 8.08 (1H, s), 8.19 (1H, s), 12.84 (1H, s).

    Example 124

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1H-tetrazol-5-yl)-2H-[1,3-bipyridin]-2-onecompound 124

    [1523] ##STR00698##

    [1524] DMF (1.5 mL) was added to a vial charged with 6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-5-carbonitrile Example 56 (29 mg, 0.07 mmol), sodium azide (13.7 mg, 0.21 mmol) and triethylamine hydrochloride (29 mg, 0.21 mmol) and the mixture was heated to 110? C. for 16 h. The reaction mixture was combined with a second batch made in the same way (0.02 mmol scale), evaporated and the residue purified by preparative SFC (PrepMethod SFC-D) to afford (18 mg, 42%) of the title compound. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24N.sub.11O: 458.2160, found: 458.2192. .sup.1H NMR (600 MHz, DMSO-d.sub.6) ? ppm 0.83-0.91 (2H, m), 0.91-1 (2H, m), 1.43-1.65 (2H, m), 1.9-1.97 (3H, m), 2.13-2.2 (2H, m), 4.28-4.4 (2H, m), 6.57 (1H, d), 6.65 (1H, d), 6.94 (1H, s, NH), 7.38 (1H, s, NH), 7.47 (1H, dd), 7.99-8.06 (2H, m), 8.13 (1H, s), 8.29 (1H, s).

    Example 125

    3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-5-(dimethylphosphoryl)-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-onecompound 125

    [1525] ##STR00699##

    [1526] Dimethylphosphine oxide (15.9 mg, 0.20 mmol) was added to 5-bromo-3-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one compound i-51b (70 mg, 0.10 mmol), XantPhos Pd G3 (CAS: 1445085-97-1) (4.85 mg, 5.10 ?mol), XantPhos (5.9 mg, 10.2 ?mol) and K.sub.2CO.sub.3 (28 mg, 0.20 mmol) in 1,4-dioxane (5 mL) at rt and the resulting suspension was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (4?50 mL). The organic layers were combined and washed with water (2?20 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The residue was first purified by preparative TLC (MeOH:DCM=1:20) and then by preparative HPLC (PrepMethod C, gradient 15-33%) to afford (2 mg, 4%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.26H.sub.32N.sub.8O.sub.2P: 519.2380, found: 519.2386. .sup.1H NMR (300 MHz, Methanol-d.sub.4) ? ppm 0.93-1.08 (4H, m), 1.59-1.71 (2H, m), 1.73 (3H, s), 1.77 (3H, s), 1.96-2.14 (3H, m), 2.22-2.37 (2H, m), 3.53 (3H, s), 4.37-4.50 (2H, m), 6.69 (1H, d), 7.31-7.43 (2H, m), 7.51 (1H, m), 7.50-7.66 (1H, m), 8.07 (1H, d), 8.17 (1H, s).

    Example 126

    6-(((1S,3S)-3-((5-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one-compound 126

    [1527] ##STR00700##

    [1528] (1S,3S)N.sup.1-(5-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-52b (80 mg, 0.41 mmol) was added to Pd-PEPPSI-IpentCl 2-methylpyridine (17.41 mg, 0.02 mmol), 6-chloro-2H-[1,3-bipyridin]-2-one compound i-29a (128 mg, 0.62 mmol) and Cs.sub.2CO.sub.3 (405 mg, 1.24 mmol) in 1,4-dioxane (8 mL). The resulting mixture was stirred at 100? C. for 15 h under a nitrogen atmosphere. The reaction mixture was filtered through Celite and the filter cake washed with EtOAc (3?20 mL). The combined filtrates were concentrated under reduced pressure and the crude product purified by preparative TLC (MeOH:DCM=1:10) and then by preparative HPLC (PrepMethod E, gradient: 2-19%) to give the title compound (35 mg, 23%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.22N.sub.7O: 364.1880, found: 364.1848. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.58-1.74 (2H, m), 2.00-2.12 (2H, m), 2.22-2.35 (2H, m), 2.38 (3H, s), 4.30-4.59 (2H, m), 6.44-6.53 (1H, m), 6.59-6.68 (2H, m), 7.47 (1H, dd), 7.57-7.69 (2H, m), 7.96 (1H, d), 8.42 (1H, s).

    Example 127

    6-(((1S,3S)-3-((5,6-Dimethyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 127

    [1529] ##STR00701##

    [1530] (1S,3S)N.sup.1-(5,6-Dimethyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 3TFA compound i-53b (100 mg, 0.18 mmol) was added to Pd-PEPPSI-IpentCl 2-methylpyridine (7.66 mg, 9.10 ?mol), Cs.sub.2CO.sub.3 (178 mg, 0.55 mmol) and 6-chloro-2H-[1,3-bipyridin]-2-one compound i-29a (37.6 mg, 0.18 mmol) in 1,4-dioxane (5 mL). The resulting mixture was stirred at 100? C. for 15 h under a nitrogen atmosphere. The reaction mixture was filtered through Celite and the filter cake washed with EtOAc (3?20 mL). The combined filtrates were concentrated under reduced pressure and the residue purified by preparative TLC (MeOH:DCM=1:10) followed by preparative HPLC (PrepMethod E, gradient: 3-14%) to give the title compound (8.4 mg, 12%) as a grey solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O: 378.2036, found: 378.2048. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.6-1.7 (2H, m), 2.03-2.12 (2H, m), 2.24-2.35 (2H, m), 2.43 (6H, d), 4.29-4.5 (2H, m), 6.47 (1H, t), 6.59-6.72 (2H, m), 7.51 (1H, dd), 7.57-7.65 (2H, m), 7.96 (1H, s).

    Example 133

    5-Methoxy-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 133

    [1531] ##STR00702##

    [1532] 6-(((1S,3S)-3-Aminocyclopentyl)amino)-5-methoxy-2H-[1,3-bipyridin]-2-one compound i-42b (100 mg, 0.33 mmol) was added to 6-methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (105 mg, 0.67 mmol) in 1,4-dioxane (6 mL) and i-PrOH (2 mL) at 30? C. The resulting solution was stirred at 100? C. for 18 h. The solvent was removed under reduced pressure and the residue purified by preparative TLC (EtOAc:MeOH=3:1) and then by preparative HPLC (PrepMethod K, gradient: 16-34%) to give the title compound (46 mg, 35%) as a pale-yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O.sub.2: 394.1986, found: 394.1990. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.65 (2H, m), 1.82-2.04 (2H, m), 2.07-2.24 (2H, m), 2.39 (3H, s), 3.65 (3H, s), 4.21-4.49 (2H, m), 6.43 (1H, d), 6.54 (1H, d), 6.93 (1H, d), 7.19 (1H, d), 7.36 (1H, dd), 7.42 (1H, dd), 7.59 (1H, br s), 7.97 (1H, d), 8.18 (1H, s).

    Example 134

    5-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 134

    [1533] ##STR00703##

    [1534] 6-Methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (155 mg, 0.98 mmol) was added to 6-(((1S,3S)-3-aminocyclopentyl)amino)-5-chloro-2H-[1,3-bipyridin]-2-one compound i-44b (150 mg, 0.49 mmol) in 1,4-dioxane (6 mL) and i-PrOH (2 mL) at 25? C. The resulting solution was stirred at 100? C. for 18 h. The solvent was removed under reduced pressure and the residue purified by preparative TLC (EtOAc:MeOH=3:1) and then by preparative HPLC (PrepMethod D, gradient: 15-45%) to give the title compound (24 mg, 12%) as a white solid. HRMS (ESI) m/z[M+H].sup.+ calcd for C.sub.19H.sub.21ClN.sub.7O: 398.1490, found: 398.1494. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.42-1.68 (2H, m), 1.84-2.01 (2H, m), 2.06-2.23 (2H, m), 2.38 (3H, s), 4.23-4.49 (2H, m), 6.50 (2H, t), 6.99 (1H, d), 7.41 (1H, dd), 7.5-7.65 (2H, m), 7.93 (2H, dd), 8.18 (1H, s).

    Example 135

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(trifluoromethyl)-2H-[1,3-bipyridin]-2-onecompound 135

    [1535] ##STR00704##

    [1536] 6-Methyl-3-(methylsulfinyl)-1,2,4-triazine compound i-36b (130 mg, 0.83 mmol) was added to 6-(((1S,3S)-3-aminocyclopentyl)amino)-3-(trifluoromethyl)-2H-[1,3-bipyridin]-2-one compound i-54b (140 mg, 0.41 mmol) in 1,4-dioxane (15 mL) at 30? C. The resulting mixture was stirred at 100? C. for 15 h. The solvent was removed under reduced pressure and the residue purified by preparative TLC (MeOH:EtOAc=1:1) and then by preparative HPLC (PrepMethod L, gradient: 23-43%) to give the title compound (15 mg, 8%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.21F.sub.3N.sub.7O: 432.1754, found: 432.1724. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.46-1.64 (2H, m), 1.85-2.00 (2H, m), 2.08-2.20 (2H, m), 2.39 (3H, s), 4.22-4.47 (2H, m), 6.43 (1H, t), 6.55 (1H, d), 7.04 (1H, d), 7.46 (1H, dd), 7.58 (1H, brs), 7.92-8.06 (3H, m), 8.18 (1H, s).

    Example 137

    3-Fluoro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 137

    [1537] ##STR00705##

    [1538] rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (25.1 mg, 0.18 mmol) was added to (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (70 mg, 0.18 mmol), 3-fluoropyridin-2-ol (CAS Reg. No. 1547-29-1) (100 mg, 0.88 mmol), Cu(I)I (33.6 mg, 0.18 mmol) and Cs.sub.2CO.sub.3 (173 mg, 0.53 mmol) in 1,4-dioxane (2 mL) at 20? C. The resulting suspension was stirred at 100? C. for 15 h under a nitrogen atmosphere. The reaction mixture was evaporated, the residue taken up with EtOAc (100 mL) and washed sequentially with sat. brine (3?100 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude product was purified by flash chromatography on a C18 column (gradient: 40-50% water in MeCN) to give the title compound (28.2 mg, 42%) as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.21FN.sub.7O: 382.1786, found: 382.1756. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.64 (2H, m), 1.82-2.03 (2H, m), 2.05-2.23 (2H, m), 2.39 (3H, s), 4.2-4.45 (2H, m), 6.19-6.31 (1H, m), 6.55 (1H, d), 7.02 (1H, d), 7.41-7.54 (2H, m), 7.58 (1H, brs), 7.87-8.02 (1H, m), 8.18 (1H, s), 12.13 (1H, brs).

    Example 151

    N-(2-Hydroxyethyl)-N-methyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxamidecompound 151

    [1539] ##STR00706##

    [1540] HATU (43 mg, 0.11 mmol) was added to a solution of the crude lithium salt of 3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxylic acid compound i-30a (30 mg, 0.075 mmol), 2-(methylamino)ethan-1-ol (9.0 ?l, 0.11 mmol) and DIPEA (0.039 mL, 0.23 mmol) in DMF (0.75 mL) at rt and the reaction was stirred at rt for 1.5 h. The mixture was diluted with DMSO (ca 1 mL) and purified by preparative SFC (PrepMethod SFC-A) to give (11 mg, 31%) of the title compound. MS (ESI): m/z [M+H].sup.+ 451.2. .sup.1H NMR (600 MHz, DMSO-d.sub.6, mixture of rotamers ca 2/1) ? ppm 1.46-1.69 (2H, m), 1.86-2.02 (2H, m), 2.1-2.24 (2H, m), 3.01 and 3.16 (3H, s, N-Me two rotamers), 4.34 (1H, q), 6.28 (1H, td), 6.44 (1H, dt), 6.49-6.61 (1H, m), 6.95 (1H, d, NH), 7.34-7.43 (1H, m), 7.48 (1H, ddd), 7.58 (1H, ddd), 7.91 (1H, d), 8.9 and 8.45 (1H, two singlets, rotamers). (Some protons are hidden in the solvent/water peaks).

    Example 152

    N-Methyl-3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(prop-2-yn-1-yl)-1,2,4-triazine-6-carboxamidecompound 152

    [1541] ##STR00707##

    [1542] HATU (43 mg, 0.11 mmol) was added to a solution of the crude lithium salt 3-(((1S,3S)-3-((2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxylic acid compound i-30a (30 mg, 0.075 mmol), N-methylprop-2-yn-1-amine (9.5 PL, 0.11 mmol) and DIPEA (39 ?L, 0.23 mmol) in DMF (0.75 mL) and the reaction was stirred at rt for 1.5 h. The mixture was diluted with DMSO (ca 1 mL) and purified by preparative SFC (PrepMethod SFC-A) to give (11 mg, 34%) of the title compound. MS (ESI): m/z [M+H].sup.+ 445.2. .sup.1H NMR (600 MHz, DMSO-d.sub.6, mixture of two rotamers ca 1.4/1) ? ppm ? 1.47-1.58 (1H, m), 1.58-1.67 (1H, m), 1.9-2.03 (2H, m), 2.13-2.22 (2H, m), 3.04 and 3.17 (3H, s, rotamers), 3.23 and 3.27 (1H, s, rotamers), 4.26-4.39 (1H, m), 4.31 and 4.45 (2H, s, rotamers), 6.28 (1H, td), 6.44 (1H, dt), 6.54 (1H, d), 6.96 (1H, brs, NH), 7.39 (1H, dd), 7.48 (1H, ddd), 7.55-7.62 (1H, m), 7.85-7.96 (1H, m), 8.48 (1H, s). (not all signals seen due to broadening/rotamers).

    Example 153

    3-(((1S,3S)-3-((3-Methoxy-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 153

    [1543] ##STR00708##

    rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (32 mg, 0.23 mmol) was added to 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (110 mg, 0.23 mmol), 3-methoxypyridin-2(1H)-one (CAS Reg. No. 20928-63-6) (57 mg, 0.46 mmol), Cs.sub.2CO.sub.3 (74 mg, 0.23 mmol) and Cu(I)I (44 mg, 0.23 mmol) in 1,4-dioxane (15 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was poured into water (125 mL) and extracted with EtOAc (4?100 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was first purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod K, gradient: 53-68%) to afford (51 mg, 47%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.27N.sub.8O.sub.4: 479.2150, found: 479.2168. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.43-1.73 (2H, m), 1.82-2.27 (4H, m), 3.71 (3H, s), 4.22-4.48 (2H, m), 4.63-4.78 (4H, m), 5.06 (1H, sxt), 6.21 (1H, t), 6.52 (1H, d), 6.78-7.01 (2H, m), 7.10-7.23 (1H, m), 7.39 (1H, dd), 7.90 (1H, d), 8.35-8.95 (2H, s, rotamers), 9.52 (1H, d).

    Example 154

    3-(((1S,3S)-3-((5-Methoxy-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 154

    [1544] ##STR00709##

    [1545] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (110 mg, 0.23 mmol) and 5-methoxypyridin-2(1H-one (CAS Reg. No 61941-79-5) (57 mg, 0.46 mmol). PrepMethod 0, gradient: 7-28%. Yield 13 mg (12%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.27N.sub.8O.sub.4: 479.2150, found: 479.2176. .sup.1H NMR (300 MHz, DMSO-.sub.d6) ? ppm 1.43-1.71 (2H, m), 2.00 (2H, s), 2.10-2.33 (2H, m), 3.65 (3H, s), 4.28-4.64 (2H, m), 4.65-4.80 (4H, m), 4.9-5.1 (1H, m), 6.43 (1H, d), 6.54 (1H, d), 6.93 (1H, d), 7.19 (1H, d), 7.36 (1H, dd), 7.43 (1H, dd), 7.98 (1H, d), 8.35-8.95 (2H, s, rotamers), 9.52 (1H, d).

    Example 155

    3-(((1S,3S)-3-((3-Methyl-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 155

    [1546] ##STR00710##

    [1547] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (120 mg, 0.25 mmol) and 3-methylpyridin-2(1H-one (54 mg, 0.50 mmol) (CAS Reg. No 1003-56-1). PrepMethod M, gradient: 16-34%. Yield 30 mg (26%). HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.27N.sub.8O.sub.3: 463.2200, found: 463.2202. .sup.1H NMR (300 MHz, DMSO-.sub.d6) ? ppm 1.45-1.75 (2H, m), 2.03 (5H, s), 2.1-2.3 (2H, m), 4.37-3.45 (2H, m), 4.65-4.8 (4H, m), 4.98-5.12 (1H, m), 6.20 (1H, t), 6.54 (1H, d), 6.96 (1H, d), 7.32-7.51 (3H, m), 7.93 (1H, d), 8.35-8.95 (2H, s, rotamers), 9.54 (1H, d).

    Example 156

    3-(((1S,3S)-3-((5-Methyl-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 156

    [1548] ##STR00711##

    [1549] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (150 mg, 0.31 mmol) and 5-methylpyridin-2(1H-one (CAS Reg. No 1003-68-5) (41 mg, 0.37 mmol). PrepMethod P, gradient: 5-26%. Yield 27 mg (19%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.27N.sub.8O.sub.3: 463.2200, found: 463.2208. .sup.1H NMR (300 MHz, DMSO-.sub.d6) ? ppm 1.5-1.7 (2H, m), 1.85-2.00 (2H, m), 2.04 (3H, d), 2.15-2.22 (2H, m), 4.26-4.56 (2H, m), 4.65-4.8 (4H, m), 5.0-5.1 (1H, m), 6.39 (1H, d), 6.53 (1H, d), 6.94 (1H, d), 7.27-7.48 (3H, m), 7.92 (1H, d), 8.35-8.95 (2H, s, rotamers), 9.54 (1H, d).

    Example 157

    3-(((1S,3S)-3-((3-Chloro-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 157

    [1550] ##STR00712##

    [1551] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (120 mg, 0.25 mmol) and 3-chloropyridin-2(1H-one (CAS Reg. No 13466-35-8) (65 mg, 0.50 mmol). PrepMethod P, gradient: 5-28%. Yield 70 mg (58%). Yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24ClN.sub.8O.sub.3: 483.1654, found: 483.1646. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.75 (2H, m), 1.88-2.02 (2H, m), 2.1-2.3 (2H, m), 4.29-4.57 (2H, m), 4.67-4.75 (4H, m), 4.95-5.15 (1H, m), 6.31 (1H, t), 6.55 (1H, d), 7.03 (1H, d), 7.45 (1H, dd), 7.66 (1H, dd), 7.82 (1H, dd), 7.97 (1H, d), 8.35-8.95 (2H, s, rotamers), 9.54 (1H, d).

    Example 158

    3-(((1S,3S)-3-((5-Chloro-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 158

    [1552] ##STR00713##

    [1553] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (150 mg, 0.31 mmol) and 5-chloropyridin-2(1H-one (CAS Reg. No 4214-79-3) (81 mg, 0.62 mmol). PrepMethod D, gradient: 26-38%. Yield 27 mg (18%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24ClN.sub.8O.sub.3: 483.1654, found: 483.1670. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.50-1.70 (2H, m), 1.90-2.05 (2H, m), 2.07-2.38 (2H, m), 4.22-4.55 (2H, m), 4.64-4.76 (4H, m), 5.05 (1H, sxt), 6.46-6.56 (2H, m), 7.00 (1H, d), 7.42 (1H, dd), 7.55 (1H, dd), 7.93 (2H, d), 8.35-8.95 (2H, s, rotamers), 9.54 (1H, d).

    Example 159

    3-(((1S,3S)-3-((3-Cyano-2-oxo-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamidecompound 159

    [1554] ##STR00714##

    [1555] m-CPBA (330 mg, 1.63 mmol) was added to a stirred solution of 3-(methylthio)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90d (184 mg, 0.81 mmol) in DCM (10 mL) which was cooled to 0? C. in an ice bath. The temperature was increased to room temperature and the resulting solution was stirred for 3 h. 6-(((1S,3S)-3-Aminocyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-3-carbonitrile compound i-35b (120 mg, 0.41 mmol) and TEA (0.227 mL, 1.63 mmol) were added and the resulting solution was stirred at rt for an additional 15 h. The reaction mixture was diluted with sat. NaHCO.sub.3 (aq, 50 mL) and extracted with EtOAc (4?100 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue purified by preparative TLC (EtOAc) followed by preparative HPLC (PrepMethod D, gradient: 14-25%) to afford (15 mg, 8%) of the title compound as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.24N.sub.9O.sub.3: 474.1996, found: 474.2026. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.48-1.73 (2H, m), 1.9-2.1 (2H, s), 2.14-2.24 (2H, m), 4.27-4.80 (6H, m), 5.04 (1H, sxt), 6.47 (1H, t), 6.56 (1H, d), 7.09 (1H, d), 7.47 (1H, dd), 7.95-8.10 (2H, m), 8.23 (1H, dd), 8.35-8.95 (2H, s, rotamers), 9.53 (1H, d).

    Example 160

    N-(Oxetan-3-yl)-3-(((1S,3S)-3-((2-oxo-3-(trifluoromethoxy)-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxamidecompound 160

    [1556] ##STR00715##

    [1557] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (80 mg, 0.17 mmol) and 3-(trifluoromethoxy)pyridin-2(1H-one (CAS Reg. No 1361696-33-4) (36 mg, 0.20 mmol). PrepMethod R, gradient: 10-27%. Yield 17 mg (19%). Yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.24F.sub.3N.sub.8O.sub.4: 533.1868, found: 533.1912. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.75 (2H, m), 1.9-2.1 (2H, m), 2.12-2.22 (2H, m), 4.35 (2H, d), 4.6-4.8 (4H, m), 5.02 (1H, sxt), 6.32 (1H, t), 6.54 (1H, d), 7.03 (1H, d), 7.44 (1H, dd), 7.65-7.8 (2H, m), 7.97 (1H, d), 8.35-8.95 (2H, s, rotamers), 9.52 (1H, d).

    Example 161

    N-(Oxetan-3-yl)-3-(((1S,3S)-3-((2-oxo-3-(trifluoromethyl)-2H-[1,3-bipyridin]-6-yl)amino)cyclopentyl)amino)-1,2,4-triazine-6-carboxamidecompound 161

    [1558] ##STR00716##

    [1559] Prepared in a similar way as described for Example 153 starting from 3-(((1S,3S)-3-((5-iodopyridin-2-yl)amino)cyclopentyl)amino)-N-(oxetan-3-yl)-1,2,4-triazine-6-carboxamide compound i-90e (110 mg, 0.23 mmol) and 3-(trifluoromethyl)pyridin-2(1H)-one (CAS Reg. No 22245-83-6) (75 mg, 0.46 mmol). PrepMethod D, gradient: 20-40%. Yield 51 mg (43%). Pale-yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.24F.sub.3N.sub.8O.sub.3: 517.1918, found: 517.1958. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.47-1.75 (2H, m), 1.9-2.1 (2H, d), 2.11-2.27 (2H, m), 4.29-4.61 (2H, m), 4.64-4.77 (4H, m), 4.98-5.12 (1H, m), 6.43 (1H, t), 6.56 (1H, d), 7.06 (1H, d), 7.47 (1H, dd), 7.95-8.07 (3H, m), 8.34-8.97 (2H, s, rotamers), 9.54 (1H, d).

    Example 165

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(difluoromethoxy)-2H-[1,3-bipyridin]-2-onecompound 165

    [1560] ##STR00717##

    [1561] Prepared in a similar way as described in Example 153 starting from (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (85 mg, 0.20 mmol) and 3-(difluoromethoxy)pyridin-2(1H)-one (CAS Reg. No. 1241752-48-6) (130 mg, 0.81 mmol). PrepMethod D, gradient: 29-40%. Yield 28 mg (31%). Pale-yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24F.sub.2N.sub.7O.sub.2: 456.1954, found: 456.1932. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.86-1.01 (4H, m), 1.43-1.72 (2H, m), 1.88-1.98 (2H, m), 2.01-2.18 (3H, m), 4.25-4.46 (2H, m), 6.30 (1H, t), 6.55 (1H, d), 7.00 (1H, brd), 7.16 (1H, t, OCHF.sub.2), 7.38-7.49 (2H, m), 7.59 (2H, brd), 7.97 (1H, d), 8.19 (1H, s).

    Example 166

    6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(difluoromethoxy)-2H-[1,3-bipyridin]-2-onecompound 166

    [1562] ##STR00718##

    [1563] Prepared in a similar way as described in Example 153 from (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)-N.sup.3-(5-iodopyridin-2-yl)cyclopentane-1,3-diamine compound i-22e (70 mg, 0.17 mmol) and 5-(difluoromethoxy)pyridin-2(1H)-one (CAS Reg. No. 130318-75-1) (53 mg, 0.33 mmol). PrepMethod 0, gradient: 21-51%. Yield 21 mg (28%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24F.sub.2N.sub.7O.sub.2: 456.1954, found: 456.1960 .sup.1H NMR (300 MHz, DMSO-d.sub.6) b ppm 0.61-1.11 (4H, m), 1.4-1.7 (2H, m), 1.8-1.98 (2H, m), 1.98-2.27 (3H, m), 4.25-4.45 (2H, m), 6.52 (2H, brt), 6.69-7.31 (2H, m), 7.03 (1H, t, OCHF.sub.2), 7.31-7.65 (2H, m), 7.76 (1H, s), 7.96 (1H, s), 8.19 (1H, s).

    Example 167

    3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-4-fluoro-2-methoxybenzoic acidcompound 167

    [1564] ##STR00719##

    [1565] NaOH (20 mg, 0.50 mmol) was added to methyl 3-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-4-fluoro-2-methoxybenzoate compound i-91b (80 mg, 0.17 mmol) in water (1 mL) and THE (4 mL) at rt and the resulting mixture was stirred at rt for 4 h. The reaction mixture was adjusted to pH=6 with 0.1 M HCl (aq). The solvent and water was removed under reduced pressure and the crude was purified by preparative HPLC (PrepMethod 0, gradient: 17-30%) to afford (69 mg, 89%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.24H.sub.26FN.sub.6O.sub.3: 465.2044, found: 465.2052. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.86-1.03 (4H, m), 1.37-1.67 (2H, m), 1.81-1.99 (2H, m), 1.99-2.21 (3H, m), 3.80 (3H, s), 4.06-4.48 (2H, m), 6.52 (1H, d), 6.74 (1H, d), 6.99 (1H, d), 7.33 (1H, d), 7.45-7.61 (1H, m), 7.82 (1H, t), 7.91 (1H, s), 8.19 (1H, s).

    Example 168

    3-(6-(((1S,3S)-3-((6-Cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-4-fluoro-2-methoxybenzonitrilecompound 168

    [1566] ##STR00720##

    [1567] 3-(6-Chloropyridin-3-yl)-4-fluoro-2-methoxybenzonitrile compound i-92c (40 mg, 0.15 mmol) was added to (1S,3S)N.sup.1-(6-cyclopropyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-22d (40 mg, 0.18 mmol), Pd-PEPPSI-IPentCl 2-methylpyridine (12.8 mg, 0.02 mmol) and Cs.sub.2CO.sub.3 (99 mg, 0.30 mmol) in 1,4-dioxane (2 mL) at rt under nitrogen and the resulting solution was stirred at 100? C. for 8 h. The reaction mixture was poured into water (20 mL), filtered through a Celite pad and extracted with EtOAc (3?20 mL). The combined organic layers were dried over (Na.sub.2SO.sub.4), filtered and evaporated and the residue purified by preparative HPLC (PrepMethod T, gradient: 42-55%) to afford (24 mg, 36%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.24H.sub.25FN.sub.7O: 446.2098, found: 446.2134. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.83-1.01 (3H, m), 1.45-1.65 (2H, m), 1.84-2.21 (4H, m), 3.66 (3H, s), 4.30-4.44 (2H, m), 6.57 (1H, d), 6.95 (1H, d), 7.29 (1H, t), 7.41-7.47 (1H, m), 7.54 (1H, d), 7.85 (1H, dd), 8.02 (1H, br s), 8.19 (1H, s).

    Example 169

    (1S,3S)N.SUP.1.-(6-Cyclopropyl-1,2,4-triazin-3-yl)-N.SUP.3.-(5-(6-fluoro-2-methoxy-3-(1H-tetrazol-5-yl)phenyl)pyridin-2-yl)cyclopentane-1,3-diaminecompound 169

    [1568] ##STR00721##

    [1569] (nBu).sub.2Sn(OAc).sub.2 (118 mg, 0.34 mmol) was added to 3-(6-(((1S,3S)-3-((6-cyclopropyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-4-fluoro-2-methoxybenzonitrile Example 168 (50.0 mg, 0.11 mmol) and trimethylsilyl azide (65 mg, 0.56 mmol) in toluene (5 mL) at 0? C. under nitrogen and the resulting mixture was stirred at 100? C. for 16 h. The reaction mixture was diluted with EtOAc and filtered through Celite. The filtrate was concentrated under reduced pressure and the residue purified by preparative HPLC (PrepMethod U, gradient: 20-34%) to afford (5 mg, 9%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.24H.sub.26FN.sub.10O: 489.2270, found: 489.2288. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 0.84-1.04 (4H, m), 1.43-1.65 (2H, m), 1.84-1.99 (2H, m), 1.99-2.22 (3H, m), 3.35 (3H, s), 4.26-4.43 (2H, m), 6.58 (1H, d), 7.23 (1H, t), 7.48 (1H, d), 7.87 (1H, dd), 8.04 (1H, s), 8.18 (1H, s).

    Example 173

    rel-3-Methyl-6-(((1 R,3R)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 173

    [1570] ##STR00722##

    [1571] rel-(1 R,3R)N.sup.1-(6-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 3HCl compound i-87b (0.312 g, 1.03 mmol), 6-fluoro-3-methyl-2H-[1,3-bipyridin]-2-one compound i-38a (0.211 g, 1.03 mmol) and K.sub.2CO.sub.3 (0.570 g, 4.12 mmol) was added to a vial. The vial was capped and the reaction was stirred at 100? C. for 48 h. The mixture was cooled to rt, EtOAc and brine were added and the phases were separated. The aqueous phase was extracted once more with EtOAc. The organic phases were combined and washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure and the residue purified by preparative HPLC (PrepMethod F, gradient: 10-70%). The collected compound was concentrated and freeze dried overnight. The obtained solid was dissolved in DCM and washed with a small amount of water. The phases were separated and the organic phase was evaporated. The residue was dissolved in MeCN/water (1:1) and freeze dried overnight to give the title compound (0.190 g, 48%) as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O: 378.2036, found: 378.2038. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? 1.55-1.74 (2H, m), 1.96-2.11 (2H, m), 2.11-2.19 (3H, m), 2.22-2.37 (2H, m), 2.44 (3H, s), 4.31-4.53 (2H, m), 6.37 (1H, t), 6.62 (1H, dd), 7.41-7.45 (2H, m), 7.45-7.49 (1H, m), 7.93 (1H, dd), 8.19 (1H, s).

    Example 180

    4-Methoxy-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 180

    [1572] ##STR00723##

    [1573] Cs.sub.2CO.sub.3 (247 mg, 0.76 mmol) was added to (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (100 mg, 0.25 mmol), 4-methoxypyridin-2(1H)-one (CAS Reg. No. 92545-13-8) (158 mg, 1.26 mmol), (1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (36 mg, 0.25 mmol) and Cu(I)I (48 mg, 0.25 mmol) in 1,4-dioxane (5 mL) at rt and the resulting mixture was stirred at 100? C. for 16 h under nitrogen. The reaction mixture was quenched with water (50 mL), extracted with EtOAc (4?100 mL), the combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product. The residue was first purified by preparative TLC (MeOH:DCM=1:30) and then by preparative HPLC (PrepMethod 0, gradient: 10-39%) to afford (28 mg, 28%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O.sub.2: 394.1986, found: 394.1980. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.65 (2H, m), 1.85-2.0 (2H, m), 2.1-2.25 (2H, m), 2.39 (3H, s), 3.77 (3H, s), 4.25-4.45 (2H, m), 5.85 (1H, d), 6.00 (1H, dd), 6.52 (1H, d), 6.90 (1H, d), 7.35 (1H, dd), 7.51 (1H, d), 7.56 (1H, s), 7.88 (1H, d), 8.18 (1H, s).

    Example 182

    4-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 182

    [1574] ##STR00724##

    [1575] Prepared in a similar way as described for Example 180 using (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (80 mg, 0.20 mmol) and 4-chloropyridin-2(1H-one (CAS Reg. No 40673-25-4) (131 mg, 1.01 mmol) and purified by preparative HPLC (PrepMethod T, gradient: 25-45%). Yield 37 mg (46%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.21ClN.sub.7O: 398.1490, found: 398.1474. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.49-1.61 (2H, m), 1.85-2.0 (2H, m), 2.12-2.21 (2H, m), 2.39 (3H, s), 4.30-4.42 (2H, m), 6.41 (1H, dd), 6.53 (1H, d), 6.62 (1H, d), 6.99 (1H, d), 7.40 (1H, dd), 7.56 (1H, s), 7.72 (1H, d), 7.93 (1H, d), 8.18 (1H, s).

    Example 183

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2-oxo-2H-[1,3-bipyridine]-4-carbonitrilecompound 183

    [1576] ##STR00725##

    [1577] Prepared in a similar way as described for Example 180 using (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (100 mg, 0.25 mmol) and 2-oxo-1,2-dihydropyridine-4-carbonitrile (CAS Reg. No 94805-51-3) (152 mg, 1.26 mmol) and purified by preparative HPLC (PrepMethod T, gradient: 25-45%). Yield 28 mg (29%). Yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.21N.sub.8O: 389.1832, found: 389.1820. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.49-1.61 (2H, m), 1.85-2.05 (2H, m), 2.11-2.23 (2H, m), 2.39 (3H, s), 4.25-4.45 (2H, m), 6.59 (1H, d), 6.59 (1H, dd), 7.04 (1H, d), 7.11 (1H, d), 7.43 (1H, dd), 7.56 (1H, brs), 7.88 (1H, d), 7.95 (1H, d), 8.18 (1H, s).

    Example 185

    5-(Difluoromethoxy)-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 185

    [1578] ##STR00726##

    [1579] Prepared in a similar way as described for Example 180 using (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (150 mg, 0.38 mmol) and 5-(difluoromethoxy)pyridin-2(1H-one (CAS Reg. No 130318-75-1) (183 mg, 1.14 mmol) and purified by preparative HPLC (PrepMethod M, gradient: 25-40%). Yield 79 mg (49%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.22F.sub.2N.sub.7O.sub.2: 430.1798, found: 430.1772. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.43-1.68 (2H, m), 1.85-2.0 (2H, m), 2.07-2.24 (2H, m), 2.39 (3H, s), 4.24-4.46 (2H, m), 6.47-6.54 (2H, m), 6.96 (1H, d), 7.02 (1H, t, OCHF.sub.2) 7.42 (1H, dd), 7.5-7.6 (2H, m), 7.75 (1H, d), 7.96 (1H, d), 8.18 (1H, s).

    Example 187

    3-(Difluoromethoxy)-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 187

    [1580] ##STR00727##

    [1581] Prepared in a similar way as described for Example 180 (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (100 mg, 0.25 mmol) and 3-(difluoromethoxy)pyridin-2(1H-one (CAS Reg. No 1241752-48-6) (81 mg, 0.50 mmol) and purified by preparative HPLC (PrepMethod O, gradient: 20-40%). Yield 45 mg (41%). White solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.22F.sub.2N.sub.7O.sub.2: 430.1798, found: 430.1832. .sup.1H NMR (300 MHz, DMSO-de) b ppm 1.43-1.66 (2H, m), 1.86-2.02 (2H, m), 2.1-2.25 (2H, m), 2.39 (3H, s), 4.26-4.45 (2H, m), 6.30 (1H, t), 6.55 (1H, d), 7.01 (1H, d), 7.16 (1H, t, CHF.sub.2), 7.37-7.49 (2H, m), 7.52-7.63 (2H, m), 7.97 (1H, d), 8.18 (1H, s).

    Example 197

    1-(6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1,8-naphthyridin-2(1H)-onecompound 197

    [1582] ##STR00728##

    [1583] (1S,3S)N.sup.1-(6-Methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 4.5HCl compound i-28b (250 mg, 0.70 mmol) was added to 1-(6-chloropyridin-3-yl)-1,8-naphthyridin-2(1H-one compound i-6a (150 mg, 0.58 mmol), Pd-PEPPSI-IpentCl 2-methylpyridine (24.5 mg, 0.03 mmol) and K.sub.2CO.sub.3 (241 mg, 1.75 mmol) in 1,4-dioxane (10 mL) at 15? C. The resulting mixture was stirred at 100? C. for 15 h under a nitrogen atmosphere. The reaction mixture was poured into sat. brine (100 mL) and extracted with EtOAc (4?100 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod D, gradient: 15-31%) to give the title compound (90 mg, 37%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23N.sub.8O: 415.1990, found: 415.2008. .sup.1H NMR (300 MHz, DMSO-d.sub.6) 1.49-1.66 (2H, m), 1.88-2.03 (2H, m), 2.08-2.28 (2H, m), 2.39 (3H, s), 4.29-4.46 (2H, m), 6.59 (1H, d), 6.76 (1H, d), 6.84 (1H, d), 7.20-7.35 (2H, m), 7.57 (1H, d), 7.79 (1H, d), 8.04 (1H, d), 8.15-8.24 (2H, m), 8.44 (1H, dd).

    Example 198

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(1-methyl-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 198

    [1584] ##STR00729##

    [1585] 3-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one Example 129 (100 mg, 0.25 mmol) was added to (1-methyl-1H-pyrazol-4-yl)boronic acid (CAS Reg. No. 847818-55-7) (63 mg, 0.50 mmol), Cs.sub.2CO.sub.3 (246 mg, 0.75 mmol), XPhos Pd G3 (21 mg, 0.03 mmol) and XPhos (12 mg, 0.03 mmol) in 1,4-dioxane (12 mL) and water (3 mL) at rt and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was poured into sat. brine (125 mL) and extracted with EtOAc (4?100 mL), the combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product. The crude was first purified by preparative TLC (MeOH:EtOAc=1:40) followed by preparative HPLC (PrepMethod Z1, gradient: 15-29%) to afford (50 mg, 45%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.26N.sub.9O: 444.2254, found: 444.2264. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.65 (2H, m), 1.84-2.04 (2H, m), 2.1-2.25 (2H, m), 2.39 (3H, s), 3.85 (3H, s), 4.25-4.45 (2H, m), 6.36 (1H, t), 6.55 (1H, d), 6.95 (1H, d), 7.45 (1H, dd), 7.5-7.65 (2H, m), 7.85 (1H, dd), 7.97 (1H, d), 8.01 (1H, s), 8.18 (1H, s), 8.31 (1H, s).

    Example 199

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 199

    [1586] ##STR00730##

    [1587] 3-Chloro-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one Example 129 (150 mg, 0.38 mmol) was added to (1-(tert-butoxycarbonyl)-1H-pyrazol-4-yl)boronic acid (CAS Reg. No. 1188405-87-9) (160 mg, 0.75 mmol), XPhos (18 mg, 0.04 mmol), Cs.sub.2CO.sub.3 (369 mg, 1.13 mmol) and XPhos Pd 3G (32 mg, 0.04 mmol) in 1,4-dioxane (8 mL) and water (2 mL) at rt and the resulting solution was stirred at 100? C. for 18 h under nitrogen. The reaction mixture was diluted with EtOAc (100 mL) and washed sequentially with water (3?75 mL) and sat. brine (3?25 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product. The crude was first purified by preparative TLC (MeOH (7 M NH.sub.3): DCM=1:20) followed by preparative HPLC (PrepMethod X, gradient: 8-38%) to afford (47 mg, 29%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24N.sub.9O: 430.2098, found: 430.2120. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.38-1.67 (2H, m), 1.79-2.03 (2H, m), 2.17 (2H, m), 2.39 (3H, s), 4.25-4.45 (2H, m), 6.36 (1H, t), 6.56 (1H, d), 6.95 (1H, d), 7.45 (1H, dd), 7.5-7.65 (2H, m), 7.85-7.92 (1H, m), 7.96 (1H, d), 8.08 (1H, s), 8.18 (1H, s), 8.34 (1H, s), 12.86 (1H, s).

    Example 200

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 200

    [1588] ##STR00731##

    [1589] 4-Methylbenzenesulfonic acid (44 mg, 0.25 mmol) was added to 6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-3-(2-(tetrahydro-2H-pyran-2-yl)-2H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-68a (130 mg, 0.25 mmol) in EtOH (8 mL) and water (0.1 mL) at rt and the resulting solution was stirred at 60? C. for 8 h. The reaction mixture was diluted with EtOAc (125 mL) and washed sequentially with sat. aq NaHCO.sub.3 (3?75 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated to afford the crude product. The crude product was purified by preparative HPLC (PrepMethod Z2, gradient: 9-30%) to afford (39 mg, 36%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.23N.sub.10O: 431.2050, found: 431.2040. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.47-1.65 (2H, m), 1.87-2.02 (2H, m), 2.08-2.25 (2H, m), 2.39 (3H, s), 4.29-4.45 (2H, m), 6.48 (1H, t), 6.57 (1H, d), 6.98 (1H, brd), 7.48 (1H, dd), 7.53-7.61 (1H, m), 7.72 (1H, brd), 8.00 (1H, d), 8.18 (1H, s), 8.28 (1H, brs), 8.38 (1H, brs), 15.17 (1H, brs)

    Example 201

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1-methyl-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 201

    [1590] ##STR00732##

    [1591] A mixture of 6-chloro-5-(1-methyl-1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-one compound i-67b (90 mg, 0.31 mmol), (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine?2HCl compound i-28b (125 mg, 0.47 mmol), Cs.sub.2CO.sub.3 (511 mg, 1.57 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (13 mg, 0.02 mmol) in DMF (4 mL) was stirred under an atmosphere of nitrogen at 100? C. for 18 h. The reaction mixture was diluted with EtOAc (75 mL) and washed sequentially with sat. brine (4?35 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and evaporated and the residue was first purified by preparative TLC (MeOH:EtOAc=1:5) followed by preparative HPLC (PrepMethod D, gradient: 12-29%) to afford (8 mg, 6%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.26N.sub.9O: 444.2254, found: 444.2288. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.46-1.66 (2H, m), 1.85-2.0 (2H, m), 2.09-2.28 (2H, m), 2.39 (3H, s), 3.82 (3H, s), 4.25-4.45 (2H, m), 66.49-6.56 (2H, m), 6.95 (1H, d), 7.45 (1H, dd), 7.51-7.63 (1H, m), 7.7-7.8 (2H, m), 7.88 (1H, d), 7.98 (1H, d), 8.03 (1H, s), 8.18 (1H, s).

    Example 202

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1H-pyrazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 202

    [1592] ##STR00733##

    [1593] 5-(1-(4-Methoxybenzyl)-1H-pyrazol-4-yl)-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one compound i-50d (74 mg, 0.13 mmol) in TFA (7 mL) was stirred at 80? C. for 5 h. The reaction mixture was evaporated to afford crude product which was purified by preparative HPLC (PrepMethod Z3, gradient: 34-64%) to afford the title compound (17 mg, 30%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.24N.sub.9O: 430.2098, found: 430.2098. .sup.1H NMR (300 MHz, DMSO-de) b ppm 1.45-1.66 (H, m), 1.88-2.01 (2H, m), 2.12-2.23 (2H, m), 2.39 (3H, s), 4.3-4.45 (2H, m), 6.49-6.57 (2H, m), 6.95 (1H, d), 7.45 (1H, m), 7.57 (1H, d), 7.81 (1H, dd), 7.86 (1H, s), 7.91 (1H, d), 7.99 (1H, d), 8.10 (1H, s), 8.18 (1H, s), 12.86 (1H, s).

    Example 208

    6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-5-(1H-1,2,3-triazol-4-yl)-2H-[1,3-bipyridin]-2-onecompound 208

    [1594] ##STR00734##

    [1595] 5-(1-(4-Methoxybenzyl)-1H-1,2,3-triazol-4-yl)-6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one compound i-49c (20 mg, 0.04 mmol) was added into TFA (2.5 mL) at rt and the resulting suspension was stirred at 80? C. for 2 h under nitrogen. The solvent was removed under reduced pressure to afford crude product which was purified by preparative HPLC (PrepMethod 0, gradient: 2-27%) to afford (0.64 mg, 4%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.23N.sub.10O: 431.2050, found: 431.2050. .sup.1H NMR (300 MHz, Methanol-d.sub.4) ? 1.55-1.81 (2H, m), 1.88-2.14 (2H, m), 2.21-2.34 (2H, m), 2.47 (3H, s), 4.28-4.52 (2H, m), 6.57-6.75 (2H, m), 7.53 (1H, dd), 7.99 (1H, s), 8.05 (1H, d), 8.07-8.12 (2H, m), 8.22 (1H, s).

    Example 210

    1-Methyl-3-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrilecompound 210

    [1596] ##STR00735##

    [1597] In a slight variation of GM2 Pd-PEPPSI-IpentCl 2-methylpyridine (19 mg, 0.02 mmol) was added to a mixture of M-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 2HCl compound i-28b (120 mg, 0.45 mmol), 3-(6-chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile compound i-60d (141 mg, 0.50 mmol) and Cs.sub.2CO.sub.3 (441 mg, 1.35 mmol) in DMF (15 mL) at rt and the resulting mixture was stirred at 90? C. for 18 h under nitrogen. The reaction mixture was concentrated under reduced pressure and taken up with EtOAc (200 mL). The organic layer was washed with sat. brine (5?75 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (EtOAc) followed by preparative HPLC (PrepMethod 0, gradient: 30-47%) to give (48 mg, 24%) of the title compound as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.24N.sub.9O: 442.2098, found: 442.2132. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.50-1.61 (2H, m), 1.87-2.02 (2H, m), 2.11-2.24 (2H, m), 2.38 (3H, s), 3.43 (3H, s), 4.30-4.43 (2H, m), 6.62 (1H, d), 7.03 (1H, d), 7.30 (1H, d), 7.42 (1H, d), 7.47 (1H, dd), 7.53-7.62 (2H, m), 8.07 (1H, d), 8.17 (1H, s).

    Example 211

    3-Methyl-1-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrilecompound 211

    [1598] ##STR00736##

    [1599] In analogy to Example 210 M-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 2HCl compound i-28b (100 mg, 0.38 mmol), 1-(6-chloropyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carbonitrile compound i-61d (118 mg, 0.41 mmol), Pd-PEPPSI-IpentCl 2-methylpyridine (16 mg, 0.02 mmol) and Cs.sub.2CO.sub.3 (367 mg, 1.13 mmol) were reacted in 1,4-dioxane (15 mL) at 100? C. for 18 h under nitrogen. Upon aqueous work-up (EtOAc) and preparative TLC (EtOAc) the title compound (38 mg, 23%) was obtained. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.24N.sub.9O: 442.2098, found: 442.2122. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.49-1.62 (2H, m), 1.89-1.99 (2H, m), 2.12-2.21 (2H, m), 2.38 (3H, s), 3.42 (3H, s), 4.32-4.42 (2H, m), 6.63 (1H, d), 7.01-7.08 (2H, m), 7.45-7.58 (3H, m), 7.78 (1H, d), 8.06 (1H, d), 8.18 (1H, s).

    Example 212

    1-Methyl-3-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-onecompound 212

    [1600] ##STR00737##

    [1601] In analogy to Example 210 M-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine 4.5HCl compound i-28b (247 mg, 0.69 mmol), 3-(6-chloropyridin-3-yl)-1-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one compound i-24a (150 mg, 0.58 mmol), Pd-PEPPSI-IpentCl 2-methylpyridine (24 mg, 0.03 mmol) and K.sub.2CO.sub.3 (239 mg, 1.73 mmol) were reacted in 1,4-dioxane (15 mL) at 100? C. for 15 h under nitrogen. Upon aqueous work-up (EtOAc), preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:25) followed by preparative HPLC (PrepMethod D, gradient: 15-35%) the title compound (40 mg, 17%) was obtained as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21H.sub.24N.sub.9O: 418.2098, found: 418.2132. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.46-1.64 (2H, m) 1.86-2.02 (2H, m), 2.07-2.27 (2H, m), 2.38 (3H, s), 3.40 (3H, s), 4.32-4.42 (2H, m), 6.59 (1H, d), 6.92 (1H, d), 7.13 (1H, dd), 7.48-7.57 (3H, m), 7.93 (1H, d), 8.10 (1H, d), 8.17 (1H, s).

    Example 213

    1-Methyl-3-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-5-carbonitrilecompound 213

    [1602] ##STR00738##

    [1603] In analogy to Example 210 N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (135 mg, 0.70 mmol), 3-(6-chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-5-carbonitrile compound i-81e (100 mg, 0.35 mmol), Pd-PEPPSI-IpentCl 2-methylpyridine (29 mg, 0.04 mmol) and Cs.sub.2CO.sub.3 (342 mg, 1.05 mmol) were reacted in DMF (15 mL) at 100? C. for 15 h under nitrogen. Upon Celite filtration, aqueous work-up (EtOAc), preparative TLC (EtOAc:PE=3:1) followed by preparative HPLC (PrepMethod Z5, gradient: 42-88%) the title compound (6 mg, 4%) was obtained as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23N.sub.10O: 443.2050, found: 443.2076. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.49-1.64 (2H, m), 1.87-2.02 (2H, m), 2.13-2.21 (2H, m), 2.38 (3H, s), 3.44 (3H, s), 4.30-4.44 (2H, m), 6.61 (1H, d), 7.01 (1H, d), 7.49 (1H, dd), 7.55-7.57 (1H, m), 7.73 (1H, d), 7.81 (1H, d), 8.08 (1H, d), 8.17 (1H, s).

    Example 214

    1-Methyl-3-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-6-carbonitrilecompound 214

    [1604] ##STR00739##

    [1605] In analogy to Example 210 M-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (135 mg, 0.70 mmol), 3-(6-chloropyridin-3-yl)-1-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-b]pyridine-6-carbonitrile compound i-82d (100 mg, 0.35 mmol), Pd-PEPPSI-IpentCl 2-methylpyridine (29 mg, 0.04 mmol) and Cs.sub.2CO.sub.3 (342 mg, 1.05 mmol) were reacted in DMF (10 mL) at 100? C. for 16 h under nitrogen. Upon aqueous work-up (EtOAc), preparative TLC (EtOAc:PE=1:1) followed by preparative HPLC (PrepMethod 0, gradient: 22-40%) the title compound (27 mg, 17%) was obtained as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.23N.sub.10O: 443.2050, found: 443.2056. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.45-1.64 (2H, m), 1.85-2.01 (2H, m), 2.12-2.20 (2H, m), 2.38 (3H, s), 3.42 (3H, s), 4.29-4.43 (2H, m), 6.59 (1H, d), 7.01 (1H, d), 7.49 (1H, dd), 7.57 (1H, brs), 8.07-8.09 (2H, m), 8.17 (1H, s), 8.42 (1H, d).

    Example 220

    4-Methoxy-2-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin-3(2H)-onecompound 220

    [1606] ##STR00740##

    rel-(1R,2R)N.sub.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (64.6 mg, 0.45 mmol) was added to (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (180 mg, 0.45 mmol), 4-methoxypyridazin-3(2H)-one (CAS Reg. No. 38732-07-9) (115 mg, 0.91 mmol), Cu(I)I (87 mg, 0.45 mmol) and K.sub.2CO.sub.3 (188 mg, 1.36 mmol) in DMF (10 mL) at 20? C. The resulting mixture was stirred at 100? C. for 15 h under a nitrogen atmosphere. The reaction mixture was poured into sat. brine (100 mL) and extracted with EtOAc (5?125 mL). The combined organic layers were washed with sat. brine (4?100 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated. The residue was purified by preparative TLC (MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod 0, gradient: 5-35%) to give the title compound (95 mg, 53%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.23N.sub.8O.sub.2: 395.1938, found: 395.1936. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.4-1.68 (2H, m), 1.82-2.03 (2H, m), 2.1-2.25 (2H, m), 2.39 (3H, s), 3.85 (3H, s), 4.23-4.49 (2H, m), 6.53 (1H, d), 6.81 (1H, d), 6.93 (1H, d), 7.43-7.63 (2H, m), 7.90 (1H, d), 8.08 (1H, d), 8.17 (1H, s).

    Example 221

    [1607] 4-Chloro-2-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin-3(2H)-onecompound 221

    ##STR00741##

    [1608] rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (71.8 mg, 0.50 mmol) was added to (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (200 mg, 0.50 mmol), 4-chloropyridazin-3(2H)-one (CAS Reg. No. 1677-79-8) (132 mg, 1.01 mmol), Cu(I)I (96 mg, 0.50 mmol) and K.sub.2CO.sub.3 (209 mg, 1.51 mmol) in DMF (15 mL) at 25? C. The resulting solution was stirred at 100? C. for 18 h under a nitrogen atmosphere. The reaction mixture was concentrated, diluted with EtOAc (250 mL) and washed sequentially with sat. brine (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue was purified by preparative TLC (MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod C, gradient: 18-33%) to give the title compound (55.4 mg, 27%) as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C18H.sub.20ClN.sub.8O: 399.1442, found: 399.1428. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.66 (2H, m), 1.83-2.03 (2H, m), 2.08-2.25 (2H, m), 2.39 (3H, s), 4.25-4.47 (2H, m), 6.54 (1H, d), 7.02 (1H, d), 7.48-7.61 (2H, m), 7.84 (1H, d), 8.00 (1H, d), 8.12 (1H, d), 8.18 (1H, s).

    Example 222

    6-Chloro-2-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin-3(2H-onecompound 222

    [1609] ##STR00742##

    [1610] rel-(1R,2R)N.sup.1,N.sup.2-Dimethylcyclohexane-1,2-diamine (71.8 mg, 0.50 mmol) was added to (1S,3S)N.sup.1-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (200 mg, 0.50 mmol), 6-chloropyridazin-3(2H)-one (CAS Reg. No. 19064-67-6) (132 mg, 1.01 mmol), Cu(I)I (96 mg, 0.50 mmol) and K.sub.2CO.sub.3 (209 mg, 1.51 mmol) in DMF (15 mL) at 25? C. The resulting solution was stirred at 100? C. for 18 h under a nitrogen atmosphere. The reaction mixture was concentrated, diluted with EtOAc (250 mL) and washed sequentially with sat. brine (3?75 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue was purified by preparative TLC (MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod D, gradient: 20-30%) to give the title compound (38 mg, 19%) as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.18H.sub.20ClN.sub.8O: 399.1442, found: 399.1464. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.40-1.65 (2H, m), 1.82-1.99 (2H, m), 2.05-2.22 (2H, m), 2.39 (3H, s), 4.25-4.45 (2H, m), 6.53 (1H, d), 7.03 (1H, d), 7.13 (1H, d), 7.45-7.72 (3H, m), 8.11 (1H, d), 8.18 (1H, s).

    Example 247

    2-(6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)benzonitrilecompound 247

    [1611] ##STR00743##

    [1612] A mixture of (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (0.099 g, 0.32 mmol), 2-bromobenzonitrile (CAS Reg. No. 2042-37-7) (0.132 g, 0.72 mmol), Pd-118 (0.021 g, 0.03 mmol) and K.sub.2CO.sub.3 1.8 M (700 PL, 1.26 mmol) in 1,4-dioxane (3 mL) was stirred a 90? C. for 2 h. Solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and purified by preparative HPLC (PrepMethod F, gradient 30-70%) to afford (67 mg, 57%) of the title compound as a beige solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.22N.sub.7: 372.1932, found: 372.1938; .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.57-1.72 (2H, m), 1.97-2.12 (2H, m), 2.23-2.35 (2H, m), 2.43 (3H, s), 4.33-4.49 (2H, m), 6.63 (1H, d), 7.45 (1H, td), 7.5-7.55 (1H, m), 7.62-7.72 (2H, m), 7.78 (1H, dd), 8.16 (1H, d), 8.18 (1H, s).

    Example 248

    (1S,3S)N.SUP.1.-(6-Methyl-1,2,4-triazin-3-yl)-N.SUP.1.-(3-methyl-[2,3-bipyridin]-6-yl)cyclopentane-1,3-diaminecompound 248

    [1613] ##STR00744##

    [1614] A mixture of (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (0.104 g, 0.33 mmol), 2-bromo-3-methylpyridine (CAS Reg. No. 3430-17-9) (74 ?L, 0.66 mmol), Pd-118 (22 mg, 0.03 mmol) and aq K.sub.2CO.sub.3 (1.8 M, 736 PL, 1.32 mmol) in 1,4-dioxane (3 mL) was stirred at 90? C. for 2 h. Solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and purified by preparative HPLC (PrepMethod F, gradient 20-60%) to afford (58 mg, 49%) of the title compound as a beige solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7: 362.2088, found: 362.2074. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.58-1.73 (2H, m), 1.97-2.13 (2H, m), 2.24-2.36 (2H, m), 2.38 (3H, s), 2.44 (s, 3H), 4.33-4.5 (2H, m), 6.63 (1H, d), 7.27 (1H, dd), 7.60 (1H, dd), 7.73 (1H, dd), 8.11 (1H, s), 8.19 (1H, s), 8.38 (1H, d).

    Example 249

    (1S,3S)N.SUP.1.-(5-(3,5-Dimethyl-1H-pyrazol-1-yl)pyridin-2-yl)-N.SUP.1.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 249

    [1615] ##STR00745##

    [1616] A mixture of 6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (0.122 g, 0.39 mmol), 3,5-dimethyl-1H-pyrazole (CAS Reg. No. 67-51-6) (0.149 g, 1.55 mmol), diacetoxycopper (0.169 g, 0.93 mmol) and pyridine (0.17 mL, 2.1 mmol) in DCM (4 mL) and DMF (0.8 mL) was stirred at rt for 20 h. Solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and purified by preparative HPLC (PrepMethod F, gradient 20-60%) to yield a pale-blue solid. DCM and water were added to the solid. Phases were separated on a phase separator and the organic layer concentrated to afford (73 mg, 52%) of the title compound as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.25N.sub.8: 365.2196, found: 365.2186; .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.56-1.71 (2H, m), 1.96-2.11 (2H, m), 2.19 (3H, s), 2.22 (3H, s), 2.24-2.33 (2H, m), 2.44 (3H, s), 4.36 (1H, p), 4.44 (1H, p), 6.02 (1H, s), 6.61 (1H, d), 7.42 (1H, dd), 7.96 (1H, d), 8.19 (1H, s).

    Example 250

    2,4-Dimethyl-1-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-1H-imidazole-5-carbonitrilecompound 250

    [1617] ##STR00746##

    [1618] A mixture of (1S,3S)N.sup.1-(5-(5-iodo-2,4-dimethyl-1H-imidazol-1-yl)pyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-77b (40 mg, 0.08 mmol), cyanocopper (29 mg, 0.33 mmol) and Pd(OAc).sub.2 (7.33 mg, 0.03 mmol) in NMP (1 mL) was stirred at 120? C. for 5 h. The mixture was concentrated, the residue dissolved in DCM and washed with water. The organic layer was concentrated under reduced pressure and purified by preparative HPLC (PrepMethod F, gradient 10-50%) to afford (3 mg, 9%) of the title compound as a beige solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.9: 390.2150, found: 390.2166. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? 1.6-1.72 (2H, m), 2-2.12 (2H, m), 2.25-2.34 (5H, m), 2.34 (3H, s), 2.45 (3H, s), 4.36-4.5 (2H, m), 6.65 (1H, dd), 7.44 (1H, dd), 8.01 (1H, d), 8.20 (1H, s).

    Example 254

    6-(((1S,3S)-3-((6-Methyl-5-oxo-4,5-dihydro-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 254

    [1619] ##STR00747##

    [1620] According to GM1A 6-(((1S,3S)-3-aminocyclopentyl)amino)-2H-[1,3-bipyridin]-2-one HCl compound i-1c (283 mg, 0.92 mmol), 6-methyl-3-(methylsulfinyl)-1,2,4-triazin-5(4H)-one compound i-80a (160 mg, 0.92 mmol) and DIPEA (484 ?L, 2.77 mmol) were reacted in 1,4-dioxane (10 mL) at 100? C. for 15 h. The reaction mixture was diluted with sat. brine (100 ml) and extracted with EtOAc (3?75 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative HPLC (PrepMethod E, gradient: 2-28%) to give the title compound (42 mg, 12%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.22N.sub.7O.sub.2: 380.1830, found: 380.1846. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.54-1.66 (2H, m), 2.00 (2H, t), 2.14 (3H, s), 2.21-2.32 (2H, m), 4.30-4.40 (2H, m), 6.47 (1H, dt), 6.60-6.64 (2H, m), 7.45 (1H, dd), 7.57-7.64 (2H, m), 7.95 (1H, brd).

    Example 255

    6-(((1S,3S)-3-((6-Chloro-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 255

    [1621] ##STR00748##

    [1622] N-chlorosuccinimide (NCS) (19 mg, 0.14 mmol) was added to a mixture of 6-(((1S,3S)-3-((1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one compound i-83b (50 mg, 0.14 mmol) in MeCN (2 mL) at 25? C. and it was stirred for 17 h. The reaction mixture was concentrated under reduced pressure and the crude material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod 0, gradient: 12-42%) to give the title compound (5.7 mg, 10%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.18H.sub.19ClN.sub.7O: 384.1334, found: 384.1310. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.62-1.76 (2H, m), 2.10 (2H, t), 2.26-2.38 (2H, m), 4.45-4.54 (1H, m), 4.58-4.67 (1H, m), 6.47 (1H, dt), 6.60-6.64 (1H, m), 7.58-7.64 (2H, m), 7.69 (1H, d), 8.00 (1H, d), 8.25 (1H, d), 8.46 (1H, d).

    Example 256

    6-(((1S,3S)-3-((6-(Dimethylamino)-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 256

    [1623] ##STR00749##

    [1624] According to GM2 Cs.sub.2CO.sub.3 (183 mg, 0.56 mmol) was added to a mixture of 6-(((1S,3S)-3-((6-bromo-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-one compound i-84b (80 mg, 0.19 mmol), dimethylamine in THE (2 M, 0.28 mL, 0.56 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (16 mg, 2 ?mol) in dioxane (5 mL) at rt and the resulting suspension was stirred at 100? C. for 16 h under nitrogen. The reaction mixture was poured into water (100 mL) and extracted with EtOAc (2?100 mL). The combined organic layers were dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product which was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:25) followed by preparative HPLC (PrepMethod C, gradient: 15-33%) to give (17 mg, 23%) of the title compound as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.25N.sub.8O: 393.2146, found: 393.2140. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.43-1.61 (2H, m), 1.82-1.97 (2H, m), 2.07-2.18 (2H, m), 2.96 (6H, s), 4.23-4.34 (2H, m), 6.27 (1H, dt), 6.44 (1H, d), 6.53 (1H, d), 6.77 (1H, d), 6.92 (1H, d), 7.39 (1H, dd), 7.47 (1H, ddd), 7.61 (1H, dd), 7.92 (1H, d), 8.23 (1H, s).

    Example 257

    6-(((1S,3S)-3-((6-(1H-Pyrazol-5-yl)-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 257

    [1625] ##STR00750##

    [1626] According to GM1A (1S,3S)N.sup.1-(6-(1H-pyrazol-5-yl)-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-85b 4TFA (370 mg, 0.53 mmol), 6-fluoro-2H-[1,3-bipyridin]-2-one (CAS Reg. No. 2062643-92-7) compound i-100a (150 mg, 0.79 mmol) and K.sub.2CO.sub.3 (365 mg, 2.64 mmol) were reacted in DMSO (5 mL) at 100? C. for 16 h. The reaction mixture was poured into water (100 mL) and extracted with EtOAc (2?100 mL). The combined organic layers were washed with sat. brine (3?50 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product which was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:30) followed by preparative HPLC (PrepMethod D, gradient: 7-37%) the title compound (3.0 mg, 1.4%) as a pale yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21H.sub.22ClN.sub.9O: 416.1942, found: 416.1940. .sup.1H NMR (300 MHz, DMSO-de) b ppm 1.50-1.68 (2H, m), 1.92-2.05 (2H, m), 2.13-2.24 (2H, m), 4.30-4.51 (2H, m), 6.27 (1H, dt), 6.44 (1H, d), 6.54 (1H, d), 6.81 (1H, d), 6.96 (1H, d), 7.40 (1H, dd), 7.47 (1H, ddd), 7.61 (1H, dd), 7.85-7.93 (3H, m), 8.75 (1H, s), 13.10 (1H, brs).

    Example 258

    6-(((1S,3S)-3-((6-(Ethylthio)-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 258

    [1627] ##STR00751##

    [1628] According to GM1A (1S,3S)N.sup.1-(6-(ethylthio)-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-86b 3.3TFA (123 mg, 0.20 mmol), 6-fluoro-2H-[1,3-bipyridin]-2-one (CAS Reg. No. 2062643-92-7) compound i-100a (57 mg, 0.30 mmol) and Na.sub.2CO.sub.3 (106 mg, 1.00 mmol) were reacted in DMSO (5 mL) at 120? C. for 16 h. The reaction mixture was poured into water (100 mL) and extracted with EtOAc (2?100 mL). The combined organic layers were washed with sat. brine (3?50 mL), dried (Na.sub.2SO.sub.4), filtered and evaporated to afford crude product which was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod T, gradient: 25-43%) to give the title compound (3.0 mg, 1.4%) as a pale-yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7OS: 410.1758, found: 410.1750. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.26 (3H, t), 1.48-1.64 (2H, m), 1.88-1.99 (2H, m), 2.11-2.20 (2H, m), 3.10 (2H, q), 4.30-4.40 (2H, m), 6.27 (1H, t), 6.44 (1H, d), 6.53 (1H, d), 6.94 (1H, d), 7.40 (1H, dd), 7.47 (1H, ddd), 7.60 (1H, dd), 7.77 (1H, brs), 7.92 (1H, d), 8.28 (1H, s).

    Example 260

    6-(((1S,3S)-3-((6-Acetyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)-2H-[1,3-bipyridin]-2-onecompound 260

    [1629] ##STR00752##

    [1630] In a slight variation of GM2 Pd-PEPPSI-IpentCl 2-methylpyridine (17 mg, 0.02 mmol) was added to a mixture of 1-(3-(((1S,3S)-3-aminocyclopentyl)amino)-1,2,4-triazin-6-yl)ethan-1-one compound i-104b (180 mg, 0.81 mmol), 6-chloro-2H-[1,3-bipyridin]-2-one compound i-29a (84 mg, 0.41 mmol) and Cs.sub.2CO.sub.3 (398 mg, 1.22 mmol) in DMF (10 mL) at 25? C. and the resulting mixture was stirred at 100? C. for 15 h under nitrogen. The reaction mixture was concentrated under reduced pressure and taken up with EtOAc (200 mL). The organic layer was washed with sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (DCM:MeOH=15:1) followed by preparative HPLC (PrepMethod 0, gradient: 15-36%) to give (17 mg, 5.4%) of the title compound as a white solid. HRMS (ESI) m/z [M+H] calcd for C.sub.20H.sub.22N.sub.7O.sub.2: 392.1830, found: 392.1850. .sup.1H NMR (500 MHz, DMSO-d.sub.6, 2 rotamers) b ppm 1.53-1.69 (2H, m), 1.89-2.04 (2H, m), 2.13-2.26 (2H, m), 2.60 (3H, s), 4.33-4.45 (1.5H, m), 4.66 (0.5H, q), 6.27 (1H, dt), 6.44 (1H, d), 6.54 (1H, dd), 6.97 (1H, dd), 7.41 (1H, dd), 7.47 (1H, ddd), 7.60 (1H, d), 7.93 (1H, d), 8.62 (0.5H, d), 8.66 (1H, d), 9.10 (0.5H, d).

    Example 277

    2-(6-(((1S,3S)-3-((6-Methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)-3-oxo-2,3-dihydropyridazine-4-carbonitrilecompound 277

    [1631] ##STR00753##

    [1632] A mixture of 4-chloro-2-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin-3(2H)-one compound 221 (75 mg, 0.19 mmol), XPhos Pd G3 (CAS Reg. No. 1445085-55-1) (48 mg, 0.06 mmol), XPhos (27 mg, 0.06 mmol) and zinc cyanide (44 mg, 0.38 mmol) in DMF (10 mL) was sealed in a microwave tube under a nitrogen atmosphere and the resulting mixture was stirred at 140? C. for 1 h under microwave irradiation. The reaction mixture was quenched with sat. brine (150 mL) and the aqueous layer was extracted with EtOAc (3?100 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the residue was purified by preparative TLC (MeOH:DCM=1:10) followed by preparative HPLC PrepMethod 0, gradient: 18-37%) to give the title compound (50 mg, 68%) as an orange solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.20N.sub.9O: 390.1786, found: 390.1802. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.63 (2H, m), 1.84-2.00 (2H, m), 2.07-2.23 (2H, m), 2.38 (3H, s), 4.29-4.43 (2H, m), 6.55 (1H, d), 7.08 (1H, d), 7.52-7.56 (2H, m), 8.14 (1H, d), 8.17 (1H, s), 8.19 (1H, d), 8.22 (1H, d).

    Example 281

    4-(Difluoromethoxy)-2-(6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)pyridazin-3(2H)-onecompound 281

    [1633] ##STR00754##

    [1634] In a slight variation of GM3 (1S,3S)N-(5-iodopyridin-2-yl)-N.sup.3-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-39a (150 mg, 0.38 mmol), 4-(difluoromethoxy)pyridazin-3(2H)-one compound i-107e (184 mg, 1.14 mmol), K.sub.2CO.sub.3 (157 mg, 1.14 mmol), Cu(I)I (72 mg, 0.38 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (56 mg, 0.39 mmol) were reacted in DMF (10 mL) at 100? C. for 18 h. The reaction mixture was diluted with EtOAc (150 mL) and the organic layer was washed sequentially with water (3?75 mL) and sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod D, gradient: 10-40%) to give the title compound (76 mg, 47%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.21F.sub.2N.sub.8O.sub.2: 431.1750, found: 431.1742. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.44-1.63 (2H, m), 1.84-2.00 (2H, m), 2.07-2.23 (2H, m), 2.38 (3H, s), 4.28-4.43 (2H, m), 6.54 (1H, d), 7.00 (1H, d), 7.24 (1H, d), 7.46 (1H, t), 7.52 (1H, dd), 7.57 (1H, brs), 8.02 (1H, d), 8.11 (1H, d), 8.17 (1H, s). .sup.19F NMR (282 MHz, DMSO-d.sub.6) b ppm ?84.49 (2F, s).

    Example 304

    (1S,3S)N-(3-Methoxy-[2,3-bipyridin]-6-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 304

    [1635] ##STR00755##

    [1636] According to GM4A (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (50 mg, 0.16 mmol), 2-bromo-3-methoxypyridine (CAS Reg. No. 24100-18-3) (60 mg, 0.32 mmol), aq. K.sub.2CO.sub.3 (1.8 M, 354 ?L, 0.64 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (CAS Reg. No. 95408-45-0) (10 mg, 0.02 mmol) were reacted in 1,4-dioxane (1.5 mL) at 90? C. for 2 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by multiple preparative HPLC runs (PrepMethod Z10, gradient: 30-70% followed by PrepMethod G, gradient: 0-50% followed by PrepMethod Z9, gradient: 30-70%) to give the title compound (27 mg, 45%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O: 378.2036, found: 378.2044. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.57-1.72 (2H, m), 1.98-2.13 (2H, m), 2.24-2.35 (2H, m), 2.44 (3H, s), 3.90 (3H, s), 4.37 (1H, p), 4.45 (1H, p), 6.59 (1H, d), 7.29 (1H, dd), 7.50 (1H, dd), 7.92 (1H, dd), 8.14 (1H, dd), 8.19 (1H, s), 8.49 (1H, s).

    Example 305

    (1S,3S)N-(6-Methoxy-[2,3-bipyridin]-6-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 305

    [1637] ##STR00756##

    [1638] According to GM4A (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (50 mg, 0.16 mmol), 2-bromo-6-methoxypyridine (CAS Reg. No. 40473-07-2) (39 ?L, 0.32 mmol), aq. K.sub.2CO.sub.3 (1.8 M, 354 ?L, 0.64 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (CAS Reg. No. 95408-45-0) (10 mg, 0.02 mmol) were reacted in 1,4-dioxane (1.5 mL) at 90? C. for 2 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z10, gradient: 30-70%) to give the title compound (18 mg, 30%) as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.24N.sub.7O: 378.2036, found: 378.2030. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.57-1.73 (2H, m), 1.97-2.12 (2H, m), 2.23-2.35 (2H, m), 2.44 (3H, s), 3.97 (3H, s), 4.37 (1H, p), 4.44 (1H, p), 6.60 (2H, ddd), 7.27 (1H, dd), 7.63 (1H, dd), 8.09 (1H, dd), 8.19 (1H, s), 8.67 (1H, d).

    Example 306

    (1S,3S)N-(5-(2-Methoxyphenyl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 306

    [1639] ##STR00757##

    [1640] According to GM4A (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (50 mg, 0.16 mmol), 1-bromo-2-methoxybenzene (CAS Reg. No. 578-57-4) (40 ?L, 0.32 mmol), aq. K.sub.2CO.sub.3 (1.8 M, 354 ?L, 0.64 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (10 mg, 0.02 mmol) were reacted in 1,4-dioxane (1.5 mL) at 90? C. for 2 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z10, gradient: 30-70%) to give the title compound (30 mg, 50%) as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.25N.sub.6O: 377.2084, found: 377.2086. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.56-1.72 (2H, m), 1.96-2.12 (2H, m), 2.23-2.35 (2H, m), 2.44 (3H, s), 3.80 (3H, s), 4.32 (1H, p), 4.44 (1H, p), 6.56 (1H, dd), 6.98 (1H, td), 7.03 (1H, dd), 7.23 (1H, dd), 7.27 (1H, ddd), 7.60 (1H, dd), 8.06 (1H, d), 8.18 (1H, s).

    Example 307

    (1S,3S)N.SUP.1.-(5-(2,6-Dimethoxyphenyl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 307

    [1641] ##STR00758##

    [1642] According to GM4A (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (50 mg, 0.16 mmol), 2-bromo-1,3-dimethoxybenzene (CAS Reg. No. 16932-45-9) (69 mg, 0.32 mmol), aq. K.sub.2CO.sub.3 (1.8 M, 354 PL, 0.64 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (10 mg, 0.02 mmol) were reacted in 1,4-dioxane (1.5 mL) at 90? C. for 2 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z10, gradient: 30-70%) to give the title compound (45 mg, 70%) as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.27N.sub.6O.sub.2: 407.2190, found: 407.2200. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.56-1.71 (2H, m), 1.96-2.12 (2H, m), 2.22-2.34 (2H, m), 2.43 (3H, s), 3.71 (6H, s), 4.30 (1H, p), 4.44 (1H, p), 6.54 (1H, d), 6.69 (2H, d), 7.24 (1H, t), 7.35 (1H, dd), 7.79-7.86 (1H, m), 8.18 (1H, s).

    Example 308

    (1S,3S)N-(5-(2-Fluoro-6-methoxyphenyl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 308

    [1643] ##STR00759##

    [1644] According to GM4A (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (50 mg, 0.16 mmol), 2-bromo-1-fluoro-3-methoxybenzene (CAS Reg. No. 446-59-3) (65 mg, 0.32 mmol), aq. K.sub.2CO.sub.3 (1.8 M, 354 PL, 0.64 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (10 mg, 0.02 mmol) were reacted in 1,4-dioxane (1.5 mL) at 90? C. for 2 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z10, gradient: 30-70%) to give the title compound (39 mg, 62%) as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.24FN.sub.6O: 395.1990, found: 395.1964. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.56-1.72 (2H, m), 1.97-2.12 (2H, m), 2.23-2.35 (2H, m), 2.44 (3H, s), 3.78 (3H, s), 4.33 (1H, p), 4.44 (1H, p), 6.57 (1H, dd), 6.77 (1H, ddd), 6.87 (1H, dt), 7.27 (1H, td), 7.44 (1H, ddd), 7.92 (1H, s), 8.18 (1H, s).

    Example 309

    (1S,3S)N-([2,3-Bipyridin]-6-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 309

    [1645] ##STR00760##

    [1646] According to GM4A (6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (50 mg, 0.16 mmol), 2-bromopyridine (CAS Reg. No. 109-04-6) (30 ?L, 0.32 mmol), aq. K.sub.2CO.sub.3 (1.8 M, 354 ?L, 0.64 mmol) and 1,1-bis(di-tert-butylphosphino)ferrocene palladium dichloride (10 mg, 0.02 mmol) were reacted in 1,4-dioxane (1.5 mL) at 90? C. for 2 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z10, gradient: 10-60%) to give the title compound (3 mg, 5%) as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.22N.sub.7: 348.1932, found: 348.1904.

    Example 310

    (1S,3S)N-(5-(1H-Pyrazolo[3,4-b]pyridin-1-yl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 310

    [1647] ##STR00761##

    [1648] A mixture of 6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (96 mg, 0.31 mmol), 1H-pyrazolo[3,4-b]pyridine (CAS Reg. No. 271-73-8) (0.109 g, 0.92 mmol), diacetoxycopper (0.133 g, 0.73 mmol) and pyridine (0.14 mL, 1.7 mmol) in DCM (3 mL) and DMF (0.6 mL) was stirred at rt for 20 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z9, gradient: 0-60%) to give the title compound (8 mg, 7%) as an off-white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.22N.sub.9: 388.1992, found: 388.2024. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.59-1.73 (2H, m), 2-2.16 (2H, m), 2.31 (2H, ddt), 2.44 (3H, s), 4.39 (1H, p), 4.46 (1H, p), 6.70 (1H, d), 7.29 (1H, dd), 8.01 (1H, dd), 8.20 (1H, s), 8.26 (1H, s), 8.29 (1H, dd), 8.57 (1H, dd), 8.59 (1H, d).

    Example 311

    (1S,3S)N-(5-(1H-Indazol-1-yl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 311

    [1649] ##STR00762##

    [1650] A mixture of 6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (100 mg, 0.32 mmol), indazole (CAS Reg. No. 271-44-3) (0.113 g, 0.95 mmol), diacetoxycopper (0.156 g, 0.86 mmol) and pyridine (0.15 mL, 1.9 mmol) in DCM (3 mL) and DMF (0.6 mL) was stirred at rt for 20 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z9, gradient: 30-70%) to give the title compound (7 mg, 6%) as solid along with its 2-regiosiomer (see compound 312).

    [1651] HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21 H.sub.23N.sub.8: 387.2040, found: 387.2030. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.59-1.73 (2H, m), 2-2.14 (2H, m), 2.24-2.37 (2H, m), 2.44 (3H, s), 4.40 (1H, p), 4.46 (1H, p), 6.71 (1H, d), 7.23 (1H, ddd), 7.45 (1H, ddd), 7.54 (1H, dd), 7.67 (1H, dd), 7.83 (1H, dt), 8.14-8.26 (3H, m).

    Example 312

    (1S,3S)N.SUP.1.-(5-(2H-Indazol-2-yl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 312

    [1652] ##STR00763##

    [1653] Isolated from the above reaction mixture: yield 2 mg, 1.6%. MS (ESI) m/z [M+H].sup.+ 387.4.

    [1654] .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.59-1.74 (2H, m), 1.99-2.13 (2H, m), 2.24-2.37 (2H, m), 2.45 (3H, s), 4.37-4.5 (2H, m), 6.69 (1H, d), 7.11 (1H, ddd), 7.33 (1H, ddd), 7.66 (1H, dd), 7.75 (1H, dt), 7.93 (1H, dd), 8.20 (1H, s), 8.50 (1H, d), 8.59 (1H, d).

    Example 313

    (1S,3S)N.SUP.1.-(5-(3,5-dimethyl-1H-1,2,4-triazol-1-yl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 313

    [1655] ##STR00764##

    [1656] A mixture of 6-(((1S,3S)-3-((6-methyl-1,2,4-triazin-3-yl)amino)cyclopentyl)amino)pyridin-3-yl)boronic acid compound i-76a (100 mg, 0.32 mmol), 3,5-dimethyl-4H-1,2,4-triazole (0.093 g, 0.95 mmol) (CAS Reg. No. 7343-34-2) (93 mg, 0.95 mmol), diacetoxycopper (0.139 g, 0.76 mmol) and pyridine (0.15 mL, 1.9 mmol) in DCM (3 mL) and DMF (0.6 mL) was stirred at rt for 20 h. The solids were filtered off and washed with MeOH. The combined filtrates were concentrated under reduced pressure and the obtained material was purified by preparative HPLC (PrepMethod Z9, gradient: 20-60%) to give the title compound (31 mg, 27%) as solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C18H.sub.24N.sub.9: 366.2150, found: 366.2160. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.57-1.72 (2H, m), 1.98-2.11 (2H, m), 2.22-2.32 (2H, m), 2.33 (3H, s), 2.39 (3H, s), 2.44 (3H, s), 4.34-4.49 (2H, m), 6.62 (1H, dd), 7.48 (1H, dd), 8.02-8.07 (1H, m), 8.19 (1H, s).

    Example 314

    (1S,3S)N.SUP.1.-(5-(2,5-Dimethyloxazol-4-yl)pyridin-2-yl)-N.SUP.3.-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diaminecompound 314

    [1657] ##STR00765##

    [1658] According to GM1A 4-(6-fluoropyridin-3-yl)-2,5-dimethyloxazole compound i-108b (83 mg, 0.43 mmol) was added to a mixture of the 3 TFA salt of (1S,3S)N.sup.1-(6-methyl-1,2,4-triazin-3-yl)cyclopentane-1,3-diamine compound i-28b (393 mg, 0.73 mmol) and K.sub.2CO.sub.3 (537 mg, 3.89 mmol) in DMSO (3 mL). The resulting mixture was stirred at 80? C. for 1 week under a nitrogen atmosphere. The solids were filtered off and the filtrate was purified by preparative HPLC (PrepMethod Z9, gradient: 20-60%) to give the title compound (55 mg, 35%) as brown solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.19H.sub.24N.sub.7O: 366.2036, found: 366.2032. .sup.1H NMR (500 MHz, MeOH-d.sub.4) ? ppm 1.55-1.71 (2H, m), 1.96-2.11 (2H, m), 2.22-2.33 (2H, m), 2.42 (6H, s), 2.43 (3H, s), 4.33 (1H, p), 4.43 (1H, p), 6.59 (1H, d), 7.62 (1H, dd), 8.15 (1H, d), 8.18 (1H, s).

    Example 315

    rac-6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)-3-methyl-2H-[1,3-bipyridin]-2-onecompound 315

    [1659] ##STR00766##

    [1660] According to GM3 rac-4-((5-iodopyridin-2-yl)amino)-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109g (90 mg, 0.22 mmol), 3-methylpyridin-2(1H-one (CAS Reg. No. 1003-56-1) (24 mg, 0.22 mmol), Cs.sub.2CO.sub.3 (142 mg, 0.43 mmol), Cu(I)I (21 mg, 0.11 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (15 mg, 0.11 mmol) were reacted in 1,4-dioxane (15 mL) at 80? C. for 18 h under nitrogen. The reaction mixture was diluted with EtOAc (150 mL) and the organic layer was washed sequentially with water (3?75 mL) and sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod X, gradient: 8-38%) to give the title compound (46 mg, 54%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.26N.sub.7O.sub.2: 396.2142, found: 396.2158. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 1.52 (2H, q), 2.02-2.06 (4H, m), 2.37 (3H, s), 3.32-3.38 (4H, m, partly covered by water peak), 3.52 (2H, q), 4.47 (1H, t), 6.19 (1H, t), 6.55 (1H, d), 6.86 (1H, brt), 7.35-7.40 (2H, m), 7.44-7.50 (2H, m), 7.89 (1H, d), 8.16 (1H, s).

    Example 316

    rac-6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)-5-methyl-2H-[1,3-bipyridin]-2-onecompound 316

    [1661] ##STR00767##

    [1662] According to GM3 rac-4-((5-iodopyridin-2-yl)amino)-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109g (100 mg, 0.24 mmol), 5-methylpyridin-2(1H-one (CAS Reg. No 1003-68-5) (53 mg, 0.48 mmol), Cs.sub.2CO.sub.3 (157 mg, 0.48 mmol), Cu(I)I (23 mg, 0.12 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (17 mg, 0.12 mmol) were reacted in 1,4-dioxane (15 mL) at 80? C. for 15 h under nitrogen. The reaction mixture was filtered through a filter membrane and the obtained residue purified by preparative TLC (DCM:MeOH=10:1) followed by preparative HPLC (PrepMethod D, gradient: 10-28%) to give the title compound (35 mg, 37%) as a yellow solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.26N.sub.7O.sub.2: 396.2142, found: 396.2128. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.53 (2H, q), 2.03-2.06 (4H, m), 2.38 (3H, s), 3.30-3.39 (4H, m, partly covered by water peak), 3.53 (2H, q), 4.45 (1H, t), 6.39 (1H, d), 6.56 (1H, d), 6.83 (1H, t), 7.33-7.40 (3H, m), 7.48 (1H, brs), 7.89 (1H, d), 8.16 (1H, s).

    Example 317

    rac-6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)-5-methoxy-2H-[1,3-bipyridin]-2-onecompound 317

    [1663] ##STR00768##

    [1664] According to GM3 rac-4-((5-iodopyridin-2-yl)amino)-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109g (90 mg, 0.22 mmol), 5-methoxypyridin-2(1H-one (CAS Reg. No. 61941-79-5) (54 mg, 0.43 mmol), Cs.sub.2CO.sub.3 (142 mg, 0.43 mmol), Cu(I)I (21 mg, 0.11 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (15 mg, 0.11 mmol) were reacted in 1,4-dioxane (15 mL) at 80? C. for 18 h under nitrogen. The reaction mixture was diluted with EtOAc (150 mL) and the organic layer was washed sequentially with water (3?75 mL) and sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15, 96 mg isolated) followed by preparative HPLC (PrepMethod X, gradient: 8-38%) to give the title compound (43 mg, 48%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.20H.sub.26N.sub.7O.sub.3: 412.2092, found: 412.2090.

    [1665] .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 1.52 (2H, q), 2.03 (1H, qn), 2.33 (3H, s), 3.31-3.38 (4H, m, partly covered by water peak), 3.52 (2H, q), 3.64 (3H, s), 4.47 (1H, t), 6.42 (1H, d), 6.56 (1H, d), 6.86 (1H, t), 7.18 (1H, d), 7.35 (1H, dd), 7.42 (1H, dd), 7.50 (1H, brs), 7.95 (1H, d), 8.16 (1H, s).

    Example 318

    rac-1-(6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)pyridin-3-yl)quinolin-2(1H)-onecompound 318

    [1666] ##STR00769##

    [1667] According to GM2 the crude HCl salt of rac-4-amino-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109f (150 mg, 0.53 mmol), 1-(6-chloropyridin-3-yl)quinolin-2(1H)-one compound i-21a (203 mg, 0.79 mmol), Cs.sub.2CO.sub.3 (516 mg, 1.58 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (22 mg, 0.03 mmol) were reacted in 1,4-dioxane (10 mL) at 100? C. for 18 h under nitrogen. The reaction mixture was concentrated under reduced pressure and taken up with EtOAc (150 mL). The organic layer was washed with sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (MeOH:DCM=1:20) followed by preparative HPLC (PrepMethod 0, gradient: 19-34%) to give the title compound (37 mg, 16%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.23H.sub.26N.sub.7O.sub.2: 432.2142, found: 432.2148. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.56 (2H, q), 2.04-2.13 (1H, m), 2.37 (3H, s), 3.32-3.42 (4H, m, partly covered by water peak), 3.55 (2H, q), 4.49 (1H, t), 6.64-6.74 (3H, m), 6.93 (1H, brt), 7.23 (1H, t), 7.30 (1H, dd), 7.45 (1H, t), 7.52 (1H, brs), 7.75 (1H, d), 7.82 (1H, t), 8.01 (1H, d), 8.16 (1H, s).

    Example 319

    rac-3-(6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)pyridin-3-yl)-1-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-onecompound 319

    [1668] ##STR00770##

    [1669] According to GM2 the crude HCl salt of rac-4-amino-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109f (153 mg, 0.54 mmol), 3-(6-chloropyridin-3-yl)-1-methyl-1,3-dihydro-2H-imidazo[4,5-b]pyridin-2-one compound i-24a (140 mg, 0.54 mmol), Cs.sub.2CO.sub.3 (875 mg, 2.69 mmol) and Pd-PEPPSI-IpentCl 2-methylpyridine (36 mg, 0.04 mmol) were reacted in 1,4-dioxane (20 mL) at 100? C. for 18 h under nitrogen and subsequently filtered through Celite. The filter cake was washed with DCM (2?10 mL), the combined filtrates concentrated under reduced pressure and the residue was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod 0, gradient: 13-28%) to give the title compound (30 mg, 13%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.21H.sub.26N.sub.9O.sub.2: 436.2204, found: 436.2220. .sup.1H NMR (300 MHz, DMSO-d.sub.6) ? ppm 1.53 (2H, q), 2.01-2.09 (1H, m), 2.37 (3H, s), 3.30-3.40 (7H, m, partly covered by water peak), 3.53 (2H, q), 4.48 (1H, t), 6.62 (1H, d), 6.86 (1H, t), 7.14 (1H, dd), 7.49-7.58 (3H, m), 7.94 (1H, dd), 8.08 (1H, d), 8.16 (1H, s).

    Example 320

    rac-1-(6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)pyridin-3-yl)-1,8-naphthyridin-2(1H)-onecompound 320

    [1670] ##STR00771##

    [1671] According to GM3 the crude HCl salt of rac-4-amino-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109f (248 mg, 0.87 mmol), 1-(6-chloropyridin-3-yl)-1,8-naphthyridin-2(1H)-one compound i-6a (150 mg, 0.58 mmol), Cs.sub.2CO.sub.3 (569 mg, 1.75 mmol), Cu(I)I (111 mg, 0.58 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (83 mg, 0.58 mmol) were reacted in 1,4-dioxane (10 mL) at 80? C. for 15 h under nitrogen. The reaction mixture was poured into water (125 mL) and the aqueous layer was extracted with EtOAc (4?100 mL). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (7 M NH.sub.3 in MeOH:DCM=1:15) followed by preparative HPLC (PrepMethod 0, gradient: 13-25%) to give the title compound (48 mg, 19%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.25N.sub.8O.sub.2: 433.2094, found: 433.2126. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ? ppm 1.55 (2H, q), 2.02-2.11 (1H, m), 2.38 (3H, s), 3.33-3.41 (4H, m, partly covered by water peak), 3.55 (2H, q), 4.49 (1H, t), 6.61 (1H, d), 6.75 (1H, d), 6.78 (1H, t), 7.25 (1H, dd), 7.29 (1H, dd), 7.54 (1H, brs), 7.78 (1H, d), 8.03 (1H, d), 8.16 (1H, s), 8.20 (1H, dd), 8.44 (1H, dd).

    Example 321

    rac-1-(6-((4-Hydroxy-2-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butyl)amino)pyridin-3-yl)-3-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-onecompound 321

    [1672] ##STR00772##

    [1673] According to GM3 rac-4-((5-iodopyridin-2-yl)amino)-3-(((6-methyl-1,2,4-triazin-3-yl)amino)methyl)butan-1-ol compound i-109g (60 mg, 0.14 mmol), 1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one (CAS Reg. No. 1849-01-0) (43 mg, 0.29 mmol), Cs.sub.2CO.sub.3 (142 mg, 0.43 mmol), Cu(I)I (28 mg, 0.14 mmol) and rel-(1R,2R)N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (21 mg, 0.14 mmol) were reacted in 1,4-dioxane (10 mL) at 80? C. for 15 h under nitrogen. The reaction mixture was concentrated under reduced pressure and taken up with EtOAc (200 mL). The organic layer was washed with sat. brine (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and evaporated and the crude material was purified by preparative TLC (MeOH:DCM=1:15) followed by flash C18-flash chromatography (gradient: 0-40% MeCN in water) to give the title compound (20 mg, 32%) as a white solid. HRMS (ESI) m/z [M+H].sup.+ calcd for C.sub.22H.sub.27N.sub.8O.sub.2: 435.2252, found: 435.2282. .sup.1H NMR (300 MHz, MeOH-d.sub.4) ? ppm 1.67 (2H, q), 2.10-2.19 (1H, m), 2.43 (3H, s), 3.37-3.58 (7H, m), 3.74 (2H, t), 6.71 (1H, dd), 6.94 (1H, d), 7.07-7.22 (3H, m), 7.48 (1H, dd), 8.08 (1H, dd), 8.19 (1H, s).

    Assays and Methods Used

    Assay 1Biochemical Human PCSK9 Assay

    [1674] This assay measures binding of compounds to PCSK9 by homogenous time-resolved fluorescence resonance energy transfer (TR-FRET).

    [1675] To determine the IC.sub.50 of inhibitors of the interaction between the human PCSK9 and Alexa647 labelled small molecule, fluorescent probe displacement was monitored by homogenous TR-FRET technology. Upon binding of a terbium (Tb) cryptate conjugated anti-His mouse antibody (mAb Anti-6His Tb cryptate Gold, Cisbio) to PCSK9-TEV-His6, the displacement of the probe from PCSK9 was assessed by reduction of the proximity and FRET signal between the Tb cryptate that serves as a FRET-donor and the Alexa647 probe that serves as acceptor.

    [1676] Recombinantly expressed and purified PCSK9-TEV-His6 (1 nM) was mixed with a fluorescent probe (5 nM) and anti His-Tb-cryptate antibody (0.2 nM) in assay buffer (10 mM HEPES/NaOH, pH 7.4, 150 mM NaCl, 0.005 (v/v) % Tween 20). 6 ?L were subsequently added to an assay-ready plate containing 0.06 ?L of controls and test compound 10 dose-response serial dilutions starting at a concentration of 10 mM (with 100 ?M top and 3.2 nM lowest final concentration) by using Certus flex dispenser. The plate was sealed, and the reaction was incubated overnight (18-24 h) at RT in the dark.

    [1677] FRET signal quantification was achieved by PHERAstar FSX (BMG) plate reader. The created data file contained the emission of FRET acceptor channel (665 nm, probe), FRET donor channel (620 nm, Tb-cryptate, excitation at 337 nm) and the FRET ratio (665 nm/620 nm signal?10.000) which was used for calculation of a test compound's IC.sub.50.

    Assay 2Biophysical Human PCSK9 Assay

    [1678] This assay measures binding of compounds to PCSK9 by SPR (surface plasmon resonance, a biophysical method).

    [1679] The SPR binding experiments were performed on a Biacore S200 optical biosensor unit at 30? C. A Series S Sensor Chip SA that is designed to bind biotinylated molecules for interaction analysis in Biacore systems was equilibrated at room temperature prior to use. The running buffer for protein tethering and subsequent ligand binding experiments was 10 mM HEPES pH 7.4, 150 mM NaCl, 0.05% (v/v) Tween 20 pH 7.4.

    [1680] For the surface tethering of PCSK9, biotinylated human PCSK9 (31-692)-Avi-His6 at a concentration of 0.5 mg/mL was used. Prior to the surface tethering, the surface was exposed to a solution of 50 mM NaOH, 500 mM NaCl via 3 consecutive injections of this solution with a contact time of 60 s and a flowrate of 10 ?L min.sup.?1 to remove non-conjugated streptavidin. The PCSK9 protein was diluted to a concentration of 20 ?g/mL using running buffer and injected with a contact time of 180-300 s and a flowrate of 10 ?L min.sup.?1 over a single flow channel (typically flow channel 2 or flow channel 4) with the aim to achieve protein capture levels of >5000 response units (RU). Remaining biotin binding sites were blocked via 2 consecutive injections of a 10 ?M D-biotin solution in running buffer with a contact time of 60 s and a flowrate of 10 ?L min.sup.?1 over all flow-channels. Flow-channels 1 and 3 typically served as a reference surface throughout the subsequent binding experiments.

    [1681] The binding experiments were all performed at a flow rate of 30 PL min.sup.?1 and by employing the method of single-cycle kinetics. This approach involves the sequential injection of a compound concentration series without regeneration steps. A contact time between 90-150 s was selected, which was followed by a 40 min dissociation phase to allow for a proper estimation of the dissociation rate constant. Test compounds were delivered in DMSO at a concentration of 10 mM and a digital dispenser HP D300 was used to set up the compound concentration series using 6 concentrations. The tested concentrations have been 30, 100, 300, 1000, 3000 and 10000 nM. Prior to injecting any compound, the surfaces were equilibrated by injecting running buffer over them in three separate pulses. The data collection rate was set to 10 Hz.

    [1682] The raw sensorgrams of the compound injections were first subjected to reference subtraction (subtracting the signal from flow channel 1 and/or 3 from the signal from channels 2 and/or 4 respectively) and then blank subtraction (subtracting the signal from injecting DMSO controls from the reference subtracted data). The resulting double-referenced sensorgrams were then fitted using a 1:1 binding interaction model using the manufactures software package to extract kinetic- and affinity data. Active compounds have been defined by creating a detectable binding signal at the highest compound concentration (10 mM) of 3 RUs. Kinetic- and affinity data on active compounds are only provided for those compounds where the binding signal at the highest compound concentration (10 mM) is 50% of the theoretical maximum binding signal for a 1:1 binding interaction (R.sub.max, typically between 15-20 RUs) in order to enable a proper fitting of the data.

    Assay 3PCSK9 LDL-C Uptake Assay

    [1683] This assay measures for PCSK9 antagonist activity based on a test compound's capacity to restore LDL-C-uptake in HepG2 cells. The assay is based on exogenous PCSK9 and LDL-C complexed with a pH-sensitive dye. Outside the cells, at neutral pH, the pHrodo Red-LDL is dimly fluorescent but upon LDLR mediated endocytosis it fluoresces brightly. PCSK9 traffics the LDLR to intracellular degradation and reduces uptake of LDL-C. Inhibition of PCSK9 reduces LDLR degradation and the increased LDL-C uptake is quantified by fluorescence microscopy.

    Preparation of Assay Reagents

    [1684] Cell medium: MEM supplemented with 10% FBS, 1?NEAA and Sodium Pyruvate [1685] Assay medium: OptiMem supplemented with penicillin/streptomycin [1686] Cells: HepG2 (ATCC #HB-8065)

    TABLE-US-00016 PCSK9:Sequence: MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEE LVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLP GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLER ITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRV MVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRD DACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD LFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMML SAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNL VAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAIARCAPD EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGV YAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPG TSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVTAVAICCR SRHLAQASQELQENLYFQGHHHHHH
    Step by step protocol for running the assay:

    Day 1

    [1687] 1. Cryopreserved HepG2 cells were thawed in assay medium and centrifuged for 5 min at 250 g. Supernatant was discarded and the cell pellet resuspended in cell medium and counted with a Nucleocounter. Cells were again centrifuged 5 min at 250 g and the pellet was resuspended to 500000 cells/mL in assay medium. [1688] 2. 20 ?L of above cell mix was dispensed into black ?clear TC treated 384 well plates with Multidrop Combi and left at room temperature for 20 minutes. [1689] 3. Plates were incubated at 37? C., 5% CO.sub.2 for 24 h

    Day 2

    [1690] 1. Test compounds were prepared in concentration response in DMSO with a half-log dilution factor in DMSO in Echo 384 LDV plates starting at 10 mM. [1691] 2. 30 nL of above test compounds were dispensed with Echo 655 to cells for a top concentration of 10 ?M [1692] 3. 10 ?L PCSK9 in assay medium was dispensed to cells with Multidrop Combi for 125 nM final concentration in the wells. [1693] 4. Plates were incubated at 37? C., 5% CO.sub.2 for 24 h

    Day 3

    [1694] 1. 10 ?L pHrodo Red-LDL in assay medium was dispensed to cells with Multidrop Combi for 6 ag/mL [1695] 2. Plates were incubated at 37? C., 5% CO.sub.2 and imaged with the Incucyte S3 after 4 h and 24 h

    [1696] Image data was processed using Incucyte 2021, a software to identify cells and red fluorescent intensity. Screener was used to further process data. Data was normalized as % effect of the signal between median values of the on-plate controls of DMSO and 100 nM Evolocumab according to the formula % effect=?100*(x?DMSO)/(Evolocumab?DMSO) where x equals the measured signal. Concentration response data of the normalized values were fitted using a four-parameter logistic fit.

    Assay 4In Vivo Assessment of Compound Effects on Plasma LDL-C Levels

    [1697] A liver-specific human PCSK9 knock-in mouse model (hPCSK9-KI) was generated by expressing human PCSK9 under the control of a mouse albumin promoter/enhancer in C.sub.5-7BL/6N mice as previously described in Carreras 2019. For all in vivo studies, heterozygous male hPCSK9-KI mice and their wildtype littermates were housed individually, and heterozygous female hPCSK9-KI mice were house in groups of 4-6 mice per cage. All animals had free access to enrichment and were housed in a temperature-controlled room (22? C.) with a 12:12-h light/dark cycle. They were fed a chow diet and water ad libitum.

    [1698] For in vivo assessment of test compound activity, mice were randomised into experimental groups of for example 8 mice per group. Mice were ? 12 weeks of age at the time of study start. On day ?1, blood samples were drawn from the tail vein and baseline levels of plasma LDL-C were assessed using an enzymatic method. Baseline plasma levels of human PCSK9 were assessed by ELISA. Starting on day 0, test compounds were dosed by oral gavage at for examplel5 mg/kg BID for up to 21 days. Blood samples were drawn from the tail vein and plasma levels of LDL-C and human PCSK9 were assessed using the afore mentioned methods.

    Assay 5hERG Assay (Human Ether-a-go-go-Related Gene)

    [1699] This assay (human Ether-d-go-go-Related Gene) measures activity of the compounds at the potassium ion channel hERG (human Ether-d-go-go-Related Gene).

    [1700] Experiments were performed on the SyncroPatch 384PE high throughput patch clamp platform at room temperature and medium resistance chips with 4 patch holes per site. Chinese hamster ovary K1 (CHO) cell lines over-expressing the ion channel of choice (hERG) were used in assay-ready format and kept in liquid nitrogen or were used from live culture. Cells were either thawed and diluted in HBSS or were detached from flasks and resuspended in HBSS. HBSS comprised 140 mM NaCl, 4 mM KCl, 10 mM HEPES and 5 mM Glucose (pH7.4). The internal patch clamp solution was KF 120 mM, KCl 20 mM, HEPES 10 mM, EGTA 10 mM, and 25 PM Escin (pH 7.2). After the sealing process was complete, the external solution was exchanged for external patch clamp solution comprising NaCl 80 mM, KCl 4 mM, HEPES 10 mM, CaCl.sub.2 2 mM, MgCl.sub.2 1 mM, glucose 5 mM, and NMDG 60 mM (pH 7.4). All solutions were stored at room temperature, except Escin, which was stored at 4? C. All test compounds were dispensed in greiner-bio 384 well plates and tested in a 6 point cumulative assay (final DMSO concentration 0.33%). Only wells that passed previously agreed acceptance criteria for this platform were used in this analysis (30 MegaOhm seal resistance, Z prime >0.4 and current size >0.2 nA).

    High Concentration hERG

    [1701] Experiments were performed on the QPatchII high throughput patch clamp platform at room temperature using single holes QChips. Chinese hamster ovary K1 (CHO) cell lines over-expressing the ion channel of choice (hERG) were used from live culture. All solutions were stored at 4? C. or ?20? C. All compounds were dispensed as 10 or 50 mM DMSO stocks, in 96 well plates and diluted to a format that allowed testing in a 6 point cumulative assay (final DMSO concentration 2% or 0.4% DMSO). Only wells that passed previously agreed acceptance criteria for this platform were used in this analysis (500 MegaOhm seal resistance and current size >0.2 nA, with positive controls including Verapamil and DMSO being consistent).

    Assay 6GSK3? Assay (ThermoFisher assay)

    [1702] This assay measures the activity of the compounds at GSK33 (Glycogen synthase kinase-3 beta).

    [1703] The test compounds were screened in 1% DMSO (final) in the well. For 10 point titrations, 3-fold serial dilutions are conducted from the starting concentration of 10 PM.

    Assay Protocol

    [1704] Bar-coded Corning, low volume NBS, black 384-well plate [1705] 1. 2.5 ?L4? Test Compound or 100 nL 100? plus 2.4 ?L kinase buffer [1706] 2. 5 ?L2? Peptide/Kinase Mixture [1707] 3. 2.5 ?L4?ATP Solution [1708] 4. 30-second plate shake [1709] 5. 60-minute Kinase Reaction incubation at room temperature [1710] 6. 5 ?LDevelopment Reagent Solution [1711] 7. 30-second plate shake [1712] 8. 60-minute Development Reaction incubation at room temperature [1713] 9. Read on fluorescence plate reader and analyse the data

    [1714] In step 2, the 2?GSK3? (GSK3 beta)/Ser/Thr (Glycogen synthase kinase-3 beta/Serine/Threonine) 09 mixture is prepared in 50 mM HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid) pH 7.5, 0.01% BRIJ-35, 10 mM MgCl.sub.2, 1 mM EGTA (egtazic acid). The final 10 ?L Kinase Reaction consists of 0.22-0.92 ng GSK3? (GSK3 beta) and 2 PM Ser/Thr 09 in 50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgCl.sub.2, 1 mM EGTA.

    [1715] In step 3 the ATP Solution is diluted to a 4? working concentration in Kinase Buffer (50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgCl.sub.2, 1 mM EGTA).

    [1716] In Step 6 the Development Reagent is diluted 1:512 in Development Buffer (10? Novel PKC Lipid Mix: 2 mg/mL Phosphatidyl Serine, 0.2 mg/mL DAG in 20 mM HEPES, pH 7.4, 0.3% CHAPS).

    Graphing Software

    [1717] SelectScreen? Kinase Profiling Service uses XLfit from IDBS. The dose response curve is curve fit to model number 205 (sigmoidal dose-response model). If the bottom of the curve does not fit between ?20% & 20% inhibition, it is set to 0% inhibition. If the top of the curve does not fit between 70% and 130% inhibition, it is set to 100% inhibition.

    TABLE-US-00017 TABLE 10 Activity results in Assays 1, 2, 5 and 6 for compounds 1-80 Assay 6 Assay 5 (GSK3? Assay 1 Assay 2 (hERG Hu FRET-Z- (PCSK9 (PCSK9 CHO if Lyte Cr) Hu Bind BIAcore EPh CR- GMean IC.sub.50 TRf) DBA Cr) Syncro) (?M) GMean GMean GMean IC.sub.50 ATP Conc: 10 Example IC.sub.50 (nM) Kd (nM) (?M) (?M) 10 797 >40.0 >10.0 50 8.0 9.8 >40.0 >10.0 51 1.8 0.9 10.8 >10.0 52 2.3 0.7 39.9 >10.0 53 70 3.4 >10.0 54 33 4.3 >10.0 55 1.0 0.4 30.3 1.6 56 9.0 7.4 34.9 >10.0 57 11 7.5 >40.0 >10.0 58 1.6 2.2 >40.0 >10.0 59 45 >40.0 >10.0 60 9.1 21.0 >10.0 61 184 5.6 >10.0 62 6.5 4.3 36.3 >10.0 63 1.2 1.4 >40.0 >10.0 64 1.5 0.4 >40.0 0.385 65 11.8 5.8 38.8 0.014 66 1.7 1.5 >40.0 >10.0 67 16 17 >40.0 2.1 68 168 >40.0 >10.0 69 20 12 >40.0 >10.0 70 19 21 >40.0 >10.0 71 46 63 >40.0 >10.0 72 205 170 >40.0 >10.0 73 75 48 >40.0 >10.0 74 85 80 >40.0 8.3 75 33 16 >40.0 >10.0 76 485 125 >40.0 >10.0

    TABLE-US-00018 TABLE 11 Activity results in Assays 1, 2, 5 and 6 for compounds 112-138 Assay 6 Assay 5 (GSK3? Assay 1 Assay 2 (hERG Hu FRET-Z- (PCSK9 (PCSK9 CHO if Lyte Cr) Hu Bind BIAcore EPh CR- GMean IC.sub.50 TRf) DBA Cr) Syncro) (?M) GMean GMean GMean IC.sub.50 ATP Conc: 10 Example IC.sub.50 (nM) Kd (nM) (?M) (?M) 112 4.7 3.9 >40.1 6.4 113 41 >40.0 >10.0 114 7.6 5.3 18.6 >10.0 115 17 >40.0 >10.0 116 0.7 0.3 12.0 >10.0 117 1.0 0.9 6.3 >10.0 118 7.4 8.5 >40.0 >10.0 119 73 >40.0 >10.0 120 143 >40.1 >10.0 121 1.0 1.6 >40.0 5.05 122 1.4 >40.1 6.17 123 1.4 >40.1 8.84 124 1.0 >40.1 1.07 125 2.7 >40.1 >10.0 126 744 954 >40.0 >10.0 127 193 248 >40.0 >10.0 128 20 30 >40.0 >10.0 129 1.6 1.3 >40.0 4.85 130 14 >40.1 5.70 131 2.7 2.4 >72.6 >10.0 132 2.3 1.5 >40.0 2.06 133 17 17 >40.0 0.032 134 8.4 9.1 >40.0 0.439 135 2.8 3.9 >40.0 >10.0 136 3.0 >40.1 >10.0 137 10 >40.1 3.52 138 4.0 >40.1 >10.0

    TABLE-US-00019 TABLE 12 Activity results in Assay 3 Assay 3 LDL uptake Example potency (?M) 50 0.3 51 0.1 52 0.1 55 0.1 56 0.3 57 0.5 58 0.1 62 0.3 63 0.1 64 0.2 65 0.5 66 0.1 67 0.6 69 0.2 70 0.2 75 0.7 112 0.2 114 0.3 116 0.1 117 0.3 118 0.5 121 0.1 122 0.1 123 0.1 124 0.1 125 0.1 128 0.8 129 0.1 130 0.2 131 0.1 132 0.1 133 0.4 134 0.5 135 0.1 136 0.2 137 0.7 138 0.2

    TABLE-US-00020 TABLE 13 Activity results in Assays 1, 2, 3, 5 and 6 for compounds 151-314 Assay 6 Assay 5 (GSK3? Assay 1 Assay 2 (hERG Hu FRET-Z- (PCSK9 (PCSK9 CHO if Lyte Cr) Assay 3 Hu Bind BIAcore EPh CR- GMean IC.sub.50 LDL TRf) DBA Cr) Syncro) (?M) uptake Exam- GMean GMean GMean IC.sub.50 ATP Conc: 10 potency ple IC.sub.50 (nM) Kd (nM) (?M) (?M) (?M) 151 2254 >40.1 >10.0 152 244 >40.1 >10.0 153 3.3 >40.1 >10.0 0.1 154 14 >40.1 3.9 0.2 155 2.7 >40.1 >10.0 0.1 156 14 >40.1 >10.0 0.1 157 2.1 >40.1 7.78 0.1 158 7.6 >40.1 >10.0 0.2 159 4.1 >40.1 >10.0 0.1 160 6.9 >40.1 >10.0 0.2 161 3.8 >40.1 >10.0 0.1 165 1.3 25.5 5.1 0.1 166 7.2 38.2 2.2 0.3 167 258 >40.1 >10.0 168 16 3.1 >10.0 169 27 >40.1 0.31 173 4.2 >40.1 1.95 0.1 180 6.0 >40.1 >10.0 0.3 182 9.4 >40.1 >10.0 0.6 183 30 >40.1 >10.0 185 13 >40.1 2.42 0.2 187 2.1 3.7 >40.1 3.78 0.1 197 2.5 2.3 >40.1 >10.0 0.1 198 2.9 3.8 >40.1 >10.0 0.1 199 2.0 >40.1 >10.0 0.1 200 2.5 >40.1 >10.0 0.1 201 8.6 >40.1 2.38 0.2 202 3.7 >40.1 7.66 0.1 208 6.5 >40.1 1.71 0.3 210 0.9 0.6 >40.1 >10.0 0.1 211 1.4 16.5 >10.0 0.1 212 1.8 1.7 >40.1 >10.0 0.1 213 1.6 >40.1 >10.0 0.2 214 3.4 >40.1 >10.0 0.7 220 1.7 >200 >10.0 0.2 221 1.6 1.7 >40.1 >10.0 0.3 222 8.3 >40.1 >10.0 247 75 6.6 >10.0 248 13 >40.1 >10.0 249 16 >40.1 >10.0 250 108 >40.1 >10.0 254 330 >40.1 6.14 255 78 >40.1 5.33 256 119 >40.1 1.68 257 62 >40.1 2.81 258 15 26.1 0.237 260 101 >40.0 1.32 277 4.9 >40.1 9.56 281 2.5 >40.1 >10.0 0.3 304 96 >40.1 >10.0 305 91 3.2 >10.0 306 302 4.5 >10.0 307 1665 23.3 >10.0 308 51 12.0 >10.0 309 534 11.4 >10.0 310 22 19 35.0 >10.0 311 5.5 6.9 7.6 >10.0 312 37 4.2 >10.0 313 16 >40.1 >10.0 314 110 25.7 >10.0 315 1287 >40.1 >10.0 316 7426 >40.0 317 4430 >40.0 >0.8 318 284 >40.0 319 705 >40.0 320 559 >40.0 321 297 >40.0

    [1718] The features disclosed in the foregoing description, or in the following claims, or in the accompanying drawings, expressed in their specific forms or in terms of a means for performing the disclosed function, or a method or process for obtaining the disclosed results, as appropriate, may, separately, or in any combination of such features, be utilised for realising the disclosure in diverse forms thereof.

    [1719] While the disclosure has been described in conjunction with the exemplary embodiments described above, many equivalent modifications and variations will be apparent to those skilled in the art when given this disclosure. Accordingly, the exemplary embodiments set forth above are considered to be illustrative and not limiting. Various changes to the described embodiments may be made without departing from the spirit and scope of the disclosure.

    [1720] For the avoidance of any doubt, any theoretical explanations provided herein are provided for the purposes of improving the understanding of a reader. The inventors do not wish to be bound by any of these theoretical explanations.

    [1721] Any section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

    [1722] Throughout this specification, including the claims which follow, unless the context requires otherwise, the word comprise and include, and variations such as comprises, comprising, and including will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.

    [1723] It must be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from about one particular value, and/or to about another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by the use of the antecedent about, it will be understood that the particular value forms another embodiment. The term about in relation to a numerical value is optional and means for example +/?10%.

    REFERENCES

    [1724] A number of publications are cited above in order to more fully describe and disclose the compound of formula (1) and the state of the art to which it pertains. Full citations for these references are provided below. The entirety of each of these references is incorporated herein.

    TABLE-US-00021 Full Reference DOI Elbitar 2016 Elbitar et al., Expert Opin 10.1080/13543776.2016.1206080 Therapeutic Patents 2016 26: 1377- 1392. Abifadel 2003 Abifadel, et al. Nat. Genet. 2003 10.1038/ng1161 34: 154-6. Abifadel 2010 Abifadel, et al. Expert Opin. Ther. 10.1517/13543776.2010.518615 Pat. 2010 20: 1547-71. Maxwell 2003 Maxwell, et al. J. Lipid Res. 2003 10.1194/jlr.M300203-JLR200 44: 2109-19. Persson 2009 Persson et al. Endocrinology 2009 10.1210/en.2008-1281 150: 1140-6. Langhi 2008 Langhi et al. FEBS Lett. 2008 10.1016/j.febslet.2008.02.038 582: 949-55. Robinson Robinson et al., Artherosclerosis 10.1016/j.atherosclerosis.2015.10.023 2015 2015 243: 593-597. Duan 2012 W. Duan et al., ChemMedChem 10.1002/cmdc.201200145 2012, 7, 1276-1285. Carreras Carreras, A., et al. (2019). In vivo 10.1186/s12915-018-0624-2 2019 genome and base editing of a human PCSK9 knock-in hypercholesterolemic mouse model. BMC biology 17, 4. Wuts 2014 P. G. M. Wuts, Greene's Protective ISBN: 978-1118057483 Groups in Organic Synthesis 5th ed., J. Wiley & Sons, 2014

    [1725] For standard molecular biology techniques, see Sambrook, J., Russel, D. W. Molecular Cloning, A Laboratory Manual. 3 ed. 2001, Cold Spring Harbor, New York: Cold Spring Harbor Laboratory Press.

    Numbered Statements

    [1726] 1. A compound of Formula (I)


    A-B-C(I) [1727] or a pharmaceutically acceptable salt, tautomeric forms or stereoisomers thereof, wherein A is of the following:

    ##STR00773## [1728] wherein the wavy line indicates the point of attachment to B; [1729] X.sup.1 is N; [1730] R.sup.A2 is selected from the group consisting of: [1731] (i) H; [1732] (ii) halo; [1733] (iii) CN; [1734] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [1735] (v) C.sub.1-6 alkoxy, optionally substituted by OH, alkyl amido, or one or more halo groups; [1736] (vi) C.sub.1-6 acyl amido (wherein the acyl is optionally substituted by H or methyl); [1737] (vii) C.sub.1-6 thioalkyl; [1738] (viii) C.sub.1-6 alkyl ester; [1739] (ix) C.sub.1-6 alkyl acyl; [1740] (x) C.sub.4-5 heterocyclyl; [1741] (xi) C.sub.5 heteroaryl; [1742] (xii) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, OH, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl or C.sub.1-3 alkyl wherein the C.sub.1-3 alkyl is optionally substituted with one or more halo or OH groups; and [1743] (xiii) OH; and [1744] (xiv) C.sub.1-6 alkylamino; [1745] R.sup.A3 is selected from the group consisting of: [1746] (i) H; [1747] (ii) halo; [1748] (iii) CN; [1749] (iv) C.sub.1-6hydrocarbon optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl, C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkyl ester, C.sub.1-6 alkylamino, C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkyl acylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [1750] (v) OH; [1751] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups; [1752] (vii) C.sub.1-6 acyloxy; [1753] (viii) C.sub.4 heterocycyl; [1754] (ix) NH.sub.2; [1755] (x) C.sub.1-6 alkylamino, optionally substituted by CN, OH or C.sub.4 heterocyclyl; [1756] (xi) C.sub.1-6 dialkylamino, optionally substituted by NH.sub.2; [1757] (xii) C.sub.1-6 acylamido (where acyl substituent is H or Me); [1758] (xiii) carbaimidoyl or methyl-carbaimidoyl; [1759] (xiv) carboxyamino; [1760] (xv) C.sub.1-6 thioalkyl, optionally substituted by OH or NH.sub.2; [1761] (xvi) C.sub.1-6 alkyl sulfinyl; [1762] (xvii) C.sub.1-6 alkyl sulfonyl, optionally substituted by one or more halo groups; [1763] (xviii) C.sub.1-6 sulfonimodyl; [1764] (xix) C.sub.1-6 alkyl phosphinyl; [1765] (xx) carboxy; [1766] (xxi) C(?O)NH.sub.2 [1767] (xxii) C.sub.1-6 alkyl ester; [1768] (xxiii) C.sub.1-6 alkyl acyl, optionally substituted by one or more halo groups; [1769] (xxiv) C.sub.1-6 alkyl amido; [1770] or wherein R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form: [1771] (i) an optionally substituted C.sub.5-7 heterocycle ring; [1772] (ii) an optionally substituted C.sub.5-7 heteroaromatic ring; [1773] (iii) an optionally substituted C.sub.6 carboaromatic ring; [1774] (iv) an optionally substituted C.sub.5-7 carbocyclic ring [1775] wherein the optional substituents are selected from C.sub.1-6 alkyl, halo, C.sub.1-6 alkoxy, NH.sub.2, C.sub.1-6 alkylamino, OH, and CN; [1776] wherein B is of formula (B-1) or (B-2)

    ##STR00774## [1777] wherein the wavy line indicates the point of attachment to A and C; [1778] R.sup.B1 is H, OH, ?CHCH.sub.2OH, OC.sub.1-4 alkyl or C.sub.1-4 alkyl, wherein the C.sub.1-4alkyl is optionally substituted by OH or OMe;

    ##STR00775## [1779] wherein the wavy line indicates the point of attachment to A and C; [1780] R.sup.B2 is C.sub.1-2 alkyl-OH, CH.sub.2CONHMe or C.sub.1-3 alkyl; [1781] wherein C is selected from the group consisting of C.sub.6-10 carboaryl, C.sub.5-6 heteroaryl and C.sub.5-10 heterocyclyl, which groups are optionally substituted by: [1782] (i) C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl C.sub.4-10 heterocyclyl, or C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12heterocyclyl or a spiro C.sub.6-12carbocyclyl, [1783] which are themselves optionally substituted by one or more of the following groups: [1784] a) one or two ?O groups; [1785] b) one or more halo groups; [1786] c) CN, NH.sub.2, OH; [1787] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [1788] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [1789] f) C.sub.1-6 alkylester; [1790] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [1791] h) C.sub.5-6 heteroaryl; [1792] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [1793] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [1794] l) P(?O)Me.sub.2; [1795] m) carboxy or CH.sub.2-carboxy; [1796] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl; [1797] (ii) one or more groups selected from carboxy, CN, halo, nitro, C.sub.1-6 alkyl, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkylacyl, C.sub.1-6 alkyl amido, di-C.sub.1-6 alkyl amido, C.sub.1-6 alkyl sulfonamido, and di-C.sub.1-6alkyl sulfonamido.

    [1798] 2. The compound of statement 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A2 is selected from the group consisting of: [1799] (i) H; [1800] (ii) halo; [1801] (iii) CN; [1802] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6 alkoxy or one or more halo groups; [1803] (v) C.sub.1-6 alkoxy, optionally substituted by OH, alkyl amido, or one or more halo groups; [1804] (vi) C.sub.1-6 acyl amido (wherein the acyl is optionally substituted by H or methyl); [1805] (vii) C.sub.1-6 thioalkyl; [1806] (viii) C.sub.1-6 alkyl ester; [1807] (ix) C.sub.1-6 alkyl acyl; [1808] (x) C.sub.4-5 heterocyclyl; [1809] (xi) C.sub.5 heteroaryl; [1810] (xii) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl or C.sub.1-3 alkyl wherein the C.sub.1-3 alkyl is optionally substituted with one or more halo or OH groups; and [1811] (xiii) OH.

    [1812] 3. The compound of statement 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A2 is selected from the group consisting of: [1813] (i) H; [1814] (ii) halo; [1815] (iii) CN; [1816] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6acyl, C.sub.1-6alkoxy or one or more halo groups; [1817] (v) OH; [1818] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, C.sub.1-6 alkyl amido, or one or more halo groups; [1819] (vii) C.sub.1-6 alkyl ester; [1820] (viii) C.sub.1-6 alkyl acyl; [1821] (ix) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; and [1822] (x) C.sub.1-6 alkylamino. [1823] 4. The compound of any one of statements 1-3 or a pharmaceutically acceptable salt thereof, wherein R.sup.A2 is selected from the group consisting of: [1824] (i) H; [1825] (ii) halo; [1826] (iii) CN; [1827] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 acyl, C.sub.1-6alkoxy or one or more halo groups; [1828] (v) OH; [1829] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, C.sub.1-6 alkyl amido, or one or more halo groups; [1830] (vii) C.sub.1-6 alkyl ester; [1831] (viii) C.sub.1-6 alkyl acyl; and [1832] (ix) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, CN, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups.

    [1833] 5. The compound of any of statements 1, 3, or 4 or a pharmaceutically acceptable salt thereof, wherein R.sup.A is selected from the group consisting of: [1834] (i) H; [1835] (ii) halo; [1836] (iii) C.sub.1-6 alkyl ester; [1837] (iv) C.sub.1-6 hydrocarbon; [1838] (v) C.sub.1-6 alkyl amido optionally substituted by C.sub.1-3 alkyl amido, C.sub.2-3 alkynyl, C.sub.4-6 heterocyclyl, or C.sub.1-3 alkyl which alkyl is optionally substituted with one or more halo or OH groups; [1839] (vi) C.sub.1-6 thioalkyl; [1840] (vii) C.sub.1-6 alkyl acyl; [1841] (viii) C.sub.5 heteroaryl; or [1842] (ix) C.sub.1-6 alkylamino.

    [1843] 6. The compound of any one of statements 1 to 5 or a pharmaceutically acceptable salt thereof, wherein R.sup.A is selected from the group consisting of CN, methyl, Cl, C(?O)CH.sub.3, C(?O)OCH.sub.2CH.sub.3, cyclopropyl, C(?O)NHCH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2CHCH, C(?O)NH-oxetane, C(?O)NHCH.sub.2CHF.sub.2, C(?O)NHCH.sub.2CH.sub.2OH, C(?O)NHCH.sub.2CH.sub.3, C(?O)NH.sub.2, C(?O)NHCH.sub.3, C(?O)N(CH.sub.3).sub.2, OCHF.sub.2, H, OMe, and OCF.sub.3.

    [1844] 7. The compound of any one of statement 1 to 6 or a pharmaceutically acceptable salt thereof, wherein R.sup.A is selected from the group consisting of C(?O)OCH.sub.2CH.sub.3, cyclopropyl, methyl, H, Cl, C(?O)CH.sub.3, S-ethyl, pyrazole, N(CH.sub.3).sub.2, C(?O)NH(CH.sub.2C(?O)NH.sub.2, C(?O)NHCH.sub.2C?CH, C(?O)NH(oxetane), C(?O)NH(CH.sub.2CHF.sub.2), C(?O)NH(CH.sub.2CH.sub.3), C(?O)NH.sub.2, C(?O)NH(CH.sub.3), C(?O)N(CH.sub.3).sub.2, C(?O)N(CH.sub.3)(CH.sub.2CH.sub.2OH), C(?O)N(CH.sub.3)(CH.sub.2C?CH or C(?O)NH(CH.sub.2OCH.sub.2OH).

    [1845] 8. The compound of any one of statements 1 to 7 or a pharmaceutically acceptable salt thereof, wherein R.sup.A is selected from the group consisting of OCHF.sub.2, methyl, and cyclopropyl.

    [1846] 9. The compound of any one of statements 1 to 8 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 is selected from the group consisting of: [1847] (i) H; [1848] (ii) halo; [1849] (iii) CN; [1850] (iv) C.sub.1-6 hydrocarbon, optionally substituted by OH, CN, C.sub.1-6 thioalkyl, C.sub.1-6 alkoxy, C.sub.1-6 alkyl acyl C.sub.1-6 acyloxy, carboxy, C.sub.1-6 alkylester, C.sub.1-6 alkylamino; C(?O)NH.sub.2, C.sub.1-6 alkyl amido, C.sub.1-6 alkylacylamido, C.sub.1-6 alkyl sulfinyl, C.sub.1-6 alkyl sulfonyl or one or more halo groups; [1851] (v) OH; and [1852] (vi) C.sub.1-6 alkoxy, optionally substituted by OH, NH.sub.2, C.sub.4 heterocyclyl or one or more halo groups.

    [1853] 10. The compound of any one of statements 1 to 9 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 is selected from the group consisting of H, CF.sub.3, CN, C.sub.1-2 alkyl, NH.sub.2 and halo.

    [1854] 11. The compound of any one of statements 1 to 10 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 is selected from the group consisting of H, CN and methyl.

    [1855] 12. The compound of any one of statements 1 to 9 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 is selected from the group consisting of H, methyl and OH.

    [1856] 13. The compound of statement 1 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form an optionally substituted C carboaromatic ring or C heteroaromatic ring, wherein the optional substituents are selected from methyl, NH.sub.2, Cl, F and OMe.

    [1857] 14. The compound of statement 13 or a pharmaceutically acceptable salt thereof, wherein R.sup.A2 and R.sup.A3 together with the carbon atoms to which they are bound form: [1858] (i) an optionally substituted C.sub.6 heteroaryl ring; wherein the optional substituent is NH.sub.2 [1859] (ii) an optionally substituted C.sub.6 carboaryl ring, wherein the optional substituent is f, OMe, Cl; or [1860] (iii) an optionally substituted C.sub.5 heteroaryl or C.sub.5 heterocyclic ring wherein the optional substituents are methyl.

    [1861] 15. The compound of statement 13 or a pharmaceutically acceptable salt thereof, wherein R.sup.A3 and R.sup.A2 together with the carbon atoms to which they are bound form: an unsubstituted 2-pyrazole; a 2-pyrrole substituted by methyl; a pyridine optionally substituted by NH.sub.2; or a phenyl optionally substituted by Cl, F or OMe.

    [1862] 16. The compound of any one of statements 1 to 15 or a pharmaceutically acceptable salt thereof, wherein B is of formula (B-1)

    ##STR00776## [1863] wherein the wavy line indicates the point o attachment to A and C; [1864] wherein R.sup.B1 is selected from the group consisting of H, OH, OMe, O-Ethyl, CH.sub.2OH, CH.sub.2CH.sub.2OH and ?CHCH.sub.2OH.

    [1865] 17. The compound of statement 16 or a pharmaceutically acceptable salt thereof, wherein R.sup.B1 is selected from the group consisting of CH.sub.2OH, CH.sub.2CH.sub.2OH and ?CHCH.sub.2OH.

    [1866] 18. The compound of any one of statements 1 to 16 or a pharmaceutically acceptable salt thereof, wherein B is of the following formula (B-1a):

    ##STR00777##

    [1867] 19. The compound of any one of statements 1 to 16 or claim 18 or a pharmaceutically acceptable salt thereof, wherein B is of the following formula (B-1b):

    ##STR00778##

    [1868] 20. The compound of any one of statements 1 to 15 or a pharmaceutically acceptable salt thereof, wherein B is of the following formula:

    ##STR00779##

    [1869] 21. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is an optionally substituted C.sub.5-6 heteroaryl.

    [1870] 22. The compound of any one of statements 1 to 21 or a pharmaceutically acceptable salt thereof, wherein C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl, wherein the optional substituents are selected from C.sub.6-10 carboaryl, C.sub.4-10 carbocyclyl, C.sub.5-10 heteroaryl, C.sub.5-10 heterocyclyl, C.sub.5-10 bridged heterocyclyl, spiro C.sub.6-12 heterocyclyl or a spiro C.sub.6-12 carbocyclyl, which are themselves optionally substituted by one or more of the following groups: [1871] a) one or two ?O groups; [1872] b) one or more halo groups; [1873] c) CN, NH.sub.2 or OH; [1874] d) one or more C.sub.1-6 alkyl groups including branched and cyclic and with an optional substituent selected from OH or one or more halo groups; [1875] e) C.sub.1-6 alkoxy with optional substituents of one or more halo groups; [1876] f) C.sub.1-6alkylester; [1877] g) C.sub.5-6 heterocyclyl with an optional methyl, OH or ?O substituent; [1878] h) C.sub.5-6 heteroaryl; [1879] i) C.sub.4-10 carbocyclyl with an optional methyl or ?O substituent; [1880] j) C.sub.6-10 carboaryl with optional substituents of one or more halo groups; [1881] l) P(?O)Me.sub.2; [1882] m) carboxy or CH.sub.2-carboxy; and/or [1883] n) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [1884] 23. The compound of any one of statements 1 to 22 or a pharmaceutically acceptable salt thereof, wherein C is an optionally substituted pyridinyl, pyrazinyl or pyrimidinyl wherein the optional substituents are selected from C.sub.6 heteroaryl or C.sub.6 heterocyclyl, which are themselves optionally substituted by one or more groups selected from the following: [1885] i) one or two ?O groups; [1886] ii) methyl; [1887] iii) OMe; [1888] iv) Cl; [1889] v) CN; [1890] vi) CF.sub.3; [1891] vii) F; [1892] viii) pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; [1893] ix) OCF.sub.3; [1894] x) OCHF.sub.2.

    [1895] 24. The compound of any one of statements 1 to 22 or a pharmaceutically acceptable salt thereof, wherein C is substituted by C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl, or C.sub.5-10 heterocyclyl, which are themselves optionally substituted by: [1896] a) one or two ?O groups; [1897] b) one or more halo groups, CN or NH.sub.2; [1898] c) one or more C.sub.1-6 alkyl groups, C.sub.1-6 alkoxy, or C.sub.1-6alkylester, wherein each group is optionally substituted by one or more halo groups; [1899] d) C.sub.5-6 heterocyclyl or C.sub.5-6 heteroaryl with an optional methyl substituent; [1900] e) C.sub.6-10 carboaryl optionally substituted by one or more halo atoms; [1901] f) carboxy or CH.sub.2-carboxy; or [1902] g) tetrazolyl, CH.sub.2-tetrazolyl, 5-oxo-4H-1,2,4-oxadiazol-3-yl.

    [1903] 25. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is a C.sub.6-10 carboaryl, C.sub.5-6 heteroaryl and C.sub.5-10 heterocyclyl, wherein each group is substituted by methyl.

    [1904] 26. The compound of statement 25 or a pharmaceutically acceptable salt thereof, wherein the methyl group on C is at the para position.

    [1905] 27. The compound of any one of statements 1 to 24 or a pharmaceutically acceptable salt thereof, wherein C is an optionally substituted pyridinyl wherein the optional substituent is phenyl or pyridyl which are themselves optionally substituted by one or more groups selected from the following: [1906] a) one or more OMe groups; [1907] b) one or more F groups; [1908] c) CN; [1909] d) tetrazole; or [1910] e) carboxy.

    [1911] 28. The compound of any one of statements 1 to 22 or a pharmaceutically acceptable salt thereof, wherein C is an optionally substituted pyridinyl wherein the optional substituent is a C.sub.5 heteroaryl or Cs heterocyclyl which are themselves optionally substituted by one or more substituents selected from methyl and CN.

    [1912] 29. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-1):

    ##STR00780## [1913] wherein D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, each which are themselves optionally substituted by: [1914] i) one or two ?O groups; [1915] ii) one or two C.sub.1a alkyl groups which can be branched; [1916] iii) OMe; [1917] iv) piperazinyl, optionally substituted by methyl; [1918] v) C(?O)OH (carboxy); [1919] vi) Cl; [1920] vii) F; [1921] viii) phenyl, optionally substituted by one or more fluoro; [1922] ix) CN; [1923] x) CF.sub.3; [1924] xi) OCF.sub.3; [1925] xii) tetrazolyl, pyrazolyl, triazolyl each of which is optionally substituted by methyl; [1926] xiii) NH.sub.2; [1927] xiv) pyridinyl; [1928] xv) CH.sub.2OH; [1929] xvi) OH; [1930] xvii) P(?O)Me.sub.2; or [1931] xviii) OCHF.sub.2.

    [1932] 30. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-1):

    ##STR00781## [1933] wherein D is C.sub.6-10 carboaryl, C.sub.5-10 heteroaryl or C.sub.5-10 heterocyclyl, each which are themselves optionally substituted by: [1934] i) one or two ?O groups; [1935] ii) one or two C.sub.1-4 alkyl groups which can be branched; [1936] iii) OMe; [1937] iv) piperazinyl, optionally substituted by methyl; [1938] v) C(?O)OH (carboxy); [1939] vi) Cl; [1940] vii) F; [1941] viii) phenyl, optionally substituted by one or more fluoro; [1942] ix) CN; [1943] x) CF.sub.3; [1944] xi) OCF.sub.3; [1945] xii) tetrazolyl, pyrazolyl, triazolyl; [1946] xiii) NH.sub.2; [1947] xiv)(CH.sub.3).sub.2; [1948] xv) pyridinyl; [1949] xvi) CH.sub.2OH; [1950] xvii) OH; [1951] xviii) P(?O)Me.sub.2.

    [1952] 31. The compound of statements 29 or 30 or a pharmaceutically acceptable salt thereof, wherein D is an optionally substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position, wherein the optional substituents are selected from: [1953] i) methyl; [1954] ii) OMe; [1955] iii) piperazinyl substituted by methyl; [1956] iv) C(?O)OH (carboxy); [1957] v) Cl; [1958] vi) phenyl substituted by fluoro; [1959] vii) CN; [1960] viii) CF.sub.3; [1961] ix) OCF.sub.3; [1962] x) F; or [1963] xi) pyrazolyl, triazolyl or tetrazolyl each of which is optionally substituted by methyl.

    [1964] 32 The compound of statements 29 or 30 or a pharmaceutically acceptable salt thereof, wherein D is an optionally substituted 6 membered heteroaryl which contains 1 or 2 N atoms, one of which is bonded to (C-1), which is substituted by ?O at the ortho position, wherein the optional substituents are selected from: [1965] i) methyl; [1966] ii) OMe; [1967] iii) Cl; [1968] iv) F; [1969] v) CN; [1970] vi) CF.sub.3; [1971] vii) OCF.sub.3; [1972] viii) OCHF.sub.2; or [1973] ix) pyrazolyl, triazolyl or tetrazolyl each of which is optionally substituted by methyl.

    [1974] 33. The compound of any one of statements 29 to 32 or a pharmaceutically acceptable salt thereof, wherein D is of the formula (D-1):

    ##STR00782## [1975] wherein one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from [1976] i) C.sub.1-6 alkyl, optionally substituted by one or more halo groups; [1977] ii) C.sub.1-6 alkoxy, optionally substituted by one or more halo groups; [1978] iii) C.sub.5-6 heterocyclyl or C.sub.5-6 heteroaryl with an optional methyl substituent; [1979] iv) carboxy or CH.sub.2-carboxy; [1980] v)?O, halo, NH.sub.2 or CN; [1981] vi) phenyl, optionally substituted by one or more halo atoms; [1982] and the rest are H; or [1983] wherein R.sup.D3 and R.sup.D4 form an optionally substituted 6 membered carboaromatic, heterocycle or heteroaromatic ring, wherein the optional substituents are selected from OH, methyl, OMe, halo and C(?O)OH; [1984] or wherein R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are all H.

    [1985] 34. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein [1986] one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from: [1987] i) methyl; [1988] ii) OMe; [1989] iii) piperazinyl substituted by methyl; [1990] iv) C(?O)OH (carboxy); [1991] v) Cl; [1992] vi) phenyl substituted by fluoro; [1993] vii) CN; [1994] viii) CF.sub.3; [1995] ix) OCF.sub.3 [1996] x) F; [1997] xi) pyrazolyl, triazolyl or tetrazolyl; [1998] and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [1999] 35. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein [2000] one or two of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are selected from: [2001] i) methyl; [2002] ii) OMe; [2003] iii) Cl; [2004] iv) CN; [2005] v) CF.sub.3; [2006] vi) F; [2007] vii) pyrazolyl optionally substituted by methyl, triazolyl, tetrazolyl; [2008] viii) OCF.sub.3 [2009] ix) OCHF.sub.2 [2010] and the rest of R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [2011] 36. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein R.sup.D1, R.sup.D2, R.sup.D3 and R.sup.D4 are H.

    [2012] 37. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein R.sup.D3 is selected from the group consisting of: H; optionally substituted phenyl, wherein the optional substituent is halo, methyl, OMe, C(?O)OH, Cl, CN; or piperazinyl optionally substituted by methyl; or pyrazolyl, triazolyl, or tetrazolyl, and wherein R.sup.D1, R.sup.D2 and R.sup.D4 are all H.

    [2013] 38. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein R.sup.D3 is selected from H, CN, OMe, Cl, pyrazole optionally substituted by methyl, tetrazole, methyl, OCHF.sub.2, or triazole and wherein R.sup.D1, R.sup.D2 and R.sup.D4 are all H.

    [2014] 39. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein R.sup.D1 is selected from H, methyl, OMe, Cl, F, CF.sub.3, OCF.sub.3, and CN, and wherein R.sup.D2, R.sup.D3 and R.sup.D4 are all H.

    [2015] 40. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein R.sup.D1 is selected from H, OMe, Cl, CF.sub.3, OCF.sub.3, OCHF.sub.2, CN, F, pyrazole optionally substituted by methyl and triazole and R.sup.D2, R.sup.D3 and R.sup.D4 are all H.

    [2016] 41. The compound of statement 33 or a pharmaceutically acceptable salt thereof, wherein R.sup.D3 and R.sup.D4 form an unsubstituted benzene ring or an unsubstituted pyridine ring.

    [2017] 42. The compound of statements 29 or 30 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-1) and D is an optionally substituted phenyl or piperidyl, wherein there are one or two optional substituents selected from F, OMe and CN.

    [2018] 43. The compound of statements 29 or 30 or a pharmaceutically acceptable salt thereof, wherein D is of the formula (D-2):

    ##STR00783## [2019] wherein X.sup.D is NR.sup.D5a or CR.sup.D5aR.sup.D5b, [2020] R.sup.D5a is selected from H or methyl; [2021] either R.sup.D5b and R.sup.D6b are both H or together they are CH.sub.2; [2022] R.sup.D6a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH, wherein when R.sup.D6a is ?O, R.sup.D6b is absent; [2023] R.sup.D7a is selected from H, ?O, methyl, CH.sub.2OH or C(?O)OH; [2024] R.sup.D7b is H, wherein when R.sup.D7a is ?O, R.sup.D7b is absent; [2025] or wherein R.sup.D6a and R.sup.D7a together form a benzene ring or a C heteroaromatic ring which is optionally substituted by CN, P(?O)Me.sub.2 or carboxy and R.sup.D6b and R.sup.D7b are absent.

    [2026] 44. The compound of statement 43 or a pharmaceutically acceptable salt thereof, wherein: [2027] a) when R.sup.D6a and R.sup.D6b are H, R.sup.D7a is selected from ?O, carboxy or CH.sub.2OH and R.sup.D7b is H or when R.sup.D7a is ?O, R.sup.D7b is absent; [2028] b) when R.sup.D7a is H, R.sup.D7b is H, R.sup.D6a is ?O and R.sup.D6b is absent.

    [2029] 45. The compound of statement 43 or a pharmaceutically acceptable salt thereof, wherein [2030] R.sup.D6a and R.sup.D7a together form a benzene ring or a C.sub.6 heteroaromatic ring which is optionally substituted by CN, C(?O)OH or P(?O)Me.sub.2 and R.sup.D6b and R.sup.D7b are absent.

    [2031] 46. The compound of statement 43 or a pharmaceutically acceptable salt thereof, wherein [2032] R.sup.D6a and R.sup.D7a form an unsubstituted benzene ring or an unsubstituted pyridine ring and R.sup.D6b and R.sup.D7b are absent.

    [2033] 47. The compound of statements 29 or 30 or a pharmaceutically acceptable salt thereof, wherein D is selected from the following groups:

    TABLE-US-00022 Name Structure 2-oxo-1-pyridyl [00784]embedded image 3-methyl-2-oxo- 1-pyridyl 3-methoxy-2- oxo-1-pyridyl [00785]embedded image 5-methoxy-2- oxo-1- pyridyl [00786]embedded image 5-chloro-2-oxo- 1-pyridyl [00787]embedded image 2-oxo-1,8- naphthyridin-1-yl [00788]embedded image 2-oxo-1-quinolyl [00789]embedded image 3-methyl-2-oxo- benzimidazol-1-yl [00790]embedded image 3-methyl-2,4- dioxo- imidazolidin-1-yl [00791]embedded image 3-methyl-2,5- dioxo-imidazolidin- 1-yl [00792]embedded image 3-chloro-2-oxo- 1-pyridyl [00793]embedded image 3-cyano-2-oxo-1- pyridyl [00794]embedded image 5-cyano-2-oxo-1- pyridyl [00795]embedded image 3-fluoro-2- oxopyridin-1(2H)-yl 5-methyl-2-oxo- 1-pyridyl 5-carboxy-2-oxo-1- pyridyl 2-oxo-5-(1H- pyrazol-4-yl)-1- pyridyl 2-oxo-5-(1 H-triazol- 4-yl)-1-pyridyl 5-cyano-3- methyl-2-oxo- benzimidazol- 1-yl 5-carboxy-3- methyl-2-oxo- benzimidazol-1-yl 6-carboxy-3- methyl-2-oxo- benzimidazol-1- yl (6- dimethylphosphoryl- 3-methyl-2-oxo- benzimidazol-1-yl) 2-oxo-3H- benzimidazol-1- yl [00796]embedded image 2-oxo-1 H- imidazo[4,5- b]pyridin-3-yl [00797]embedded image 6-oxopyridazin- 1-yl [00798]embedded image 6-oxopyrimidin- 1-yl [00799]embedded image 1-methyl-2-oxo- 3-pyridyl [00800]embedded image 2-oxo-3- (trifluoromethyl)-1- pyridyl [00801]embedded image 2-oxo-3- (trifluoromethoxy)- 1-pyridyl [00802]embedded image 2-oxo-5-(1H- tetrazol-5-yl)-1- pyridyl [00803]embedded image

    [2034] 48. The compound of statements 29 or 30 or a pharmaceutically acceptable salt thereof, wherein D is selected from the following groups:

    ##STR00804## ##STR00805## ##STR00806## ##STR00807##

    [2035] 49. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-2):

    ##STR00808## [2036] wherein one of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from the group consisting of: methyl; OMe; piperazinyl optionally substituted by methyl; C(?O)OH (carboxy); Cl; F; pyrazolyl optionally substituted by methyl; triazolyl; tetrazole; optionally substituted phenyl (wherein the optional substituent is methyl or halo); CN; CF.sub.3; OCHF.sub.2, OCF.sub.3; and the rest of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or [2037] R.sup.C9 and R.sup.C10 form a benzene or 6 membered heteroaromatic ring, and R.sup.C7 and R.sup.C8 are both H; or wherein R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are all H.

    [2038] 50. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is of the formula (C-2):

    ##STR00809##

    [2039] wherein one of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are selected from the group consisting of: methyl; OMe; piperazinyl optionally substituted by methyl; C(?O)OH (carboxy); Cl; F; pyrazolyl; triazolyl; tetrazole; optionally substituted phenyl (wherein the optional substituent is methyl or halo); CN; CF.sub.3; OCF.sub.3; and the rest of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or R.sup.C9 and R.sup.C10 form a benzene or 6 membered heteroaromatic ring, and R.sup.C7 and R.sup.C8 are both H; or wherein R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are all H.

    [2040] 51. The compound of statements 49 or 50 or a pharmaceutically acceptable salt thereof, wherein: [2041] a) all of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or [2042] b) R.sup.C9 is selected from H, optionally substituted phenyl (wherein the optional substituent is F), methyl, OMe, C(?O)OH, Cl, F, pyrazolyl, triazolyl, tetrazolyl, CN and piperazinyl optionally substituted by methyl, and R.sup.C7, R.sup.C8 and R.sup.C10 are all H; or [2043] c) R.sup.C7 is selected from H, methyl, OMe, OCF.sub.3, CF.sub.3, Cl, F and CN and R.sup.C8, R.sup.C9 and R.sup.C10 are all H.

    [2044] 52. The compound of statement 51 or a pharmaceutically acceptable salt thereof, wherein: [2045] a) all of R.sup.C7, R.sup.C8, R.sup.C9 and R.sup.C10 are H; or [2046] b) R.sup.C9 is selected from H, CN, OMe, Cl, pyrazole optionally substituted by methyl, tetrazole, methyl, OCHF.sub.2, or triazole and R.sup.C7, R.sup.C8 and R.sup.C10 are all H; or [2047] c) R.sup.C7 is selected from H, OMe, Cl, CF.sub.3, OCF.sub.3, OCHF.sub.2, CN, F, triazole or pyrazole optionally substituted by methyl, and R.sup.C7, R.sup.C8 and R.sup.C10 are all H.

    [2048] 53. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is selected from the group consisting of:

    TABLE-US-00023 No. Structure 1 [00810]embedded image 2 [00811]embedded image 3 [00812]embedded image 4 [00813]embedded image 5 [00814]embedded image 6 [00815]embedded image 7 [00816]embedded image 8 [00817]embedded image 9 [00818]embedded image 10 [00819]embedded image 11 [00820]embedded image 12 [00821]embedded image 13 [00822]embedded image 14 [00823]embedded image 15 [00824]embedded image 16 [00825]embedded image 17 [00826]embedded image 18 [00827]embedded image 19 [00828]embedded image 20 [00829]embedded image 21 [00830]embedded image 22 [00831]embedded image 23 [00832]embedded image 24 [00833]embedded image 25 [00834]embedded image 26 [00835]embedded image 27 [00836]embedded image 28 [00837]embedded image 29 [00838]embedded image 30 [00839]embedded image 31 [00840]embedded image 32 [00841]embedded image 33 [00842]embedded image 34 [00843]embedded image 35 [00844]embedded image 36 [00845]embedded image 37 [00846]embedded image 38 [00847]embedded image 39 [00848]embedded image 40 [00849]embedded image 41 [00850]embedded image 42 [00851]embedded image 43 [00852]embedded image 44 [00853]embedded image 45 [00854]embedded image 46 [00855]embedded image 47 [00856]embedded image 48 [00857]embedded image

    [2049] 54. The compound of any one of statements 1 to 20 or a pharmaceutically acceptable salt thereof, wherein C is selected from the group consisting of:

    ##STR00858## ##STR00859## ##STR00860## ##STR00861## ##STR00862## ##STR00863## ##STR00864## ##STR00865## ##STR00866##

    [2050] 55. The compound of any of the preceding statements or a pharmaceutically acceptable salt thereof, wherein A-B-C is of the formula (I-A), (I-B), (I-Ba), (I-Bb), (I-C), (I-D), (I-E), (I-Ea) or (I-Eb):

    ##STR00867## [2051] wherein X.sup.1, R.sup.A2, R.sup.A3, C, D, R.sup.D1, R.sup.D2, R.sup.D3, R.sup.D4, R.sup.D1a, R.sup.D2a, R.sup.D3a, R.sup.D4a, X.sup.D, R.sup.D6a, R.sup.D6, R.sup.D7a and R.sup.D7b are as defined in any of the preceding claims.

    [2052] 56. The compound of Table 1, Table 2 or Table 3 or a pharmaceutically acceptable salt thereof.

    [2053] 57. The compound of any one of statements 1 to 56 or a pharmaceutically acceptable salt thereof, for use in therapy.

    [2054] 58. A pharmaceutical composition comprising the compound of any one of statements 1 to 56 or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable diluent, carrier or excipient.

    [2055] 59. The compound of any one of statements 1 to 56 or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition according to claim 52 for use in the treatment of a cardiovascular disease.

    [2056] 60. The compound for use according to statement 59 wherein the compound is administered simultaneously, separately or sequentially in combination with an additional active ingredient selected from the group consisting of: [2057] i) a statin; [2058] ii) a cholesterol absorption inhibitor; [2059] iii) a SGLT2 inhibitor; [2060] iv) a P2Y12 inhibitor; [2061] v) a citrate lyase inhibitor; and [2062] vi) anti-hypertensive drugs.

    [2063] 61. The compound use according to statement 59 or 60 when the cardiovascular disease is selected from dyslipidemia, hypercholesterolemia, hypertriglyceridemia, hyperlipidemia, hypoalphalipoproteinemia, metabolic syndrome, diabetic complications, atherosclerosis, stroke, vascular dimensia, chronic kidney disease, coronary heart disease, coronary artery disease, retinopathy, inflammation, thrombosis, peripheral vascular disease heart failure or congestive heart failure.

    [2064] 62. Use of a compound of any one of statements 1 to 56 or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition according to claim 52 in a method of medical treatment.

    [2065] 63. A method of medical treatment comprising administering to the patient the pharmaceutical composition of statement 58.

    [2066] 64. Use of a compound of any one of statements 1 to 56 in the manufacture of a medicament for use in therapy.

    [2067] 65. A method of treating PCSK9-mediated disease or disorder in a patient need thereof comprising administering to the patient a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to any one of statements 1 to 56 or the pharmaceutical composition according to statement 58.

    [2068] 66. The method according to statement 65, wherein the disease or disorder is a cardiovascular disease or disorder.

    [2069] 67. The method according to statement 66, wherein the cardiovascular disease or disorder is selected from dyslipidemia, hypercholesterolemia, hypertriglyceridemia, hyperlipidemia, hypoalphalipoproteinemia, metabolic syndrome, diabetic complications, atherosclerosis, stroke, vascular dimensia, chronic kidney disease, coronary heart disease, coronary artery disease, retinopathy, inflammation, thrombosis, peripheral vascular disease heart failure or congestive heart failure.