BISPECIFIC ANTIGEN BINDING MOLECULES THAT BIND HER2, AND METHODS OF USE THEREOF
20240254255 ยท 2024-08-01
Inventors
- Julian Andreev (Sleepy Hollow, NY, US)
- Andres Perez Bay (New York, NY, US)
- Christopher Daly (New York, NY)
- Frank Delfino (Poughquag, NY)
- Amy Han (Hockessin, DE)
- Thomas Nittoli (Pearl River, NY)
- William Olson (Yorktown Heights, NY)
- Gavin Thurston (Briarcliff Manor, NY)
Cpc classification
A61K47/6803
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
C07K5/021
CHEMISTRY; METALLURGY
International classification
A61K47/68
HUMAN NECESSITIES
Abstract
Provided herein are bispecific antigen-binding molecules that bind HER2 and methods of use thereof. The bispecific antigen-binding molecules comprise a first and a second antigen-binding domain, wherein the first and second antigen-binding domains bind to two different (preferably nonoverlapping) epitopes of the extracellular domain of human HER2. The bispecific antigen-binding molecules cluster on the surface of HER2 IHC2+ and IHC3+ cells, and are internalized into the cellular lysosomes. Also included are antibody-drug conjugates (ADCs) comprising the antibodies or bispecific antigen-binding molecules provided herein linked to a cytotoxic agent, radionuclide, or other moiety, as well as methods of treating cancer in a subject by administering to the subject a bispecific antigen-binding molecule or an ADC thereof.
Claims
1. A bispecific antigen-binding molecule comprising: a first antigen-binding domain (D1); and a second antigen-binding domain (D2); wherein D1 specifically binds a first epitope of human HER2; and wherein D2 specifically binds a second epitope of human HER2; and wherein D1 comprises three heavy chain complementarity determining regions (HCDR1, HCDR2 and HCDR3) within a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 32 and three light chain complementarity determining regions (LCDR1, LCDR2 and LCDR3) within a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 18, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 34; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 36; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 38; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 20; the LCDR2 comprises the amino acid sequence of SEQ ID NO: 22; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 24; and wherein D2 comprises three heavy chain complementarity determining regions (HCDR1, HCDR2 and HCDR3) within a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 40 and three light chain complementarity determining regions (LCDR1, LCDR2 and LCDR3) within a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 18, wherein the HCDR1 comprises the amino acid sequence of SEQ ID NO: 42; the HCDR2 comprises the amino acid sequence of SEQ ID NO: 44; the HCDR3 comprises the amino acid sequence of SEQ ID NO: 46; the LCDR1 comprises the amino acid sequence of SEQ ID NO: 20; the LCDR2 comprises the amino acid sequence of SEQ ID NO: 22; and the LCDR3 comprises the amino acid sequence of SEQ ID NO: 24.
2. The bispecific antigen-binding molecule of claim 1, wherein the bispecific antigen-binding molecule is conjugated to a cytotoxin.
3. The bispecific antigen-binding molecule of claim 2, wherein the cytotoxin is a tubulysin, a camptothecin, or a maytansinoid.
4. The bispecific antigen-binding molecule of claim 1, wherein the bispecific antigen-binding molecule is conjugated to a cytotoxin through a linker.
5. The bispecific antigen-binding molecule of claim 4, wherein the cytotoxin is a tubulysin.
6. The bispecific antigen-binding molecule of claim 5, wherein the tubulysin is: ##STR00154##
7. The bispecific antigen-binding molecule of claim 4, wherein the bispecific antigen-binding molecule is conjugated to ##STR00155## or a regioisomer thereof, wherein ##STR00156## is a bond to a heavy chain glutamine.
8. The bispecific antigen-binding molecule of claim 5, wherein the bispecific antigen-binding molecule comprises a heavy chain conjugated to tubulysin through Q295.
9. The bispecific antigen-binding molecule of claim 5, wherein the bispecific antigen-binding molecule comprises a heavy chain comprising an N297Q mutation (EU index numbering), and wherein the bispecific antigen-binding molecule is (1) conjugated to a tubulysin through the glutamine residue of the heavy chain Q295, and (2) conjugated to a tubulysin through the glutamine residue of the N297Q mutation.
10. The bispecific antigen-binding molecule of claim 4, wherein the cytotoxin is a maytansinoid.
11. The bispecific antigen-binding molecule of claim 10 wherein the maytansinoid is: ##STR00157## wherein the ##STR00158## is the bond to the linker.
12. The bispecific antigen-binding molecule of claim 11, wherein the linker is: ##STR00159## wherein the bond noted with ##STR00160## represents the bond to the bispecific antigen-binding molecule and the bond noted with ##STR00161## represents the bond to the maytansinoid.
13. The bispecific antigen-binding molecule of claim 10, wherein the maytansinoid is ##STR00162## wherein the ##STR00163## is the bond to the linker.
14. The bispecific antigen-binding molecule of claim 13, wherein the linker is: ##STR00164## wherein the bond noted with ##STR00165## represents the bond to the bispecific antigen-binding molecule and the bond noted with ##STR00166## represents the bond to the maytansinoid.
15. The bispecific antigen-binding molecule of claim 4, wherein the cytotoxin is a camptothecin.
16. The bispecific antigen-binding molecule of claim 1, wherein the bispecific antigen-binding molecule comprises a heavy chain comprising an N297Q mutation (EU index numbering).
17. A pharmaceutical composition comprising the bispecific antigen-binding molecule of claim 1, and a pharmaceutically acceptable carrier.
18. A bispecific antigen-binding molecule comprising: a first antigen-binding domain (D1); and a second antigen-binding domain (D2); wherein D1 specifically binds a first epitope of human HER2; and wherein D2 specifically binds a second epitope of human HER2; and wherein D1 comprises three heavy chain complementarity determining regions (HCDR1, HCDR2 and HCDR3) within a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 32 and three light chain complementarity determining regions (LCDR1, LCDR2 and LCDR3) within a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 18; and wherein D2 comprises three heavy chain complementarity determining regions (HCDR1, HCDR2 and HCDR3) within a heavy chain variable region (HCVR) comprising the amino acid sequence of SEQ ID NO: 40 and three light chain complementarity determining regions (LCDR1, LCDR2 and LCDR3) within a light chain variable region (LCVR) comprising the amino acid sequence of SEQ ID NO: 18.
19. The bispecific antigen-binding molecule of claim 18, wherein D1 comprises an HCDR1 amino acid sequence as set forth in SEQ ID NO: 34; an HCDR2 amino acid sequence as set forth in SEQ ID NO: 36; an HCDR3 amino acid sequence as set forth in SEQ ID NO: 38; an LCDR1 amino acid sequence as set forth in SEQ ID NO: 20; an LCDR2 amino acid sequence as set forth in SEQ ID NO: 22; and an LCDR3 amino acid sequence as set forth in SEQ ID NO: 24.
20. The bispecific antigen-binding molecule of claim 18, wherein D2 comprises an HCDR1 amino acid sequence as set forth in SEQ ID NO: 42; an HCDR2 amino acid sequence as set forth in SEQ ID NO: 44; an HCDR3 amino acid sequence as set forth in SEQ ID NO: 46; an LCDR1 amino acid sequence as set forth in SEQ ID NO: 20; an LCDR2 amino acid sequence as set forth in SEQ ID NO: 22; and an LCDR3 amino acid sequence as set forth in SEQ ID NO: 24.
21. A method of treating a cancer in a subject suffering from a tumor overexpressing HER2, the method comprising administering to the subject the bispecific antigen-binding molecule of claim 2.
22. The method of claim 21, wherein the cancer is selected from the group consisting of a breast cancer, lung cancer, gastric cancer, cervical cancer, gastric cancer, endometrial cancer, and ovarian cancer.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION
[0027] Before the present invention is described, it is to be understood that this invention is not limited to particular methods and experimental conditions described, as such methods and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0028] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. As used herein, the term about, when used in reference to a particular recited numerical value, means that the value may vary from the recited value by no more than 1%. For example, as used herein, the expression about 100 includes 99 and 101 and all values in between (e.g., 99.1, 99.2, 99.3, 99.4, etc.).
[0029] Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All patents, applications and non-patent publications mentioned in this specification are incorporated herein by reference in their entireties.
HER2 Protein
[0030] The expressions HER2 and the like, as used herein, a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. The protein is also known as NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu. HER2 can refer to the amino acid sequence as set forth in SEQ ID NO: 51, and/or having the amino acid sequence as set forth in NCBI accession No. NP_004439.2.
[0031] All references to proteins, polypeptides and protein fragments herein are intended to refer to the human version of the respective protein, polypeptide or protein fragment unless explicitly specified as being from a non-human species. Thus, the expression HER2 means human HER2 unless specified as being from a non-human species, e.g., mouse HER2 monkey HER2, etc.
[0032] As used herein, the expression cell surface-expressed HER2 means one or more HER2 protein(s), or the extracellular domain thereof, that is/are expressed on the surface of a cell in vitro or in vivo, such that at least a portion of a HER2 protein is exposed to the extracellular side of the cell membrane and is accessible to an antigen-binding portion of an antibody. A cell surface-expressed HER2 can comprise or consist of a HER2 protein expressed on the surface of a cell which normally expresses HER2 protein. Alternatively, cell surface-expressed HER2 can comprise or consist of HER2 protein expressed on the surface of a cell that normally does not express human HER2 on its surface but has been artificially engineered to express HER2 on its surface.
HER2?HER2 Bispecific Antigen-Binding Molecules
[0033] Provided herein are bispecific antigen binding molecules comprising a first antigen-binding domain (also referred to herein as D1), and a second antigen-binding domain (also referred to herein as D2). The simultaneous binding of the two separate HER2 epitopes by the bispecific antigen-binding molecule results in cluster formation of the antibodies on a HER2 expressing cell surface and results in internalization of the HER2 protein along with the bound antibody.
[0034] The bispecific antigen-binding molecules, which comprise a first antigen-binding domain (D1) which specifically binds a first epitope of human HER2 and a second antigen-binding domain (D2) which specifically binds a second epitope of human HER2, may be referred to herein as HER2?HER2 bispecific antibodies, HER2?HER2, or other related terminology.
[0035] In certain embodiments, D1 and D2 domains of a HER2?HER2 bispecific antibody are non-competitive with one another. Non-competition between D1 and D2 for binding to HER2 means that, the respective monospecific antigen binding proteins from which D1 and D2 were derived do not compete with one another for binding to human HER2. Exemplary antigen-binding protein competition assays are known in the art, non-limiting examples of which are described elsewhere herein.
[0036] In certain embodiments, D1 and D2 bind to different (e.g., non-overlapping, or partially overlapping) epitopes on HER2, as described elsewhere herein.
[0037] HER2?HER2 bispecific antigen-binding molecules may be constructed using the antigen-binding domains of two separate monospecific anti-HER2 antibodies. For example, a collection of monoclonal monospecific anti-HER2 antibodies may be produced using standard methods known in the art. The individual antibodies thus produced may be tested pairwise against one another for cross-competition to a HER2 protein. If two different anti-HER2 antibodies are able to bind to HER2 at the same time (i.e., do not compete with one another), then the antigen-binding domain from the first anti-HER2 antibody and the antigen-binding domain from the second, non-competitive anti-HER2 antibody can be engineered into a single HER2?HER2 bispecific antibody in accordance with the present disclosure.
[0038] According to the present disclosure, a bispecific antigen-binding molecule can be a single multifunctional polypeptide, or it can be a multimeric complex of two or more polypeptides that are covalently or non-covalently associated with one another. As will be made evident by the present disclosure, any antigen binding construct which has the ability to simultaneously bind two separate, non-identical epitopes of the HER2 molecule is regarded as a bispecific antigen-binding molecule. Any of the bispecific antigen-binding molecules described herein, or variants thereof, may be constructed using standard molecular biological techniques (e.g., recombinant DNA and protein expression technology) as will be known to a person of ordinary skill in the art.
Anti-HER2 Bispecific Antibody Sequences
[0039] The term antibody, as used herein, means any antigen-binding molecule or molecular complex comprising at least one complementarity determining region (CDR) that specifically binds to or interacts with a particular antigen (e.g., HER2). The term antibody includes immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM). The term antibody also includes immunoglobulin molecules consisting of four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or V.sub.H) and a heavy chain constant region. The heavy chain constant region comprises three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain comprises a light chain variable region (abbreviated herein as LCVR or V.sub.L) and a light chain constant region. The light chain constant region comprises one domain (C.sub.L1). The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. In different embodiments of the invention, the FRs of the anti-HER2 antibody (or antigen-binding portion thereof) may be identical to the human germline sequences, or may be naturally or artificially modified. An amino acid consensus sequence may be defined based on a side-by-side analysis of two or more CDRs.
[0040] Likewise, the term antibody includes immunoglobulin molecules comprising eight polypeptide chains, four heavy (H) chains and four light (L) chains inter-connected by disulfide bonds, i.e. a bispecific antibody. The term antibody also includes immunoglobulin molecules consisting of eight polypeptide chains, four heavy (H) chains and four light (L) chains inter-connected by disulfide bonds.
[0041] Furthermore, the term antibody includes functionalized immunoglobulin molecules comprising at least one HC, wherein the HC comprises an azido-PEG.sub.3-amine. In some aspects, the azido-PEG.sub.3-amine is located at a Q295 site on the antibody HC. In some aspects, the azido-PEG.sub.3-amine is located at a Q297 site on the antibody. In some aspects, the bispecific antibody has two HCs functionalized with azido-PEG.sub.3-amines located at both Q295 sites in the HCs. In some aspects, the bispecific antibody has two HCs functionalized with azido-PEG.sub.3-amines located at both Q297 sites in the HCs. In some aspects, the bispecific antibody has two HCs functionalized with azido-PEG.sub.3-amines located at both Q295 sites and at both Q297 sites in the HCs. The Q297 sites in the HCs are obtained by modifying the N297 to a Q297, also referred to herein as an N297Q modification.
[0042] According to one aspect, HER2 bispecific antibodies are provided. Exemplary HER2 bispecific antibodies according to this aspect are listed in Tables 1 and 2 herein. Table 1 sets forth the amino acid sequence identifiers of the heavy chain variable regions (HCVRs), light chain variable regions (LCVRs), heavy chain complementarity determining regions (HCDR1, HCDR2 and HCDR3), and light chain complementarity determining regions (LCDR1, LCDR2 and LCDR3) of the bispecific antigen-binding molecules (used interchangeably herein with bispecific antigen-binding protein) disclosed herein. Table 2 sets forth the nucleic acid sequence identifiers of the HCVRs, LCVRs, HCDR1, HCDR2 HCDR3, LCDR1, LCDR2 and LCDR3 of the exemplary antibodies.
[0043] Provided herein are bispecific antibodies that specifically bind HER2, comprising an HCVR comprising an amino acid sequence selected from any of the HCVR amino acid sequences listed in Table 1, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0044] Provided herein are bispecific antibodies that specifically bind HER2, comprising an LCVR comprising an amino acid sequence selected from any of the LCVR amino acid sequences listed in Table 1, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0045] Provided herein are bispecific antibodies that specifically bind HER2, comprising an HCVR and an LCVR amino acid sequence pair (HCVR/LCVR) comprising any of the HCVR amino acid sequences listed in Table 1 paired with any of the LCVR amino acid sequences listed in Table 1. According to certain embodiments, the bispecific antibodies comprise two HCVR/LCVR amino acid sequence pairs contained within any of the exemplary HER2 bispecific antibodies listed in Table 1. In certain embodiments, an HCVR/LCVR amino acid sequence pair is selected from the group consisting of: SEQ ID NO: 2/18, 10/18, 32/18, and 40/18.
[0046] Also provided are bispecific antibodies that specifically bind HER2, comprising a heavy chain CDR1 (HCDR1) comprising an amino acid sequence selected from any of the HCDR1 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0047] Also provided are bispecific antibodies that specifically bind HER2, comprising a heavy chain CDR2 (HCDR2) comprising an amino acid sequence selected from any of the HCDR2 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0048] Also provided are bispecific antibodies that specifically bind HER2, comprising a heavy chain CDR3 (HCDR3) comprising an amino acid sequence selected from any of the HCDR3 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0049] Also provided are bispecific antibodies that specifically bind HER2, comprising a light chain CDR1 (LCDR1) comprising an amino acid sequence selected from any of the LCDR1 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0050] Also provided are bispecific antibodies that specifically bind HER2, comprising a light chain CDR2 (LCDR2) comprising an amino acid sequence selected from any of the LCDR2 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0051] Also provided are bispecific antibodies that specifically bind HER2, comprising a light chain CDR3 (LCDR3) comprising an amino acid sequence selected from any of the LCDR3 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0052] Also provided are bispecific antibodies that specifically bind HER2, comprising an HCDR1 and an LCDR1 amino acid sequence pair (HCDR1/LCDR1) comprising any of the HCDR1 amino acid sequences listed in Table 1 paired with any of the LCDR1 amino acid sequences listed in Table 1. According to certain embodiments, bispecific antibodies comprise at least one HCDR1/LCDR1 amino acid sequence pair contained within any of the exemplary anti-HER2 antibodies listed in Table 1. In certain embodiments, the HCDR1/LCDR1 amino acid sequence pair is selected from the group consisting of: SEQ ID NO: 4/20, 12/20, 34/20, and 42/20.
[0053] Also provided are bispecific antibodies that specifically bind HER2, comprising an HCDR2 and an LCDR2 amino acid sequence pair (HCDR2/LCDR2) comprising any of the HCDR2 amino acid sequences listed in Table 1 paired with any of the LCDR2 amino acid sequences listed in Table 1. According to certain embodiments, the bispecific antibodies comprise at least one HCDR2/LCDR2 amino acid sequence pair contained within any of the exemplary anti-HER2 antibodies listed in Table 1. In certain embodiments, the HCDR2/LCDR2 amino acid sequence pair is selected from the group consisting of: SEQ ID NO: 6/22, 14/22, 36/22, and 44/22.
[0054] Also provided herein are bispecific antibodies that specifically bind HER2, comprising an HCDR3 and an LCDR3 amino acid sequence pair (HCDR3/LCDR3) comprising any of the HCDR3 amino acid sequences listed in Table 1 paired with any of the LCDR3 amino acid sequences listed in Table 1. According to certain embodiments the bispecific antibodies comprise at least one HCDR3/LCDR3 amino acid sequence pair contained within any of the exemplary bispecific antibodies listed in Table 1. In certain embodiments, the HCDR3/LCDR3 amino acid sequence pair is selected from the group consisting of: SEQ ID NO: 8/24, 16/24, 38/24, and 46/24.
[0055] Also provided herein are bispecific antibodies that specifically bind HER2, comprising two sets of six CDRs (i.e., HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) contained within any of the exemplary anti-HER2 antibodies listed in Table 1. In certain embodiments, the HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3 amino acid sequence sets are selected from the group consisting of: SEQ ID NO: 4-6-8-20-22-24, 12-14-16-20-22-24, 34-36-38-20-22-24, and 42-44-46-20-22-24.
[0056] In a related embodiment, bispecific antibodies that specifically bind HER2 comprise two sets of six CDRs (i.e., HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) contained within two HCVR/LCVR amino acid sequence pairs as defined by any of the exemplary HER2 bispecific antibodies listed in Table 1. For example, HER2 bispecific antibodies comprise an HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3 amino acid sequence set contained within an HCVR/LCVR amino acid sequence pair selected from the group consisting of: SEQ ID NOs: 2/18, 10/18, 32/18, and 40/18.
[0057] Methods and techniques for identifying CDRs within HCVR and LCVR amino acid sequences are well known in the art and can be used to identify CDRs within the specified HCVR and/or LCVR amino acid sequences disclosed herein. Exemplary conventions that can be used to identify the boundaries of CDRs include, e.g., the Kabat definition, the Chothia definition, and the AbM definition. In general terms, the Kabat definition is based on sequence variability, the Chothia definition is based on the location of the structural loop regions, and the AbM definition is a compromise between the Kabat and Chothia approaches. See, e.g., Kabat, Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md. (1991); Al-Lazikani et al., J. Mol. Biol. 273:927-948 (1997); and Martin et al., Proc. Natl. Acad. Sci. USA 86:9268-9272 (1989). Public databases are also available for identifying CDR sequences within an antibody.
[0058] Provided herein are bispecific antibodies that specifically bind HER2, comprising a heavy chain (HC) comprising an amino acid sequence selected from any of the HC amino acid sequences listed in Table 3, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto. For example, provided herein are bispecific antibodies that specifically bind HER2, comprising a HC comprising an amino acid sequence selected from any of the HC amino acid sequences listed in Table 3, but comprising an N297Q modification, or an equivalent modification. Illustratively, provided herein is a bispecific antibody having a heavy chain comprising an N297Q modification within a HC amino acid sequence selected from the group consisting of SEQ ID NOs: 26, 28, 48, and 50. In some aspects, the bispecific antibody comprises a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 26. In some aspects, the bispecific antibody comprises a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 28. In some aspects, the bispecific antibody comprises a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 48. In some aspects, the bispecific antibody comprises a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 50. In some aspects, the bispecific antibody comprises a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 26 and a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 28. In some aspects, the bispecific antibody comprises a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 48 and a HC comprising an N297Q modification within the HC amino acid sequence of SEQ ID NO: 50.
[0059] Provided herein are bispecific antibodies that specifically bind HER2, comprising a light chain (LC) comprising an amino acid sequence selected from any of the LC amino acid sequences listed in Table 3, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0060] Provided herein are bispecific antibodies that specifically bind HER2, comprising an HC and an LC amino acid sequence pair (HC/LC) comprising any of the HC amino acid sequences listed in Table 3 paired with any of the LC amino acid sequences listed in Table 3. According to certain embodiments, the bispecific antibodies comprise two HC/LC amino acid sequence pairs contained within any of the exemplary HER2 bispecific antibodies listed in Table 3. In certain embodiments, an HC/LC amino acid sequence pair is selected from the group consisting of: SEQ ID NO: 26/30, 28/30, 48/30, and 50/30. In some aspects, the HC comprises an N297Q modification as provided above.
[0061] Also provided herein are nucleic acid molecules encoding anti-HER2 antibodies or portions thereof. For example, the present invention provides nucleic acid molecules encoding any of the HCVR amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0062] Also provided are nucleic acid molecules encoding any of the LCVR amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0063] Also provided are nucleic acid molecules encoding any of the HCDR1 amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCDR1 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0064] Also provided are nucleic acid molecules encoding any of the HCDR2 amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCDR2 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0065] Also provided are nucleic acid molecules encoding any of the HCDR3 amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCDR3 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0066] Also provided are nucleic acid molecules encoding any of the LCDR1 amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCDR1 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0067] Also provided are nucleic acid molecules encoding any of the LCDR2 amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCDR2 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0068] Also provided are nucleic acid molecules encoding any of the LCDR3 amino acid sequences listed in Table 1; in certain embodiments the nucleic acid molecule comprises a polynucleotide sequence selected from any of the LCDR3 nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0069] Also provided are nucleic acid molecules encoding an HCVR, wherein the HCVR comprises a set of three CDRs (i.e., HCDR1-HCDR2-HCDR3), wherein the HCDR1-HCDR2-HCDR3 amino acid sequence set is as defined by any of the exemplary HER2 bispecific antibodies listed in Table 1.
[0070] Also provided are nucleic acid molecules encoding an LCVR, wherein the LCVR comprises a set of three CDRs (i.e., LCDR1-LCDR2-LCDR3), wherein the LCDR1-LCDR2-LCDR3 amino acid sequence set is as defined by any of the exemplary HER2 bispecific antibodies listed in Table 1.
[0071] Also provided are nucleic acid molecules encoding both an HCVR and an LCVR, wherein the HCVR comprises an amino acid sequence of any of the HCVR amino acid sequences listed in Table 1, and wherein the LCVR comprises an amino acid sequence of any of the LCVR amino acid sequences listed in Table 1. In certain embodiments, the nucleic acid molecule comprises a polynucleotide sequence selected from any of the HCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto, and a polynucleotide sequence selected from any of the LCVR nucleic acid sequences listed in Table 2, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto. In certain embodiments according to this aspect, the nucleic acid molecule encodes an HCVR and LCVR, wherein the HCVR and LCVR are both derived from the same HER2 bispecific antibody listed in Table 1.
[0072] Also provided are nucleic acid molecules encoding any of the HC amino acid sequences listed in Table 3; or encoding a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto. For example, the nucleic acid molecules can encode any of the HC amino acid sequences listed in Table 3, wherein the HC has an N297Q modification.
[0073] Also provided are nucleic acid molecules encoding any of the LC amino acid sequences listed in Table 3; or encoding a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0074] Also provided herein are recombinant expression vectors capable of expressing a polypeptide comprising a heavy or light chain variable region of HER2 bispecific antibody. For example, recombinant expression vectors comprise any of the nucleic acid molecules mentioned above, i.e., nucleic acid molecules encoding any of the HCVR, LCVR, and/or CDR sequences as set forth in Table 1. Also included within the scope of the present disclosure are host cells into which such vectors have been introduced, as well as methods of producing the antibodies or portions thereof by culturing the host cells under conditions permitting production of the antibodies or antibody fragments, and recovering the antibodies and antibody fragments so produced.
[0075] Provided herein are HER2 bispecific antibodies having a modified glycosylation pattern. In some embodiments, modification to remove undesirable glycosylation sites may be useful, or an antibody lacking a fucose moiety present on the oligosaccharide chain, for example, to increase antibody dependent cellular cytotoxicity (ADCC) function (see Shield et al. (2002) JBC 277:26733). In other applications, modification of galactosylation can be made in order to modify complement dependent cytotoxicity (CDC).
Antigen-Binding Domains
[0076] The bispecific antigen-binding molecules of the present disclosure comprise two separate antigen-binding domains (D1 and D2). As used herein, the expression antigen-binding domain means any peptide, polypeptide, nucleic acid molecule, scaffold-type molecule, peptide display molecule, or polypeptide-containing construct that is capable of specifically binding a particular antigen of interest (e.g., human HER2). The term specifically binds or the like, as used herein, means that the antigen-binding domain forms a complex with a particular antigen characterized by a dissociation constant (K.sub.D) of 500 pM or less, and does not bind other unrelated antigens under ordinary test conditions. Unrelated antigens are proteins, peptides or polypeptides that have less than 95% amino acid identity to one another.
[0077] Exemplary categories of antigen-binding domains that can be used in the context of the present disclosure include antibodies, antigen-binding portions of antibodies, peptides that specifically interact with a particular antigen (e.g., peptibodies), receptor molecules that specifically interact with a particular antigen, proteins comprising a ligand-binding portion of a receptor that specifically binds a particular antigen, antigen-binding scaffolds (e.g., DARPins, HEAT repeat proteins, ARM repeat proteins, tetratricopeptide repeat proteins, and other scaffolds based on naturally occurring repeat proteins, etc., [see, e.g., Boersma and Pluckthun, 2011, Curr. Opin. Biotechnol. 22:849-857, and references cited therein]), and aptamers or portions thereof.
[0078] Methods for determining whether two molecules specifically bind one another are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like. For example, an antigen-binding domain, as used in the context of the present disclosure, includes polypeptides that bind a particular antigen (e.g., a target molecule [T] or an internalizing effector protein [E]) or a portion thereof with a Kp of less than about 500 pM, less than about 400 pM, less than about 300 pM, less than about 200 pM, less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 5 pM, less than about 4 pM, less than about 2 pM, less than about 1 pM, less than about 0.5 pM, less than about 0.2 pM, less than about 0.1 pM, or less than about 0.05 pM, as measured in a surface plasmon resonance assay.
[0079] The term surface plasmon resonance, as used herein, refers to an optical phenomenon that allows for the analysis of real-time interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore? system (Biacore Life Sciences division of GE Healthcare, Piscataway, NJ).
[0080] The term K.sub.D, as used herein, means the equilibrium dissociation constant of a particular protein-protein interaction (e.g., antibody-antigen interaction). Unless indicated otherwise, the K.sub.D values disclosed herein refer to K.sub.D values determined by surface plasmon resonance assay at 25? C.
[0081] As indicated above, an antigen-binding domain (D1 and/or D2) may comprise or consist of an antibody or antigen-binding fragment of an antibody. The term antibody, as used herein, means any antigen-binding molecule or molecular complex comprising at least one complementarity determining region (CDR) that specifically binds to or interacts with a particular antigen (e.g., human HER2). The term antibody includes immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM). Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or V.sub.H) and a heavy chain constant region. The heavy chain constant region comprises three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain comprises a light chain variable region (abbreviated herein as LCVR or V.sub.L) and a light chain constant region. The light chain constant region comprises one domain (C.sub.L1). The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. In different embodiments, the FRs of the antibodies provided herein (or antigen-binding portion thereof) may be identical to the human germline sequences, or may be naturally or artificially modified. An amino acid consensus sequence may be defined based on a side-by-side analysis of two or more CDRs.
[0082] The D1 and/or D2 components of the bispecific antigen-binding molecules provided herein may comprise or consist of antigen-binding fragments of full antibody molecules. The terms antigen-binding portion of an antibody, antigen-binding fragment of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. Antigen-binding fragments of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains. Such DNA is known and/or is readily available from, e.g., commercial sources, DNA libraries (including, e.g., phage-antibody libraries), or can be synthesized. The DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
[0083] Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab)2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide. Other engineered molecules, such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g. monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression antigen-binding fragment, as used herein.
[0084] An antigen-binding fragment of an antibody will typically comprise at least one variable domain. The variable domain may be of any size or amino acid composition and will generally comprise at least one CDR which is adjacent to or in frame with one or more framework sequences. In antigen-binding fragments having a V.sub.H domain associated with a V.sub.L domain, the V.sub.H and V.sub.L domains may be situated relative to one another in any suitable arrangement. For example, the variable region may be dimeric and contain V.sub.H-V.sub.H, V.sub.H-V.sub.L or V.sub.L-V.sub.L dimers. Alternatively, the antigen-binding fragment of an antibody may contain a monomeric V.sub.H or V.sub.L domain.
[0085] In certain embodiments, an antigen-binding fragment of an antibody may contain at least one variable domain covalently linked to at least one constant domain. Non-limiting, exemplary configurations of variable and constant domains that may be found within an antigen-binding fragment of an antibody of the present disclosure include: (i) V.sub.H-C.sub.H1; (ii) V.sub.H-C.sub.H2; (iii) V.sub.H-C.sub.H3; (iv) V.sub.H-C.sub.H1-C.sub.H2; (v) V.sub.H-C.sub.H1-C.sub.H2-C.sub.H3; (vi) V.sub.H-C.sub.H2-C.sub.H3; (vii) V.sub.H-C.sub.L; (viii) V.sub.L-C.sub.H1; (ix) V.sub.L-C.sub.H2; (x) V.sub.L-C.sub.H3; (xi) V.sub.L-C.sub.H1-C.sub.H2; (xii) V.sub.L-C.sub.H1-C.sub.H2-C.sub.H3; (xiii) V.sub.L-C.sub.H2-C.sub.H3; and (xiv) V.sub.L-C.sub.L. In any configuration of variable and constant domains, including any of the exemplary configurations listed above, the variable and constant domains may be either directly linked to one another or may be linked by a full or partial hinge or linker region. A hinge region may consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60 or more) amino acids which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule. Moreover, an antigen-binding fragment may comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non-covalent association with one another and/or with one or more monomeric V.sub.H or V.sub.L domain (e.g., by disulfide bond(s)).
[0086] The bispecific antigen-binding molecules provided herein may comprise or consist of human antibodies and/or recombinant human antibodies, or fragments thereof. The term human antibody, as used herein, includes antibodies having variable and constant regions derived from human germline immunoglobulin sequences. Human antibodies may nonetheless include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term human antibody, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
[0087] The bispecific antigen-binding molecules of the present disclosure may comprise or consist of recombinant human antibodies or antigen-binding fragments thereof. The term recombinant human antibody, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described further below), antibodies isolated from a recombinant, combinatorial human antibody library (described further below), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor et al. (1992) Nucl. Acids Res. 20:6287-6295) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the V.sub.H and V.sub.L regions of the recombinant antibodies are sequences that, while derived from and related to human germline V.sub.H and V.sub.L sequences, may not naturally exist within the human antibody germline repertoire in vivo.
[0088] Methods for making bispecific antibodies are known in the art and may be used to construct bispecific antigen-binding molecules disclosed herein. Exemplary bispecific formats that can be used in the context of the present disclosure include, without limitation, e.g., scFv-based or diabody bispecific formats, IgG-scFv fusions, dual variable domain (DVD)-Ig, Quadroma, knobs-into-holes, common light chain (e.g., common light chain with knobs-into-holes, etc.), CrossMab, CrossFab, (SEED)body, leucine zipper, Duobody, IgG1/IgG2, dual acting Fab (DAF)-IgG, and Mab2 bispecific formats (see, e.g., Klein et al. 2012, mAbs 4:6, 1-11, and references cited therein, for a review of the foregoing formats).
[0089] Exemplary antigen-binding domains (D1 and D2) that can be included in the HER2?HER2 bispecific antigen-binding molecules provided herein include antigen-binding domains derived from any of the anti-HER2 sequences disclosed herein. For example, the present disclosure includes HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising an HCVR comprising an amino acid sequence selected from any of the HCVR amino acid sequences listed in Table 1, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0090] Also provided herein are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising an LCVR comprising an amino acid sequence selected from any of the LCVR amino acid sequences listed in Table 1, or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity thereto.
[0091] Provided herein are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising an HCVR and an LCVR amino acid sequence pair (HCVR/LCVR) comprising any of the HCVR amino acid sequences listed in Table 1 paired with any of the LCVR amino acid sequences listed in Table 1. According to certain embodiments, the present invention provides HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising an HCVR/LCVR amino acid sequence pair contained within any of the exemplary anti-HER2 antibodies listed in Table 1.
[0092] Also provided herein are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a heavy chain CDR1 (HCDR1) comprising an amino acid sequence selected from any of the HCDR1 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0093] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a heavy chain CDR2 (HCDR2) comprising an amino acid sequence selected from any of the HCDR2 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0094] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a heavy chain CDR3 (HCDR3) comprising an amino acid sequence selected from any of the HCDR3 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0095] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a light chain CDR1 (LCDR1) comprising an amino acid sequence selected from any of the LCDR1 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0096] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a light chain CDR2 (LCDR2) comprising an amino acid sequence selected from any of the LCDR2 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0097] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a light chain CDR3 (LCDR3) comprising an amino acid sequence selected from any of the LCDR3 amino acid sequences listed in Table 1 or a substantially similar sequence thereof having at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0098] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising an HCDR3 and an LCDR3 amino acid sequence pair (HCDR3/LCDR3) comprising any of the HCDR3 amino acid sequences listed in Table 1 paired with any of the LCDR3 amino acid sequences listed in Table 1. According to certain embodiments, the present disclosure provides antibodies, or antigen-binding fragments thereof, comprising an HCDR3/LCDR3 amino acid sequence pair contained within any of the exemplary anti-HER2 antibodies listed in Table 1.
[0099] Also provided are HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a set of six CDRs (i.e., HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) contained within any of the exemplary anti-HER2 antibodies listed in Table 1.
[0100] In a related embodiment, the present disclosure provides HER2?HER2 bispecific antigen-binding molecules comprising a D1 or D2 antigen-binding domain comprising a set of six CDRs (i.e., HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) contained within an HCVR/LCVR amino acid sequence pair selected from the anti-HER2 sequences listed in Table 1.
[0101] The HER2?HER2 bispecific antigen-binding molecules provided herein may comprise a D1 antigen-binding domain derived from any of the anti-HER2 sequences of Table 1, and a D2 antigen-binding domain derived from any other anti-HER2 sequence of Table 1. Non-limiting examples of HER2?HER2 bispecific antibodies of the present disclosure are depicted in the Examples provided herein.
[0102] As a non-limiting illustrative example, the present disclosure includes HER2?HER2 bispecific antigen binding molecules comprising a D1 antigen-binding domain and a D2 antigen-binding domain, wherein the D1 antigen binding domain comprises an HCVR/LCVR amino acid sequence pair of SEQ ID NOs: 2/18, or a set of heavy and light chain CDRs (HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) comprising SEQ ID NOs: 4-6-8-20-22-24, and wherein the D2 antigen-binding domain comprises an HCVR/LCVR amino acid sequence pair of SEQ ID NOS: 10/18, or a set of heavy and light chain CDRs (HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) comprising SEQ ID NOs: 12-14-16-20-22-24. An exemplary HER2?HER2 bispecific antibody having these sequence characteristics is the bispecific antibody designated H4H17325D, also referred to as bispecific antibody 1 (bsAb1).
[0103] As a further non-limiting illustrative example, the present disclosure includes HER2?HER2 bispecific antigen binding molecules comprising a D1 antigen-binding domain and a D2 antigen-binding domain, wherein the D1 antigen binding domain comprises an HCVR/LCVR amino acid sequence pair of SEQ ID NOs: 32/18, or a set of heavy and light chain CDRs (HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) comprising SEQ ID NOs: 34-36-38-20-22-24, and wherein the D2 antigen-binding domain comprises an HCVR/LCVR amino acid sequence pair of SEQ ID NOs: 40/18, or a set of heavy and light chain CDRs (HCDR1-HCDR2-HCDR3-LCDR1-LCDR2-LCDR3) comprising SEQ ID NOs: 42-44-46-20-22-24. An exemplary HER2?HER2 bispecific antibody having these sequence characteristics is the bispecific antibody designated H4H17087D, also referred to as bispecific antibody 2 (bsAb2).
Multimerizing Components
[0104] The bispecific antigen-binding molecules provided herein, in certain embodiments, may also comprise one or more multimerizing component(s). The multimerizing components can function to maintain the association between the antigen-binding domains (D1 and D2). As used herein, a multimerizing component is any macromolecule, protein, polypeptide, peptide, or amino acid that has the ability to associate with a second multimerizing component of the same or similar structure or constitution. For example, a multimerizing component may be a polypeptide comprising an immunoglobulin C.sub.H3 domain. A non-limiting example of a multimerizing component is an Fc portion of an immunoglobulin, e.g., an Fc domain of an IgG selected from the isotypes IgG1, IgG2, IgG3, and IgG4, as well as any allotype within each isotype group. In certain embodiments, the multimerizing component is an Fc fragment or an amino acid sequence of 1 to about 200 amino acids in length containing at least one cysteine residues. In other embodiments, the multimerizing component is a cysteine residue, or a short cysteine-containing peptide. Other multimerizing domains include peptides or polypeptides comprising or consisting of a leucine zipper, a helix-loop motif, or a coiled-coil motif.
[0105] In certain embodiments, the bispecific antigen-binding molecules provided herein comprise two multimerizing domains, M1 and M2, wherein D1 is attached to M1 and D2 is attached to M2, and wherein the association of M1 with M2 facilitates the physical linkage of D1 and D2 to one another in a single bispecific antigen-binding molecule. In certain embodiments, M1 and M2 are identical to one another. For example, M1 can be an Fc domain having a particular amino acid sequence, and M2 is an Fc domain with the same amino acid sequence as M1. Alternatively, M1 and M2 may differ from one another at one or more amino acid position. For example, M1 may comprise a first immunoglobulin (Ig) C.sub.H3 domain and M2 may comprise a second Ig C.sub.H3 domain, wherein the first and second Ig C.sub.H3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the targeting construct to Protein A as compared to a reference construct having identical M1 and M2 sequences. In one embodiment, the Ig C.sub.H3 domain of M1 binds Protein A and the Ig C.sub.H3 domain of M2 contains a mutation that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering). The C.sub.H3 of M2 may further comprise a Y96F modification (by IMGT; Y436F by EU). Further modifications that may be found within the C.sub.H3 of M2 include: D16E, L18M, N44S, K52N, V57M, and V82I (by IMGT; D356E, L358M, N384S, K392N, V397M, and V422I by EU) in the case of an IgG1 Fc domain; N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by EU) in the case of an IgG2 Fc domain; and Q15R, N44S, K52N, V57M, R69K, E79Q, and V82I (by IMGT; Q355R, N384S, K392N, V397M, R409K, E419Q, and V422I by EU) in the case of an IgG4 Fc domain.
[0106] The bispecific antigen-binding molecules of the disclosure may be isolated. An isolated bispecific antigen-binding molecule, as used herein, means a bispecific antigen-binding molecule that has been identified and separated and/or recovered from at least one component of its natural environment. For example, a bispecific antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody is produced, is an isolated bispecific antibody for purposes of the present disclosure. An isolated bispecific antigen-binding molecule also includes molecules in situ within a recombinant cell. Isolated bispecific antigen-binding molecules are molecules that have been subjected to at least one purification or isolation step. According to certain embodiments, an isolated bispecific antigen-binding molecule may be substantially free of other cellular material and/or chemicals.
[0107] The bispecific antigen-binding molecules disclosed herein, or the antigen-binding domains thereof (D1 and/or D2) may comprise one or more amino acid substitutions, insertions and/or deletions in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences from which the antigen-binding proteins or antigen-binding domains were derived. Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases. The present disclosure includes bispecific antigen-binding molecules disclosed herein, or the antigen-binding domains thereof (D1 and/or D2), which are derived from any of the amino acid sequences disclosed herein, wherein one or more amino acids within one or more framework and/or CDR regions are mutated to the corresponding residue(s) of the germline sequence from which the antibody was derived, or to the corresponding residue(s) of another human germline sequence, or to a conservative amino acid substitution of the corresponding germline residue(s) (such sequence changes are referred to herein collectively as germline mutations).
[0108] A person of ordinary skill in the art, starting with the heavy and light chain variable region sequences disclosed herein, can easily produce numerous bispecific antigen-binding molecules, or antigen-binding domains thereof (D1 and/or D2), which comprise one or more individual germline mutations or combinations thereof. In certain embodiments, all of the framework and/or CDR residues within the V.sub.H and/or V.sub.L domains are mutated back to the residues found in the original germline sequence from which the antibody was derived. In other embodiments, only certain residues are mutated back to the original germline sequence, e.g., only the mutated residues found within the first 8 amino acids of FR1 or within the last 8 amino acids of FR4, or only the mutated residues found within CDR1, CDR2 or CDR3. In other embodiments, one or more of the framework and/or CDR residue(s) are mutated to the corresponding residue(s) of a different germline sequence (i.e., a germline sequence that is different from the germline sequence from which the antibody was originally derived).
[0109] Furthermore, the bispecific antigen-binding molecules, or the antigen-binding domains thereof (D1 and/or D2), of the present disclosure may contain any combination of two or more germline mutations within the framework and/or CDR regions, e.g., wherein certain individual residues are mutated to the corresponding residue of a particular germline sequence while certain other residues that differ from the original germline sequence are maintained or are mutated to the corresponding residue of a different germline sequence. Once obtained, bispecific antigen-binding molecules, or the antigen-binding domains thereof (D1 and/or D2), that contain one or more germline mutations can be easily tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc. Bispecific antigen-binding molecules, or the antigen-binding domains thereof (D1 and/or D2), obtained in this general manner are encompassed within the present disclosure.
Variants
[0110] The present disclosure also includes anti-HER2 antibodies and bispecific antigen-binding molecules comprising variants of any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein. Exemplary variants included within this aspect include variants of any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein having one or more substitutions, for example, conservative substitutions. In some aspects, the present disclosure includes anti-HER2 antibodies and HER2?HER2 bispecific antigen-binding molecules having HCVR, LCVR, and/or CDR amino acid sequences with, e.g., 10 or fewer, 8 or fewer, 6 or fewer, 4 or fewer, 3 or fewer, 2, or 1 amino acid substitutions relative to any of the HCVR, LCVR, and/or CDR amino acid sequences set forth in Table 1 herein, where the modified antibodies and bispecific antigen-binding molecules maintain the binding activity against HER2.
[0111] Exemplary variants included within this aspect of the disclosure also include variants having substantial sequence identity to any of the HCVR, LCVR, and/or CDR amino acid sequences disclosed herein. As used herein in the context of amino acid sequences, the term substantial identity or substantially identical means that two amino acid sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 95%, 98% or 99% sequence identity. In certain embodiments, residue positions which are not identical differ by conservative amino acid substitutions. A conservative amino acid substitution is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of similarity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well-known to those of skill in the art. See, e.g., Pearson (1994) Methods Mol. Biol. 24: 307-331, herein incorporated by reference. Examples of groups of amino acids that have side chains with similar chemical properties include (1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; (2) aliphatic-hydroxyl side chains: serine and threonine; (3) amide-containing side chains: asparagine and glutamine; (4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; (5) basic side chains: lysine, arginine, and histidine; (6) acidic side chains: aspartate and glutamate, and (7) sulfur-containing side chains: cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine. Alternatively, a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443-1445, herein incorporated by reference. A moderately conservative replacement is any change having a nonnegative value in the PAM250 log-likelihood matrix.
[0112] Sequence identity between two different amino acid sequences is typically measured using sequence analysis software. Sequence analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. For instance, GCG software contains programs such as GAP and BESTFIT which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species of organisms or between a wild type protein and a mutein thereof. See, e.g., GCG Version 6.1. Polypeptide sequences also can be compared using FASTA using default or recommended parameters, a program in GCG Version 6.1. FASTA (e.g., FASTA2 and FASTA3) provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (Pearson (2000) supra). Another preferred algorithm when comparing a sequence provided herein to a database containing a large number of sequences from different organisms is the computer program BLAST, especially BLASTP or TBLASTN, using default parameters. See, e.g., Altschul et al. (1990) J. Mol. Biol. 215:403-410 and Altschul et al. (1997) Nucleic Acids Res. 25:3389-402, each herein incorporated by reference.
HER2?HER2 Bispecific Antigen-Binding Molecules Comprising Fc Variants
[0113] According to certain embodiments provided herein, HER2?HER2 bispecific antigen binding proteins are provided comprising an Fc domain comprising one or more mutations which enhance or diminish antibody binding to the FcRn receptor, e.g., at acidic pH as compared to neutral pH. For example, the present disclosure includes HER2?HER2 bispecific antigen binding proteins comprising a mutation in the C.sub.H2 or a C.sub.H3 region of the Fc domain, wherein the mutation(s) increases the affinity of the Fc domain to FcRn in an acidic environment (e.g., in an endosome where pH ranges from about 5.5 to about 6.0). Such mutations may result in an increase in serum half-life of the antibody when administered to an animal. Non-limiting examples of such Fc modifications include, e.g., a modification at position 250 (e.g., E or Q); 250 and 428 (e.g., L or F); 252 (e.g., L/Y/F/W or T), 254 (e.g., S or T), and 256 (e.g., S/R/Q/E/D or T); or a modification at position 428 and/or 433 (e.g., H/L/R/S/P/Q or K) and/or 434 (e.g., H/F or Y); or a modification at position 250 and/or 428; or a modification at position 307 or 308 (e.g., 308F, V308F), and 434. In one embodiment, the modification comprises a 428L (e.g., M428L) and 434S (e.g., N434S) modification; a 428L, 2591 (e.g., V2591), and 308F (e.g., V308F) modification; a 433K (e.g., H433K) and a 434 (e.g., 434Y) modification; a 252, 254, and 256 (e.g., 252Y, 254T, and 256E) modification; a 250Q and 428L modification (e.g., T250Q and M428L); and a 307 and/or 308 modification (e.g., 308F or 308P).
[0114] For example, the present disclosure includes HER2?HER2 bispecific antigen binding proteins comprising an Fc domain comprising one or more pairs or groups of mutations selected from the group consisting of: 250Q and 248L (e.g., T250Q and M248L); 252Y, 254T and 256E (e.g., M252Y, S254T and T256E); 428L and 434S (e.g., M428L and N434S); and 433K and 434F (e.g., H433K and N434F). All possible combinations of the foregoing Fc domain mutations, and other mutations within the antibody variable domains disclosed herein, are contemplated within the scope of the present disclosure.
Biological Characteristics of the Antigen-Binding Molecules Provided Herein
[0115] Provided herein are HER2?HER2 bispecific antigen-binding proteins that bind human HER2 (e.g., hErbB2 ecto-mFc) with high affinity. For example, the present disclosure includes anti-HER2?HER2 bispecific antigen-binding proteins that bind human HER2 with a K.sub.D of less than about 3 nM as measured by surface plasmon resonance at 25? C., e.g., using an assay format as defined in Example 8 herein, or a substantially similar assay. According to certain embodiments, anti-HER2 antibodies are provided that bind human HER2 at 25? C. with a K.sub.D of less than about 1 nM, less than about 0.9 nM, less than about 0.8 nM, less than about 0.7 nM, less than about 0.6 nM, less than about 0.5 nM, less than about 0.4 nM, less than about 0.3 nM, less than about 0.25 nM, less than about 200 pM, less than about 150 pM, less than about 100 nM, or less than 50 pM, as measured by surface plasmon resonance, e.g., using an assay format as defined in Example 8 herein, or a substantially similar assay.
[0116] Also provided herein are HER2?HER2 bispecific antigen-binding proteins that bind human HER2 (e.g., hErbB2 ecto-mFc) with a dissociative half-life (t?) of greater than about 20 minutes as measured by surface plasmon resonance at 25? C., e.g., using an assay format as defined in Example 8 herein, or a substantially similar assay. According to certain embodiments, HER2?HER2 bispecific antigen-binding proteins are provided that bind human HER2 at 25? C. with a t? of greater than about 20 minutes, greater than about 25 minutes, greater than about 30 minutes, greater than about 40 minutes, greater than about 50 minutes, greater than about 60 minutes, greater than about 70 minutes, greater than about 80 minutes, greater than about 90 minutes, greater than about 100 minutes, greater than about 200 minutes, greater than about 300 minutes, greater than about 400 minutes, greater than about 500 minutes, greater than about 600 minutes, greater than about 700 minutes, greater than about 800 minutes, greater than about 900 minutes, greater than about 1000 minutes, greater than about 1100 minutes, or longer, as measured by surface plasmon resonance, e.g., using an assay format as defined in Example 8 herein, or a substantially similar assay.
[0117] Also provided herein are HER2?HER2 bispecific antigen-binding proteins that exhibit internalization in early endosomes and trafficking from early endosomes to lysosomes. Also provided herein are HER2?HER2 bispecific antigen-binding proteins that form surface clusters and induce internalization of HER2.
[0118] The antigen-binding proteins of the present disclosure may possess one or more of the aforementioned biological characteristics, or any combination thereof. The foregoing list of biological characteristics of the antibodies is not intended to be exhaustive. Other biological characteristics of the antibodies provided herein will be evident to a person of ordinary skill in the art from a review of the present disclosure including the working Examples herein.
Antibody-Drug Conjugates (ADCs)
[0119] Provided herein are antibody-drug conjugates (ADCs) comprising a HER2?HER2 bispecific antigen-binding protein conjugated to a therapeutic moiety such as a cytotoxic agent, a chemotherapeutic drug, or a radioisotope.
[0120] Cytotoxic agents include any agent that is detrimental to the growth, viability or propagation of cells, including, but not limited to, tubulin-interacting agents and DNA-damaging agents. In some embodiments, the cytotoxic agent is a tubulin inhibitor. In particular embodiments, the tubulin inhibitor inhibits tubulin polymerization. In some embodiments, the cytotoxic payload is a topoisomerase I inhibitor. In some embodiments, the cytotoxic agent is a maytansinoid, an auristatin, a hemiasterlin, a vinblastine, a vincristine, a pyrrolobenzodiazepine, a paclitaxel, a docetaxel, a cryptophycin, a tubulysin, or a camptothecin. Examples of suitable cytotoxic agents and chemotherapeutic agents that can be conjugated to anti-HER2 antibodies in accordance with this aspect of the disclosure also include, e.g., 1-(2chloroethyl)-1,2-dimethanesulfonyl hydrazide, 1,8-dihydroxy-bicyclo[7.3.1]trideca-4,9-diene-2,6-diyne-13-one, 1-dehydrotestosterone, 5-fluorouracil, 6-mercaptopurine, 6-thioguanine, 9-amino camptothecin, actinomycin D, amanitins, aminopterin, anguidine, anthracycline, anthramycin (AMC), auristatins, bleomycin, busulfan, butyric acid, calicheamicins (e.g., calicheamicin ?.sub.1), camptothecin, carminomycins, carmustine, cemadotins, cisplatin, colchicin, combretastatins, cyclophosphamide, cytarabine, cytochalasin B, dactinomycin, daunorubicin, decarbazine, diacetoxypentyldoxorubicin, dibromomannitol, dihydroxy anthracin dione, disorazoles, dolastatin (e.g., dolastatin 10), doxorubicin, duocarmycin, echinomycins, eleutherobins, emetine, epothilones, esperamicin, estramustines, ethidium bromide, etoposide, fluorouracils, geldanamycins, gramicidin D, glucocorticoids, irinotecans, kinesin spindle protein (KSP) inhibitors, leptomycins, leurosines, lidocaine, lomustine (CCNU), maytansinoids, mechlorethamine, melphalan, mercatopurines, methopterins, methotrexate, mithramycin, mitomycin, mitoxantrone, N8-acetyl spermidine, podophyllotoxins, procaine, propranolol, pteridines, puromycin, pyrrolobenzodiazepines (PBDs), rhizoxins, streptozotocin, tallysomycins, taxol, tenoposide, tetracaine, thioepa chlorambucil, tomaymycins, topotecans, tubulysin, vinblastine, vincristine, vindesine, vinorelbines, and derivatives of any of the foregoing. According to certain embodiments, the cytotoxic agent that is conjugated to an anti-HER2 antibody is a maytansinoid such as DM1 or DM4, a tomaymycin derivative, or a dolastatin derivative. According to certain embodiments, the cytotoxic agent that is conjugated to an anti-HER2 antibody is an auristatin such as MMAE, MMAF, or derivatives thereof. In some embodiments, the cytotoxic agent is Dxd or a derivative thereof. In some embodiments, the cytotoxic agent is AZ13599185 (see, e.g., Li et. al., 2016 Cancer Cell 29, 117-129). Other cytotoxic agents known in the art are contemplated within the scope of the present disclosure, including, e.g., protein toxins such ricin, C. difficile toxin, pseudomonas exotoxin, ricin, diphtheria toxin, botulinum toxin, bryodin, saporin, pokeweed toxins (i.e., phytolaccatoxin and phytolaccigenin), and others such as those set forth in Sapra et al., Pharmacol. & Therapeutics, 2013, 138:452-469. In some embodiments, the cytotoxic agent is a tubulysin, a maytansinoid, or a camptothecin.
[0121] In certain embodiments, the cytotoxic agent is a tubulysin. Suitable tubulysins include those described in U.S. patent application Ser. No. 16/724,164 filed Dec. 20, 2019. In some embodiments, the tubulysin is Compound IVa, IVa, IVb, IVc, IVd, IVe, IVf, IVg, IVh, IVj, IVk, IV-I, IVm, IVn, IVo, IVp, IVq, IVr, IVs, IVt, IVu, IVvA, IVvB, IVw, IVx, IVy, Va, Va, Vb, Vc, Vd, Ve, Vf, Vg, Vh, Vi, Vj, Vk, Via, VIb, VIc, VId, VIe, VIf, VIg, VIh, VI, VII, VII, VIII, IX, X, D-5a, or D-5c from U.S. patent application Ser. No. 16/724,164 filed Dec. 20, 2019. In certain embodiments, the tubulysin is Compound Ve in U.S. patent application Ser. No. 16/724,164 filed Dec. 20, 2019. In some embodiments, the tubulysin has the following structure:
##STR00001##
[0122] Tubulysin 1A can be prepared using the methods disclosed in U.S. Ser. No. 16/724,164 filed Dec. 20, 2019.
[0123] In certain embodiments, the cytotoxic agent is a maytansinoid, e.g., derivative of maytansine. Suitable maytansinoids include DM1, DM4, or derivatives, stereoisomers, or isotopologues thereof. Suitable maytansinoids also include, but are not limited to, those disclosed in WO 2014/145090A1, WO 2015/031396A1, US 2016/0375147A1, and US 2017/0209591A1, incorporated herein by reference in their entireties. In some embodiments, the maytansinoid is DM1.
[0124] In some embodiments, the maytansinoid has the following structure:
##STR00002## [0125] wherein A is an optionally substituted arylene or heteroarylene.
[0126] In some embodiments, the maytansinoid has the following structure:
##STR00003## [0127] wherein A is an optionally substituted arylene or heteroarylene.
[0128] In some embodiments, the maytansinoid has the following structure:
##STR00004## [0129] wherein n is an integer from 1-12 and R1 is alkyl.
[0130] In some embodiments, the maytansinoid is:
##STR00005## ##STR00006## ##STR00007## ##STR00008## ##STR00009## ##STR00010##
[0131] In some embodiments, the maytansinoid is:
##STR00011##
[0132] In some embodiments, the maytansinoid is:
##STR00012##
[0133] In some embodiments, the cytotoxic agent is a camptothecin, e.g., analog or derivative of camptothecin. In some embodiments, the HER2?HER2 bispecific antigen-binding protein e.g., antibody, is conjugated to exatecan, deruxtecan, DX-8951, DXd, camptothecin, or derivatives or analogs thereof. In particular embodiments, the cytotoxic agent is DXd. In particular embodiments, the cytotoxic agent is:
##STR00013##
[0134] Also provided herein are antibody-radionuclide conjugates (ARCs) comprising anti-HER2 antibodies conjugated to one or more radionuclides. Exemplary radionuclides that can be used in the context of this aspect of the disclosure include, but are not limited to, e.g., .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.131I, .sup.186Re, .sup.227Th, .sup.222Rn, .sup.223Ra, .sup.224Ra, and .sup.90Y.
[0135] In certain embodiments provided herein, ADCs are provided comprising a HER2?HER2 bispecific antigen-binding protein conjugated to a cytotoxic agent (e.g., any of the cytotoxic agents disclosed above) via a linker molecule. Linkers are any group or moiety that links, connects, or bonds the antibody or antigen-binding proteins described herein with a therapeutic moiety, e.g. cytotoxic agent. Suitable linkers may be found, for example, in Antibody-Drug Conjugates and Immunotoxins; Phillips, G. L., Ed.; Springer Verlag: New York, 2013; Antibody-Drug Conjugates; Ducry, L., Ed.; Humana Press, 2013; Antibody-Drug Conjugates; Wang, J., Shen, W.-C., and Zaro, J. L., Eds.; Springer International Publishing, 2015, the contents of each incorporated herein in their entirety by reference. Generally, suitable binding agent linkers for the antibody conjugates described herein are those that are sufficiently stable to exploit the circulating half-life of the antibody and, at the same time, capable of releasing its payload after antigen-mediated internalization of the conjugate. Linkers can be cleavable or non-cleavable. Cleavable linkers include linkers that are cleaved by intracellular metabolism following internalization, e.g., cleavage via hydrolysis, reduction, or enzymatic reaction. Non-cleavable linkers include linkers that release an attached payload via lysosomal degradation of the antibody following internalization. Suitable linkers include, but are not limited to, acid-labile linkers, hydrolysis-labile linkers, enzymatically cleavable linkers, reduction labile linkers, self-immolative linkers, and non-cleavable linkers. Suitable linkers also include, but are not limited to, those that are or comprise peptides, glucuronides, succinimide-thioethers, polyethylene glycol (PEG) units, hydrazones, mal-caproyl units, dipeptide units, valine-citruline units, and para-aminobenzyl (PAB) units.
[0136] Any linker molecule or linker technology known in the art can be used to create or construct an ADC of the present disclosure. In certain embodiments, the linker is a cleavable linker. According to other embodiments, the linker is a non-cleavable linker. Exemplary linkers that can be used in the context of the present disclosure include, linkers that comprise or consist of e.g., MC (6-maleimidocaproyl), MP (maleimidopropanoyl), val-cit (valine-citrulline), val-ala (valine-alanine), dipeptide site in protease-cleavable linker, ala-phe (alanine-phenylalanine), dipeptide site in protease-cleavable linker, PAB (p-aminobenzyloxycarbonyl), SPP (N-Succinimidyl 4-(2-pyridylthio) pentanoate), SMCC (N-Succinimidyl 4-(N-maleimidomethyl)cyclohexane-1 carboxylate), SIAB (N-Succinimidyl (4-iodo-acetyl)aminobenzoate), and variants and combinations thereof. Additional examples of linkers that can be used in the context of the present disclosure are provided, e.g., in U.S. Pat. No. 7,754,681 and in Ducry, Bioconjugate Chem., 2010, 21:5-13, and the references cited therein, the contents of which are incorporated by reference herein in their entireties.
[0137] In certain embodiments, the linkers are stable in physiological conditions. In certain embodiments, the linkers are cleavable, for instance, able to release at least the payload portion in the presence of an enzyme or at a particular pH range or value. In some embodiments, a linker comprises an enzyme-cleavable moiety. Illustrative enzyme-cleavable moieties include, but are not limited to, peptide bonds, ester linkages, hydrazones, and disulfide linkages. In some embodiments, the linker comprises a cathepsin-cleavable linker.
[0138] In some embodiments, the linker comprises a non-cleavable moiety.
[0139] Suitable linkers also include, but are not limited to, those that are chemically bonded to two cysteine residues of a single binding agent, e.g., antibody. Such linkers can serve to mimic the antibody's disulfide bonds that are disrupted as a result of the conjugation process.
[0140] In some embodiments, the linker comprises one or more amino acids. In some embodiments, the linker comprises two amino acids. In some embodiments, the linker comprises three amino acids. In some embodiments, the linker comprises four amino acids. Suitable amino acids include natural, non-natural, standard, non-standard, proteinogenic, non-proteinogenic, and L- or D-?-amino acids. In some embodiments, the linker comprises alanine, valine, glycine, leucine, isoleucine, methionine, tryptophan, phenylalanine, proline, serine, threonine, cysteine, tyrosine, asparagine, glutamine, aspartic acid, glutamic acid, lysine, arginine, histidine, or citrulline, a derivative thereof, or combination thereof. In certain embodiments, one or more side chains of the amino acids is linked to a side chain group, described below. In some embodiments, the linker comprises valine and citrulline. In some embodiments, the linker comprises lysine, valine, and citrulline. In some embodiments, the linker comprises lysine, valine, and alanine. In some embodiments, the linker comprises valine and alanine. In some embodiments, the linker comprises a dipeptide, tripeptide, or tetrapeptide. In some embodiments, the linker comprises a peptide, wherein the peptide is valine-citruline (val-cit or VC), glutamic acid-valine-citruline (EVC), or glycine-glycine-phenylalanine-glycine (GGFC).
[0141] In some embodiments, the linker comprises a self-immolative group. The self-immolative group can be any such group known to those of skill. In particular embodiments, the self-immolative group is p-aminobenzyl (PAB), or a derivative thereof. Useful derivatives include p-aminobenzyloxycarbonyl (PABC). In some embodiments, the linker comprises a moiety having the following structure:
##STR00014##
[0142] Those of skill will recognize that a self-immolative group is capable of carrying out a chemical reaction which releases the remaining atoms of a linker from a payload.
[0143] In some embodiments, the linker is:
##STR00015## [0144] wherein
##STR00016##
is a bond to the antibody or antigen-binding protein (e.g., via lysine residue) and
##STR00017##
is a bond to the cytotoxic agent (e.g., DM1). In some embodiments, the linker is:
##STR00018## [0145] wherein
##STR00019##
is a bond to the antibody or antigen-binding protein (e.g., via lysine residue) and
##STR00020##
is a bond to the cytotoxic agent (e.g., DM1). In certain embodiments, the linker is:
##STR00021##
[0146] In certain embodiments, the linker is:
##STR00022##
[0147] In some embodiments, the linker is derived from maleimidylmethyl-4-trans-cyclohexanecarboxysuccinate:
##STR00023##
[0148] In some embodiments, the linker is:
##STR00024## [0149] wherein
##STR00025##
is a bond to the antibody or antigen-binding protein (e.g., via lysine residue) and
##STR00026##
is a bond to the cytotoxic agent (e.g., a compound having the following formula:
##STR00027##
[0150] Suitable linkers also include, but are not limited to, linkers that comprise one or more cyclic moieties. In some embodiments, the cyclic moiety is derived from a cycloaddition reaction. In certain embodiments, the cyclic moiety is derived from a 1-3-cycloaddition reaction between an azide and alkyne, e.g., cycloalkyne. In some embodiments, the cyclic moiety is
##STR00028##
[0151] In some embodiments, the linker comprises one or more spacers. Suitable spacers include moieties that link, e.g. covalently or through ionic interaction, two linker portions, a linker portion with a payload, or a linker portion with an antibody. In certain embodiments, the spacer is a PEG group.
[0152] The present disclosure comprises ADCs in which a linker connects a HER2?HER2 bispecific antigen-binding protein to a drug or cytotoxin through an attachment at a particular amino acid within the antibody or antigen-binding molecule. Exemplary amino acid attachments that can be used in the context of this aspect, e.g., lysine (see, e.g., U.S. Pat. No. 5,208,020; US 2010/0129314; Hollander et al., Bioconjugate Chem., 2008, 19:358-361; WO 2005/089808; U.S. Pat. No. 5,714,586; US 2013/0101546; and US 2012/0585592), cysteine (see, e.g., US 2007/0258987; WO 2013/055993; WO 2013/055990; WO 2013/053873; WO 2013/053872; WO 2011/130598; US 2013/0101546; and U.S. Pat. No. 7,750,116), selenocysteine (see, e.g., WO 2008/122039; and Hofer et al., Proc. Natl. Acad. Sci., USA, 2008, 105:12451-12456), formyl glycine (see, e.g., Carrico et al., Nat. Chem. Biol., 2007, 3:321-322; Agarwal et al., Proc. Natl. Acad. Sci., USA, 2013, 110:46-51, and Rabuka et al., Nat. Protocols, 2012, 10:1052-1067), non-natural amino acids (see, e.g., WO 2013/068874, and WO 2012/166559), and acidic amino acids (see, e.g., WO 2012/05982). Linkers can also be conjugated to an antigen-binding protein via attachment to carbohydrates (see, e.g., US 2008/0305497, WO 2014/065661, and Ryan et al., Food & Agriculture Immunol., 2001, 13:127-130) and disulfide linkers (see, e.g., WO 2013/085925, WO 2010/010324, WO 2011/018611, and Shaunak et al., Nat. Chem. Biol., 2006, 2:312-313). Site specific conjugation techniques can also be employed to direct conjugation to particular residues of the antibody or antigen binding protein (see, e.g., Schumacher et al. J Clin Immunol (2016) 36 (Suppl 1): 100). Site specific conjugation techniques include, but are not limited to, glutamine conjugation via transglutaminase (see e.g., Schibli, Angew Chemie Inter Ed. 2010, 49, 9995).
[0153] According to certain embodiments, the present disclosure provides ADCs, wherein a HER2?HER2 bispecific antigen-binding protein as described herein is conjugated to a linker-drug composition as set forth in International Patent Publication WO2014/145090, (e.g., compound 7, also referred to herein as M0026 and depicted below), the disclosure of which is hereby incorporated by reference herein in its entirety:
##STR00029##
[0154] Provided herein are also antibody-drug conjugates comprising the monospecific anti-HER2 antibodies and HER2?HER2 bispecific antibodies disclosed herein, where said HER2?HER2 bispecific antibody is conjugated to a cytotoxic agent. In certain embodiments, the cytotoxic agent is a maytansinoid. In certain embodiments, the maytansinoid is a compound having the following formula:
##STR00030## [0155] wherein n is an integer from 1-12 and R1 is alkyl. In certain embodiments, the maytansinoid is
##STR00031##
[0156] In certain embodiments, the cytotoxic agent is a maytansinoid, and the maytansinoid is covalently attached to the antibody via non-cleavable linker. In certain embodiments, the cytotoxic agent is a maytansinoid, and the maytansinoid is covalently attached to the bispecific antibody via cleavable linker.
[0157] In one embodiment, the bispecific antibody is conjugated to:
##STR00032## [0158] wherein
##STR00033##
is a bond to the antibody.
[0159] In one embodiment, the bispecific antibody is conjugated to:
##STR00034## [0160] wherein
##STR00035##
is a bond to the antibody.
[0161] In one embodiment, the bispecific antibody is conjugated to:
##STR00036## [0162] wherein
##STR00037##
is a bond to the antibody.
[0163] In one embodiment, the bispecific antibody is conjugated to:
##STR00038## [0164] wherein
##STR00039##
is a bond to the antibody.
[0165] In some embodiments, the bispecific antibody is conjugated to:
##STR00040## [0166] wherein L is a linker and
##STR00041##
is a bond to the antibody.
[0167] In some embodiments, the bispecific antibody is conjugated to:
##STR00042## [0168] or a regioisomer thereof, wherein SP is a spacer and
##STR00043##
is a bond to the antibody.
[0169] In some embodiments, the bispecific antibody is conjugated to:
##STR00044##
[0170] or regioisomer thereof, wherein
##STR00045##
is a bond to a glutamine residue of the antibody. In certain embodiments, the glutamine is a heavy chain Q295 glutamine. In certain embodiments, the bispecific antibody is conjugated to a heavy chain Q295 and Q297, wherein said Q297 is derived from an N297Q mutation.
[0171] In some embodiment, the bispecific antibody is conjugated to:
##STR00046## [0172] wherein
##STR00047##
is a bond to a glutamine residue of the antibody. In certain embodiments, the glutamine is a heavy chain Q295 glutamine. In certain embodiments, the bispecific antibody is conjugated to a heavy chain Q295 and Q297, wherein said Q297 is derived from an N297Q mutation.
[0173] In some embodiments, the conjugates have the following structure:
##STR00048## [0174] wherein: [0175] Ab is a HER2?HER2 bispecific antigen-binding protein as described herein; [0176] L is a linker; [0177] Pay is a cytotoxic agent; and [0178] n is an integer from 1-12.
[0179] In some embodiments, n is 2. In some embodiments, n is 4. In some embodiments, Pay is:
##STR00049##
[0180] In some embodiments, L is a cleavable linker. In some embodiments, L comprises a peptide. In some embodiments, L comprises val-cit. In some embodiments, L comprises
##STR00050##
[0181] In some embodiments, L comprises a PEG group. In some embodiments, L comprises a cyclic moiety. In certain embodiments, the cyclic moiety is the product of a 1,3-cycloaddition between an azide and a cycloalkyne. In some embodiments, -L-Pay is
##STR00051## [0182] wherein SP.sup.1 and SP.sup.2 are each independently a spacer,
##STR00052##
is a cyclic moiety, and
##STR00053##
is a bond to a heavy chain glutamine. In some embodiments, the glutamine cyclic moiety, and is a Q295 glutamine. In some embodiments, n is 2, wherein two L-Pay are conjugated to Q295. In some embodiments, n is 4, wherein two L-Pay are conjugated to Q295 and two L-Pay are conjugated to Q297. In some embodiments, the cyclic moiety is a product of a cycloaddition reaction. In certain embodiments, the cyclic moiety is a product of a cycloaddition reaction between an azide and cycloalkyne. In certain embodiments, the cyclic moiety is
##STR00054##
[0183] In certain embodiments, SP.sup.1 comprises a PEG moiety. In certain embodiments, SP.sup.2 comprise a dipeptide. In certain embodiments, SP.sup.2 comprises val-cit. In certain embodiments, SP.sup.2 comprises
##STR00055##
[0184] In certain embodiments, SP.sup.2 comprises a PEG moiety. In some embodiments, SP2-Pay is:
##STR00056##
[0185] In certain embodiments,
##STR00057##
is
##STR00058##
or a regioisomer thereof.
[0186] In certain embodiments,
##STR00059##
is
##STR00060##
(tubulysin 1b) or a regioisomer thereof, wherein
##STR00061##
is a bond to the antibody.
[0187] In some embodiments, the Ab is conjugated to a linker-payload or payload disclosed in WO2015/157592, e.g., compound T32 disclosed therein. In some embodiments, the Ab is conjugated to deruxtecan (DXd), optionally through a linker comprising GGFG.
[0188] In some embodiments, Ab is a HER2?HER2 bispecific antigen-binding protein comprising the CDRs within the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the CDRs within the D2-HCVR amino acid sequence of SEQ ID NO: 10. In some aspects, the HER2?HER2 bispecific antigen-binding protein further comprises the CDRs within the LCVR amino acid sequence of SEQ ID NO: 18. In some embodiments, Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10. In some aspects, the HER2?HER2 bispecific antigen-binding protein further comprises the LCVR amino acid sequence of SEQ ID NO: 18.
[0189] In some embodiments, Ab is a HER2?HER2 bispecific antigen-binding protein comprising the CDRs within the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the CDRs within the D2-HCVR amino acid sequence of SEQ ID NO: 40. In some aspects, the HER2?HER2 bispecific antigen-binding protein further comprises the CDRs within the LCVR amino acid sequence of SEQ ID NO: 18. In some embodiments, Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40. In some aspects, the HER2?HER2 bispecific antigen-binding protein further comprises the LCVR amino acid sequence of SEQ ID NO: 18.
[0190] In some embodiments, L is a cleavable linker. In some embodiments, L is a non-cleavable linker. In some embodiments, L comprises a dipeptide. In some embodiments, L comprises a PAB moiety.
[0191] In some embodiments, L comprises a moiety having the following structure:
##STR00062##
[0192] In some embodiments, L comprises a moiety having the following structure:
##STR00063##
[0193] In some embodiments, L comprises a moiety having the following structure:
##STR00064##
[0194] In some embodiments, L comprises a moiety having the following structure:
##STR00065##
[0195] In some embodiments, Pay is a tubulysin.
[0196] In some embodiments, Pay is a maytansinoid.
[0197] In some embodiments, Pay is:
##STR00066## [0198] wherein R.sup.1 is alkyl.
[0199] In some embodiments, Pay is:
##STR00067##
[0200] In some embodiments, Pay is:
##STR00068##
[0201] In some embodiments, n is an integer from 2 to 5.
[0202] In some embodiments, -L-Pay is:
##STR00069## [0203] wherein
##STR00070##
is a bond to the antibody.
[0204] In some embodiments, -L-Pay is:
##STR00071## [0205] wherein
##STR00072##
is a bond to the antibody.
[0206] In some embodiments, -L-Pay is
##STR00073## [0207] wherein
##STR00074##
is a bond to the antibody.
[0208] In some embodiments, -L-Pay is:
##STR00075## [0209] wherein
##STR00076##
is a bond to the antibody.
[0210] In some embodiments -Pay is
##STR00077##
[0211] In some embodiments, -L-Pay is:
##STR00078##
[0212] In particular embodiments, L-Pay is
##STR00079##
and n is 2.
[0213] In some embodiments, the conjugates have the following structure:
##STR00080## [0214] wherein: [0215] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; [0216] L-Pay is
##STR00081## [0217] wherein
##STR00082##
is a bond to the antigen binding protein; and n is an integer from 2-5.
[0218] In some embodiments, the conjugates have the following structure:
##STR00083## [0219] wherein: [0220] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; [0221] L-Pay is
##STR00084## [0222] wherein
##STR00085##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0223] In some embodiments, the conjugates have the following structure:
##STR00086## [0224] wherein: [0225] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; [0226] L-Pay is
##STR00087## [0227] wherein
##STR00088##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0228] In some embodiments, the conjugates have the following structure:
##STR00089## [0229] wherein: [0230] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; [0231] L-Pay is
##STR00090## [0232] wherein
##STR00091##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0233] In some embodiments, the conjugates have the following structure:
##STR00092## [0234] wherein: [0235] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; [0236] L-Pay is
##STR00093## [0237] wherein
##STR00094##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0238] In some embodiments, the conjugates have the following structure:
##STR00095## [0239] wherein: [0240] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; [0241] L-Pay is
##STR00096## [0242] wherein
##STR00097##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0243] In some embodiments, the conjugates have the following structure:
##STR00098## [0244] wherein: [0245] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; [0246] L-Pay is
##STR00099## [0247] wherein
##STR00100##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0248] In some embodiments, the conjugates have the following structure:
##STR00101## [0249] wherein: [0250] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; [0251] L-Pay is
##STR00102## [0252] wherein
##STR00103##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0253] In some embodiments, the conjugates have the following structure:
##STR00104## [0254] wherein: [0255] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; Pay is
##STR00105## [0256] wherein
##STR00106##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0257] In some embodiments, the conjugates have the following structure:
##STR00107## [0258] wherein: [0259] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; Pay is
##STR00108## [0260] wherein
##STR00109##
is a bond to the antigen-binding protein; and n is an integer from 2-5.
[0261] In some embodiments, the conjugates have the following structure:
##STR00110## [0262] wherein: [0263] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; [0264] L-Pay is
##STR00111## [0265] wherein
##STR00112##
is a bond to a heavy chain glutamine. In some embodiments, n is 2. In certain embodiments, n is 2 and L-Pay is bonded to Q295 glutamines. In some embodiments, n is 4. In certain embodiments, n is 4 and L-Pay is bonded to Q295 and Q297 glutamines.
[0266] In some embodiments, the conjugates have the following structure:
##STR00113## [0267] wherein: [0268] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; [0269] L-Pay is
##STR00114## [0270] wherein
##STR00115##
is a bond to a heavy chain glutamine. In some embodiments, n is 2. In certain embodiments, n is 2 and L-Pay is bonded to Q295 glutamines. In some embodiments, n is 4. In certain embodiments, n is 4 and L-Pay is bonded to Q295 and Q297 glutamines.
[0271] In some embodiments, the conjugates have the following structure:
##STR00116## [0272] wherein: [0273] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; Pay is
##STR00117##
[0274] In some embodiments, the conjugates have the following structure:
##STR00118## [0275] wherein: [0276] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; Pay is
##STR00119##
[0277] In some embodiments, the conjugates have the following structure:
##STR00120## [0278] wherein: [0279] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10; [0280] L-Pay is
##STR00121## [0281] wherein
##STR00122##
is a bond to a heavy chain glutamine of the binding protein. In some embodiments, n is 2. In certain embodiments, n is 2 and L-Pay is bonded to Q295 glutamines. In some embodiments, n is 4. In certain embodiments, n is 4 and L-Pay is bonded to Q295 and Q297 glutamines.
[0282] In some embodiments, the conjugates have the following structure:
##STR00123## [0283] wherein: [0284] Ab is a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40; [0285] L-Pay is
##STR00124##
wherein
##STR00125##
is a bond to a heavy chain glutamine of the binding protein. In some embodiments, n is 2. In certain embodiments, n is 2 and L-Pay is bonded to Q295 glutamines. In some embodiments, n is 4. In certain embodiments, n is 4 and L-Pay is bonded to Q295 and Q297 glutamines.
[0286] The antibody drug conjugates described herein can be prepared using conjugation conditions known to those of ordinary skill in the art, (see, e.g., Doronina et al. Nature Biotechnology 2003, 21, 7, 778, which is incorporated herein by reference in its entirety). In some embodiments a HER2?HER2 bispecific antigen-binding protein antibody drug conjugate is prepared by contacting a HER2?HER2 bispecific antigen-binding protein described herein with a compound comprising the desired linker and cytotoxic agent, wherein said linker possesses a moiety that is reactive with the antibody or antigen-binding protein, e.g., at the desired residue of the antibody or antigen-binding protein.
[0287] In some embodiments, the antibody drug conjugates provided herein are conjugated at heavy chain Q295 or Q297 glutamines. Antibodies comprising heavy chain Q297 glutamines can be prepared using techniques known in the art, e.g., through N297Q mutation. See, e.g., Bioconjugate Chem. 2014, 25, 3, 569 (2014). Such conjugation methods can provide antibody drug conjugates having a DAR of 2 or 4. In some embodiments, such methods comprise installing a first reactive moiety at the heavy chain glutamines by reacting the antibody with a primary amine compound comprising said first reactive moiety in the presence of transglutaminase to produce an antibody comprising the first reactive moiety at Q295, and optionally Q297. This product can be subsequently reacted with a payload having a linker and complementary second reactive moiety to provide antibody-drug conjugates provided herein. In some embodiments, the first reactive moiety is an azide. In some embodiments, the second reactive moiety is a cycloalkyne. In some embodiments, the payload having a linker and complementary second reactive moiety is:
##STR00126##
which can be prepared using methods described in U.S. patent application Ser. No. 16/724,164 filed Dec. 20, 2019 (e.g., compound LP4 described therein). In certain embodiments, the primary amine compound is
##STR00127##
[0288] In some embodiments, the payload having a linker and complementary second reactive moiety is:
##STR00128##
[0289] In certain embodiments, the primary amine compound is
##STR00129##
[0290] In some embodiments, provided herein are processes for preparing an antibody-drug conjugate comprising contacting a HER2?HER2 bispecific antigen-binding protein described herein with a compound having the following formula A.sup.1:
##STR00130##
and aqueous diluent.
[0291] In some embodiments, the compound of formula A.sup.1 is present in stoichiometric excess. In some embodiments, the compound of formula A.sup.1 is present in 5-6 fold stoichiometric excess. In some embodiments, the aqueous diluent comprises HEPES. In some embodiments, the aqueous diluent comprises DMA.
[0292] In some embodiments, the compound of formula A.sup.1 is a compound of formula A.sup.2 or A.sup.3:
##STR00131##
[0293] In some embodiments, the compound of formula A.sup.2 is A.sup.3 stereomerically pure. In some embodiments, the compound of formula A.sup.1 comprises a compound of formula A.sup.1 or A.sup.2, wherein the compound of A.sup.1 or A.sup.2 is present in a diastereomeric excess of more than 50%. In certain embodiments, the diastereomeric excess is more than 70%. In certain embodiments, the diastereomeric excess is more than 90%. In certain embodiments, the diastereomeric excess is more than 95%.
[0294] The term diastereomeric excess refers to the difference between the mole fraction of the desired single diastereomer as compared to the remaining diastereomers in a composition. Diastereomeric excess is calculated as follows: (amount of single diastereomer)-(amount of other diastereomers)/1. For example, a composition that contains 90% of 1 and 10% of 2, 3, 4, or a mixture thereof has a diastereomeric excess of 80% [(90-10)/1]. A composition that contains 95% of 1 and 5% of 2, 3, 4, or a mixture thereof has a diastereomeric excess of 90% [(95-5)/1]. A composition that contains 99% of 1 and 1% of 2, 3, 4, or a mixture thereof has a diastereomeric excess of 98% [(99?1)/1]. The diastereomeric excess can similarly be calculated for any one of 1, 2, 3, or 4.
[0295] In some embodiments, the compound of formula A1 is prepared by contacting a compound of formula (a):
##STR00132##
with a compound of formula (b)
##STR00133##
in the presence of silica gel and diluent. In some embodiments, the diluent comprises an organic solvent and water.
[0296] Provided herein is also the product prepared by the process of: [0297] (i) contacting a compound of formula (a):
##STR00134## [0298] with a compound of formula (b):
##STR00135## [0299] in the presence of silica gel and diluent to synthesize an intermediate; and [0300] (ii) contacting a HER2?HER2 bispecific antigen-binding protein described herein with the intermediate and aqueous diluent.
[0301] In some embodiments, provided herein are processes for preparing an antibody-drug conjugate comprising contacting a HER2?HER2 bispecific antigen-binding protein described herein with a compound having the following formula B:
##STR00136## [0302] wherein LG is a leaving group, and aqueous diluent.
[0303] In some embodiments, the compound of formula B is present in stoichiometric excess. In some embodiments, the compound of formula B is present in 5-6 fold stoichiometric excess. In some embodiments, the aqueous diluent comprises HEPES. In some embodiments, the aqueous diluent comprises DMA. In some embodiments, the C(O)-LG is an ester, e.g., NHS or trifluorophenyl ester.
[0304] In some embodiments, the compound of formula B is a compound of formula B1:
##STR00137##
[0305] In some embodiments, the compound of formula B1 is prepared by contacting a compound of formula C:
##STR00138##
with N-hydroxysuccinimide (NHS), a peptide coupling reagent, and an organic diluent. Suitable peptide coupling reagents include those that activate, i.e., render reactive, carboxylic acid moieties for reaction with a nucleophile. In certain embodiments, the peptide coupling reagent is N-(3-dimethylaminopropyl)-N-ethylcarbodiimide hydrochloride (EDC). In some embodiments, the organic solvent is dichloromethane.
[0306] In some embodiments, the compound of formula C is prepared by contacting a compound of formula D:
##STR00139##
with adipic acid, a peptide coupling agent, and an organic solvent. In certain embodiments, the peptide coupling agent is 2-ethoxy-1-ethoxycarbonyl-1,2-dihydroquinoline (EEDQ). In certain embodiments, the organic solvent comprises dichloromethane. Compound D can be prepared as described in WO2014/145090.
Epitope Mapping and Related Technologies
[0307] The epitope to which the antibodies and antigen-binding domains bind may consist of a single contiguous sequence of 3 or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more) amino acids of a HER2 protein. Alternatively, the relevant epitope may consist of a plurality of non-contiguous amino acids (or amino acid sequences) of HER2.
[0308] As described elsewhere herein, e.g. Examples 21 and 22, the individual antigen binding domains (D1 and D2) of the HER2?HER2 bispecific antigen-binding molecules may bind to distinct, or non-overlapping, or partially overlapping epitopes, relative to one another. As used herein, partially overlapping epitopes means that the first and second epitopes share less than 5, less than 4, less than 3, or only one common amino acid as determined by any epitope mapping methodology known in the art (e.g., X-ray crystallography, alanine-scan mutagenesis, hydrogen/deuterium exchange [HDX], domain swapping, etc.). The D1 and D2 domains may be non-competitive with one another. For example, in certain embodiments, the binding of a D1 domain of a particular HER2?HER2 bispecific antigen-binding molecule to its epitope on ErbB2 does not inhibit (or only minimally inhibits) the binding of the D2 domain of the HER2?HER2 bispecific antigen-binding molecule to its epitope on HER2. Due to the non-overlapping (or at most, partially overlapping) nature of the respective epitopes of the D1 and D2 components, the HER2?HER2 bispecific antigen-binding molecules are able to bind to a single HER2 molecule on a cell surface. In addition, the HER2?HER2 bispecific binding molecules are able to cluster at ErbB2 on the cell surface, and trigger HER2 internalization.
[0309] Various techniques known to persons of ordinary skill in the art can be used to determine the epitope on HER2 with which the antibodies and antigen-binding domains of the present disclosure interact. Exemplary techniques that can be used to determine an epitope or binding domain of a particular antibody or antigen-binding domain include, e.g., point mutagenesis (e.g., alanine scanning mutagenesis, arginine scanning mutagenesis, etc.), peptide blots analysis (Reineke, 2004, Methods Mol Biol 248:443-463), protease protection, and peptide cleavage analysis. In addition, methods such as epitope excision, epitope extraction and chemical modification of antigens can be employed (Tomer, 2000, Protein Science 9:487-496). Another method that can be used to identify the amino acids within a polypeptide with which an antibody interacts is hydrogen/deuterium exchange detected by mass spectrometry. In general terms, the hydrogen/deuterium exchange method involves deuterium-labeling the protein of interest, followed by binding the antibody to the deuterium-labeled protein. Next, the protein/antibody complex is transferred to water to allow hydrogen-deuterium exchange to occur at all residues except for the residues protected by the antibody (which remain deuterium-labeled). After dissociation of the antibody, the target protein is subjected to protease cleavage and mass spectrometry analysis, thereby revealing the deuterium-labeled residues which correspond to the specific amino acids with which the antibody interacts. See, e.g., Ehring (1999) Analytical Biochemistry 267(2):252-259; Engen and Smith (2001) Anal. Chem. 73:256A-265A. X-ray crystal structure analysis can also be used to identify the amino acids within a polypeptide with which an antibody interacts.
[0310] Further provided herein are HER2 bispecific antibodies that bind to the same epitope as any of the specific exemplary antibodies or antigen-binding domains described herein (e.g. antibodies comprising any of the amino acid sequences as set forth in Table 1 herein). Likewise, also provided herein are HER2 bispecific antibodies that compete for binding to HER2 with any of the specific exemplary antibodies described herein (e.g. antibodies comprising any of the amino acid sequences as set forth in Table 1 herein).
[0311] One can easily determine whether an antibody binds to the same epitope as, or competes for binding with, a reference anti-HER2 antibody by using routine methods known in the art and exemplified herein. For example, to determine if a test antibody binds to the same epitope as a reference anti-HER2 antibody provided herein, the reference antibody is allowed to bind to a HER2 protein. Next, the ability of a test antibody to bind to the HER2 molecule is assessed. If the test antibody is able to bind to HER2 following saturation binding with the reference anti-HER2 antibody, it can be concluded that the test antibody binds to a different epitope than the reference anti-HER2 antibody. On the other hand, if the test antibody is not able to bind to the HER2 molecule following saturation binding with the reference anti-HER2 antibody, then the test antibody may bind to the same epitope as the epitope bound by the reference anti-HER2 antibody. Additional routine experimentation (e.g., peptide mutation and binding analyses) can then be carried out to confirm whether the observed lack of binding of the test antibody is in fact due to binding to the same epitope as the reference antibody or if steric blocking (or another phenomenon) is responsible for the lack of observed binding. Experiments of this sort can be performed using ELISA, RIA, Biacore, flow cytometry or any other quantitative or qualitative antibody-binding assay available in the art. In accordance with certain embodiments, two antibodies bind to the same (or overlapping) epitope if, e.g., a 1-, 5-, 10-, 20- or 100-fold excess of one antibody inhibits binding of the other by at least 50% but preferably 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans et al., Cancer Res. 1990:50:1495-1502). Alternatively, two antibodies are deemed to bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies are deemed to have overlapping epitopes if only a subset of the amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
[0312] To determine if an antibody competes for binding (or cross-competes for binding) with a reference anti-HER2 antibody, the above-described binding methodology is performed in two orientations: In a first orientation, the reference antibody is allowed to bind to a HER2 protein under saturating conditions followed by assessment of binding of the test antibody to the HER2 molecule. In a second orientation, the test antibody is allowed to bind to a HER2 molecule under saturating conditions followed by assessment of binding of the reference antibody to the HER2 molecule. If, in both orientations, only the first (saturating) antibody is capable of binding to the HER2 molecule, then it is concluded that the test antibody and the reference antibody compete for binding to HER2. As will be appreciated by a person of ordinary skill in the art, an antibody that competes for binding with a reference antibody may not necessarily bind to the same epitope as the reference antibody, but may sterically block binding of the reference antibody by binding an overlapping or adjacent epitope.
Preparation of Human Antibodies
[0313] The HER2?HER2 bispecific antibodies provided herein can be fully human antibodies. Methods for generating monoclonal antibodies, including fully human monoclonal antibodies are known in the art. Any such known methods can be used in the context of the present disclosure to make human antibodies that specifically bind to human HER2.
[0314] Using VELOCIMMUNE? technology, for example, or any other similar known method for generating fully human monoclonal antibodies, high affinity chimeric antibodies to HER2 are initially isolated having a human variable region and a mouse constant region. As in the experimental section below, the antibodies are characterized and selected for desirable characteristics, including affinity, dimerization blocking activity, selectivity, epitope, etc. If necessary, mouse constant regions are replaced with a desired human constant region, for example wild-type or modified IgG1 or IgG4, to generate a fully human anti-HER2 antibody. While the constant region selected may vary according to specific use, high affinity antigen-binding and target specificity characteristics reside in the variable region. In certain instances, fully human anti-HER2 antibodies are isolated directly from antigen-positive B cells.
Bioequivalents
[0315] The HER2 bispecific antibodies and antibody fragments provided herein encompass proteins having amino acid sequences that vary from those of the described antibodies but that retain the ability to bind human HER2. Such variant antibodies and antibody fragments comprise one or more additions, deletions, or substitutions of amino acids when compared to parent sequence, but exhibit biological activity that is essentially equivalent to that of the described antibodies. Likewise, the anti-HER2 antibody-encoding DNA sequences of the present disclosure encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to the disclosed sequence, but that encode an anti-HER2 antibody or antibody fragment that is essentially bioequivalent to an anti-HER2 antibody or antibody fragment of the disclosure. Examples of such variant amino acid and DNA sequences are discussed above.
[0316] Two antigen-binding proteins, or antibodies, are considered bioequivalent if, for example, they are pharmaceutical equivalents or pharmaceutical alternatives whose rate and extent of absorption do not show a significant difference when administered at the same molar dose under similar experimental conditions, either single does or multiple dose. Some antibodies will be considered equivalents or pharmaceutical alternatives if they are equivalent in the extent of their absorption but not in their rate of absorption and yet may be considered bioequivalent because such differences in the rate of absorption are intentional and are reflected in the labeling, are not essential to the attainment of effective body drug concentrations on, e.g., chronic use, and are considered medically insignificant for the particular drug product studied.
[0317] In one embodiment, two antigen-binding proteins are bioequivalent if there are no clinically meaningful differences in their safety, purity, and potency.
[0318] In one embodiment, two antigen-binding proteins are bioequivalent if a patient can be switched one or more times between the reference product and the biological product without an expected increase in the risk of adverse effects, including a clinically significant change in immunogenicity, or diminished effectiveness, as compared to continued therapy without such switching.
[0319] In one embodiment, two antigen-binding proteins are bioequivalent if they both act by a common mechanism or mechanisms of action for the condition or conditions of use, to the extent that such mechanisms are known.
[0320] Bioequivalence may be demonstrated by in vivo and in vitro methods. Bioequivalence measures include, e.g., (a) an in vivo test in humans or other mammals, in which the concentration of the antibody or its metabolites is measured in blood, plasma, serum, or other biological fluid as a function of time; (b) an in vitro test that has been correlated with and is reasonably predictive of human in vivo bioavailability data; (c) an in vivo test in humans or other mammals in which the appropriate acute pharmacological effect of the antibody (or its target) is measured as a function of time; and (d) in a well-controlled clinical trial that establishes safety, efficacy, or bioavailability or bioequivalence of an antibody.
[0321] Bioequivalent variants of HER2 bispecific antibodies provided herein may be constructed by, for example, making various substitutions of residues or sequences or deleting terminal or internal residues or sequences not needed for biological activity. For example, cysteine residues not essential for biological activity can be deleted or replaced with other amino acids to prevent formation of unnecessary or incorrect intramolecular disulfide bridges upon renaturation. In other contexts, bioequivalent antibodies may include HER2 bispecific antibody variants comprising amino acid changes which modify the glycosylation characteristics of the antibodies, e.g., mutations which eliminate or remove glycosylation.
Species Selectivity and Species Cross-Reactivity
[0322] The present disclosure, according to certain embodiments, provides anti-HER2 antibodies (and antigen-binding molecules comprising anti-HER2 antigen-binding domains) that bind to human HER2 but not to HER2 from other species. The present disclosure also includes anti-HER2 antibodies (and antigen-binding molecules comprising anti-HER2 antigen-binding domains) that bind to human HER2 and to HER2 from one or more non-human species. For example, the anti-HER2 antibodies and antigen-binding molecules may bind to human HER2 and may bind or not bind, as the case may be, to one or more of mouse, rat, guinea pig, hamster, gerbil, pig, cat, dog, rabbit, goat, sheep, cow, horse, camel, cynomolgus, marmoset, rhesus or chimpanzee HER2.
Multispecific Antibodies
[0323] As described elsewhere herein, the present disclosure provides bispecific antigen-binding molecules comprising two different antigen-binding domains, wherein the first antigen-binding domain (D1) binds a first epitope on HER2, and wherein the second antigen-binding domain (D2) binds a second epitope on HER2. In certain embodiments, the first and/or second epitopes are within the ectodomain of HER2, for example, within SEQ ID NO: 54. In certain embodiments, the first and second epitopes on HER2 to which the D1 and D2 domains bind are distinct, or non-overlapping, or partially overlapping. According to this aspect, the D1 domain can comprise any of the HCVR/LCVR or CDR amino acid sequences as set forth in Table 1 herein, and the D2 domain can comprise any other of the HCVR/LCVR or CDR amino acid sequences as set forth in Table 1 herein (so long as the binding specificity of the D1 domain is different from the binding specificity of the D2 domain, and/or the antigen-binding protein from which D1 was obtained does not compete for binding to HER2 with the antigen-binding protein from which D2 was obtained).
[0324] In some embodiments, the human HER2 epitope to which the anti-HER2?anti-HER2 bispecific antibodies bind comprise amino acids 9-23 (SEQ ID NO: 57), amino acids 41-51 (SEQ ID NO: 58), amino acids 64-77 (SEQ ID NO: 59), amino acids 133-148 (SEQ ID NO: 61), amino acids 141-145 (SEQ ID NO: 155), amino acids 152-161 (SEQ ID NO: 64), amino acids 166-182 (SEQ ID NO: 56), amino acids 174-182 (SEQ ID NO: 162), amino acids 194-200 (SEQ ID NO: 163), amino acids 258-273 (SEQ ID NO: 65), and/or amino acids 353-359 (SEQ ID NO: 60) of SEQ ID NO: 54. In some embodiments, the first epitope of human HER2 comprises amino acids 141-145 and/or 166-182 of SEQ ID NO: 54; and the second epitope of human HER2 comprises amino acids 9-23, 41-51, 64-67, and/or 353-359 of SEQ ID NO: 54. In some embodiments, the first epitope of human HER2 comprises amino acids 133-148, 174-182, and/or 194-200 of SEQ ID NO: 54; and the second epitope of human HER2 comprises amino acids 152-161, 258-273, and/or 194-200 of SEQ ID NO: 54.
[0325] An exemplary bispecific antibody format that can be used in the context of the present disclosure involves the use of a first immunoglobulin (Ig) C.sub.H3 domain and a second Ig C.sub.H3 domain, wherein the first and second Ig C.sub.H3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the bispecific antibody to Protein A as compared to a bi-specific antibody lacking the amino acid difference. In one embodiment, the first Ig C.sub.H3 domain binds Protein A and the second Ig C.sub.H3 domain contains a mutation that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering). The second C.sub.H3 may further comprise a Y96F modification (by IMGT; Y436F by EU). Further modifications that may be found within the second C.sub.H3 include: D16E, L18M, N44S, K52N, V57M, and V82I (by IMGT; D356E, L358M, N384S, K392N, V397M, and V422I by EU) in the case of IgG1 antibodies; N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by EU) in the case of IgG2 antibodies; and Q15R, N44S, K52N, V57M, R69K, E79Q, and V82 I (by IMGT; Q355R, N384S, K392N, V397M, R409K, E419Q, and V422I by EU) in the case of IgG4 antibodies. Variations on the bispecific antibody format described above are contemplated within the scope of the present disclosure.
[0326] Other exemplary bispecific formats that can be used in the context of the present disclosure include, without limitation, e.g., scFv-based or diabody bispecific formats, IgG-scFv fusions, dual variable domain (DVD)-Ig, Quadroma, knobs-into-holes, common light chain (e.g., common light chain with knobs-into-holes, etc.), CrossMab, CrossFab, (SEED)body, leucine zipper, Duobody, IgG1/IgG2, dual acting Fab (DAF)-IgG, and Mab.sup.2 bispecific formats (see, e.g., Klein et al. 2012, mAbs 4:6, 1-11, and references cited therein, for a review of the foregoing formats). Bispecific antibodies can also be constructed using peptide/nucleic acid conjugation, e.g., wherein unnatural amino acids with orthogonal chemical reactivity are used to generate site-specific antibody-oligonucleotide conjugates which then self-assemble into multimeric complexes with defined composition, valency and geometry. (See, e.g., Kazane et al., J. Am. Chem. Soc. [Epub: Dec. 4, 2012]).
Therapeutic Formulation and Administration
[0327] Provided herein are pharmaceutical compositions comprising the anti-HER2 antibodies or HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, of the present invention. The pharmaceutical compositions may be formulated with suitable carriers, excipients, and other agents that provide improved transfer, delivery, tolerance, and the like.
Therapeutic Uses of the Antibodies
[0328] Provided herein are methods comprising administering to a subject in need thereof a therapeutic composition comprising a HER2?HER2 bispecific antigen-binding molecule, including HER2?HER2 ADCs, comprising any of the D1 and D2 components as set forth herein). The therapeutic composition can comprise any of the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, disclosed herein, and a pharmaceutically acceptable carrier or diluent.
[0329] The HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, are useful, inter alia, for the treatment, prevention and/or amelioration of any disease or disorder associated with or mediated by HER2 expression, signaling or activity, or treatable by blocking HER2 dimerization, or otherwise inhibiting HER2 activity and/or signaling, and/or promoting receptor internalization and/or decreasing cell surface receptor number.
[0330] For example, HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, of the present disclosure are useful for the treatment of tumors that express (or overexpress) HER2. In some embodiments, the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, bind cells expressing high levels of HER2, e.g. IHC3+. In some embodiments, the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, bind cells expressing intermediate levels of HER2, e.g. IHC2+. In some embodiments, the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, bind poorly to cells expressing low levels of HER2, e.g. IHC1+.
[0331] In some embodiments, HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, exhibit cell killing of intermediate or high HER2 expressing cells but not low HER2 expressors. In some aspects, cell killing is less than about 5%, less than about ? %, less than about 3%, or less than about 2% of cells expressing low levels of HER2.
[0332] In certain embodiments, the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, are used to treat one or more of the following cancers: breast cancer, cervical cancer, gastric cancer (e.g., gastric cancer with HER2 amplification), esophageal cancer, colorectal cancer, endometrial cancer, glioblastomata, head and neck cancer (e.g., head and neck squamous cell carcinoma [HNSCC]), ovarian cancer, lung cancer (e.g., non-small cell lung cancer [NSCLC]), small cell lung cancer, acute myelogenous leukemia, adult T-cell leukemia, astrocytomas, bladder cancer, cholangiocarcinoma, chronic myeloid leukemia, Kaposi's sarcoma, kidney cancer, leiomyosarcomas, liver cancer, lymphomas, malignant gliomas, malignant mesothelioma, melanoma, mesothelioma, MFH/fibrosarcoma, multiple myeloma, nasopharyngeal cancer, osteosarcoma, pancreatic carcinoma, prostate cancer, renal cell carcinoma, rhabdomyosarcoma, synovial sarcoma, thyroid cancer, and Wilms' tumor.
[0333] In some aspects, the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, may be used to treat primary and/or metastatic tumors expressing high or intermediate levels of HER2, i.e. tumors arising in the brain and meninges, oropharynx, lung and bronchial tree, gastrointestinal tract, male and female reproductive tract, muscle, bone, skin and appendages, connective tissue, spleen, immune system, blood forming cells and bone marrow, liver and urinary tract, and special sensory organs such as the eye.
[0334] In the context of the methods of treatment described herein, the HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, may be administered as a monotherapy (i.e., as the only therapeutic agent), in combination with one or more additional therapeutic agents (examples of which are described elsewhere herein), or as an ADC (examples of which are also described elsewhere herein).
Combination Therapies and Formulations
[0335] Provided herein are compositions and therapeutic formulations comprising any of the anti-HER2 antibodies and HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, described herein in combination with one or more additional therapeutically active components, and methods of treatment comprising administering such combinations to subjects in need thereof.
[0336] The anti-HER2 antibodies and HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, may be co-formulated with and/or administered in combination with one or more additional therapeutically active component(s) selected from the group consisting of: another antagonist of Her2/ErbB2 (e.g., anti-ErbB2 [e.g., Trastuzumab or T-DM1 {KADCYLA?}, or trastuzumab deruxtican {T-SXD; a DNA topoisomerase 1 inhibitor}], or small molecule inhibitor of ErbB2 activity), an antagonist of another EGFR family member such as ErbB3 or ErbB4 (e.g., anti-ErbB3 or anti-ErbB4 antibody or small molecule inhibitor of ErbB3 or ErbB4 activity), a MET antagonist (e.g., an anti-MET antibody [e.g., onartuzumab, emibetuzumab, and H4H14639D] or small molecule inhibitor of MET), an EGFR antagonist (e.g., an anti-EGFR antibody [e.g., cetuximab or panitumumab] or small molecule inhibitor of EGFR [e.g., gefitinib or erlotinib]), an antagonist of EGFRvIII (e.g., an anti-EGFRvIII antibody), an IGF1R antagonist (e.g., an anti-IGF1R antibody), a B-raf inhibitor (e.g., vemurafenib, sorafenib, GDC-0879, PLX-4720), a PDGFR-? inhibitor (e.g., an anti-PDGFR-? antibody), a PDGFR-? inhibitor (e.g., an anti-PDGFR-? antibody or small molecule kinase inhibitor such as, e.g., imatinib mesylate or sunitinib malate), a PDGF ligand inhibitor (e.g., anti-PDGF-A, -B, -C, or -D antibody, aptamer, siRNA, etc.), a VEGF antagonist (e.g., a VEGF-Trap such as aflibercept, see, e.g., U.S. Pat. No. 7,087,411 (also referred to herein as a VEGF-inhibiting fusion protein), anti-VEGF antibody (e.g., bevacizumab), a small molecule kinase inhibitor of VEGF receptor (e.g., sunitinib, sorafenib or pazopanib)), a DLL4 antagonist (e.g., an anti-DLL4 antibody disclosed in US 2009/0142354 such as REGN421), an Ang2 antagonist (e.g., an anti-Ang2 antibody disclosed in US 2011/0027286 such as H1H685P), a FOLH1 antagonist (e.g., an anti-FOLH1 antibody), a STEAP1 or STEAP2 antagonist (e.g., an anti-STEAP1 antibody or an anti-STEAP2 antibody), a TMPRSS2 antagonist (e.g., an anti-TMPRSS2 antibody), a MSLN antagonist (e.g., an anti-MSLN antibody), a CA9 antagonist (e.g., an anti-CA9 antibody), a uroplakin antagonist (e.g., an anti-uroplakin [e.g., anti-UPK3A] antibody), a MUC16 antagonist (e.g., an anti-MUC16 antibody), a Tn antigen antagonist (e.g., an anti-Tn antibody), a CLEC12A antagonist (e.g., an anti-CLEC12A antibody), a TNFRSF17 antagonist (e.g., an anti-TNFRSF17 antibody), a LGR5 antagonist (e.g., an anti-LGR5 antibody), a monovalent CD20 antagonist (e.g., a monovalent anti-CD20 antibody such as rituximab), a CD20?CD3 bispecific antibody, a PD-1 blocking agent (e.g., an anti-PD-1 antibody such as pembrolizumab or nivolumab), etc. Other agents that may be beneficially administered in combination with antibodies provided herein include, e.g., tamoxifen, aromatase inhibitors, and cytokine inhibitors, including small-molecule cytokine inhibitors and antibodies that bind to cytokines such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-8, IL-9, IL-11, IL-12, IL-13, IL-17, IL-18, or to their respective receptors.
[0337] Illustratively, a PD-1 inhibitor such as an anti-PD-1 antibody can be combined with a HER2?HER2 antibody-drug conjugate as described herein. The target patient population includes specifically those patients with tumors that overexpress the HER2 mutation (e.g. IHC2+ or IHC3+), such as a patient with a HER2-expressing breast cancer.
[0338] Provided herein are compositions and therapeutic formulations comprising any of the anti-HER2 antibodies and HER2?HER2 bispecific antigen-binding molecules, including HER2?HER2 ADCs, described herein in combination with one or more chemotherapeutic agents. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (Cytoxan?); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, carminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK?; razoxane; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); cyclophosphamide; thiotepa; taxanes, e.g. paclitaxel (Taxol?, Bristol-Myers Squibb Oncology, Princeton, N.J.) and docetaxel (Taxotere?; Aventis Antony, France); chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY 117018, onapristone, and toremifene (Fareston); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[0339] The HER2?HER2 bispecific antigen-binding molecules may also be administered and/or co-formulated in combination with antivirals, antibiotics, analgesics, corticosteroids, steroids, oxygen, antioxidants, COX inhibitors, cardioprotectants, metal chelators, IFN-gamma, and/or NSAIDs.
[0340] The additional therapeutically active component(s), e.g., any of the agents listed above or derivatives thereof, may be administered just prior to, concurrent with, or shortly after the administration of a HER2?HER2 bispecific antigen-binding molecule; (for purposes of the present disclosure, such administration regimens are considered the administration of an antibody in combination with an additional therapeutically active component). The present disclosure includes pharmaceutical compositions in which a HER2?HER2 bispecific antigen-binding molecule is co-formulated with one or more of the additional therapeutically active component(s) as described elsewhere herein.
Administration Regimens
[0341] According to certain embodiments, multiple doses of a HER2?HER2 bispecific antigen-binding molecule, including HER2?HER2 ADCs, (or a pharmaceutical composition comprising a combination of an anti-HER2 antibody, HER2?HER2 bispecific antigen-binding molecule, or HER2?HER2 ADC, and any of the additional therapeutically active agents mentioned herein) may be administered to a subject over a defined time course. The methods according to this aspect comprise sequentially administering to a subject multiple doses of a HER2?HER2 bispecific antigen-binding molecule provided herein. As used herein, sequentially administering means that each dose of antibody is administered to the subject at a different point in time, e.g., on different days separated by a predetermined interval (e.g., hours, days, weeks or months). The present disclosure includes methods which comprise sequentially administering to the patient a single initial dose of a HER2?HER2 bispecific antigen-binding molecule, followed by one or more secondary doses of the HER2?HER2 bispecific antigen-binding molecule, and optionally followed by one or more tertiary doses of the HER2?HER2 bispecific antigen-binding molecule.
[0342] The terms initial dose, secondary doses, and tertiary doses, refer to the temporal sequence of administration of the HER2?HER2 bispecific antigen-binding molecule. Thus, the initial dose is the dose which is administered at the beginning of the treatment regimen (also referred to as the baseline dose); the secondary doses are the doses which are administered after the initial dose; and the tertiary doses are the doses which are administered after the secondary doses. The initial, secondary, and tertiary doses may all contain the same amount of HER2?HER2 bispecific antigen-binding molecule, but generally may differ from one another in terms of frequency of administration. In certain embodiments, however, the amount of antibody contained in the initial, secondary and/or tertiary doses varies from one another (e.g., adjusted up or down as appropriate) during the course of treatment. In certain embodiments, two or more (e.g., 2, 3, 4, or 5) doses are administered at the beginning of the treatment regimen as loading doses followed by subsequent doses that are administered on a less frequent basis (e.g., maintenance doses).
Diagnostic Uses of the Antibodies
[0343] The HER2?HER2 bispecific antigen-binding molecule of the present disclosure may also be used to detect and/or measure HER2, or HER2-expressing cells in a sample, e.g., for diagnostic purposes. For example, an anti-HER2 antibody, or fragment thereof, may be used to diagnose a condition or disease characterized by aberrant expression (e.g., over-expression, under-expression, lack of expression, etc.) of HER2. Exemplary diagnostic assays for HER2 may comprise, e.g., contacting a sample, obtained from a patient, with a HER2?HER2 bispecific antigen-binding molecule, wherein the antibody is labeled with a detectable label or reporter molecule. Alternatively, an unlabeled HER2?HER2 bispecific antigen-binding molecule can be used in diagnostic applications in combination with a secondary antibody which is itself detectably labeled. The detectable label or reporter molecule can be a radioisotope, such as .sup.3H, .sup.14C, .sup.32P, .sup.35S, or .sup.125I; a fluorescent or chemiluminescent moiety such as fluorescein, or rhodamine; or an enzyme such as alkaline phosphatase, beta-galactosidase, horseradish peroxidase, or luciferase. Specific exemplary assays that can be used to detect or measure HER2 in a sample include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immuno-PET (e.g., .sup.89Zr, .sup.64Cu, etc.), and fluorescence-activated cell sorting (FACS). In some embodiments, the HER2?HER2 bispecific antigen-binding molecule is labeled as described in WO 2018/044540, the entirety of which is incorporated herein by reference in its entirety. In some embodiments, the HER2?HER2 bispecific antigen is labeled to:
##STR00140##
[0344] In some embodiments, a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 2 and the D2-HCVR amino acid sequence of SEQ ID NO: 10 is labeled to Biosensor 1.
[0345] In some embodiments, a HER2?HER2 bispecific antigen-binding protein comprising the D1-HCVR amino acid sequence of SEQ ID NO: 32 and the D2-HCVR amino acid sequence of SEQ ID NO: 40 is labeled to Biosensor 1.
[0346] Samples that can be used in HER2 diagnostic assays according to the present disclosure include any tissue or fluid sample obtainable from a patient. Generally, levels of HER2 in a particular sample obtained from a healthy patient (e.g., a patient not afflicted with a disease or condition associated with abnormal HER2 levels or activity) will be measured to initially establish a baseline, or standard, level of HER2. This baseline level of HER2 can then be compared against the levels of HER2 measured in samples obtained from individuals suspected of having a HER2-related disease or condition.
EXAMPLES
[0347] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the methods and compositions provided herein, and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
[0348] Comparator antibodies used in the Examples below include the following: [0349] Trastuzumab-MCC-DM1, an anti-HER2 ADC comprising a DM1 payload. See, e.g., WO2015/031396A1. The ADC is referred to herein as CompAb1-MCC-Maytansinoid A. The parental anti-HER2 antibody, Herceptin, is referred to herein as CompAb1. [0350] DS8201A, an anti-HER2 ADC comprising a DxD payload. See e.g., Ogitani et al. (Clinical Cancer Research, October 2016, 22(20): doi: 10.1158/1078-0432.ccr-15-2822) and Tamura (Lancet 2019). The ADC is referred to herein as CompAb1-Camptothecin-LP. The parental antibody is Herceptin, also referred to as CompAb1. [0351] MEDI4276, a HER2?HER2 bispecific antibody ADC comprising the AZ13599185 payload. The antibody comprises SEQ ID NO: 52 (DomainIV_VL.(G4S)4 Linker_v3.DomainIV_VH.(G4S)3) and SEQ ID NO: 53 (Bs2AB_VK.hKappa). The linker payload is compound T32 shown below, in WO2015/157592, and Faria et al. (Antibodies, 2019, 8(11) doi: 10.3390/antib8010011). The parental bispecific antibody is referred to herein as CompAb2, and the ADC is referred to herein as CompAb2-Tubulysin 2A-LP. [0352] Isotype control antibodies are referred to herein as IC1. The IC1 antibodies can be conjugated to Tubulysin 1A-LP, MCC-Maytansinoid A, Camptothecin, or Tubulysin 2A-LP.
##STR00141##
Example 1. Generation of Anti-HER2 Antibodies
[0353] Anti-HER2 antibodies were obtained by immunizing a genetically engineered mouse comprising DNA encoding human immunoglobulin heavy and kappa light chain variable regions with an immunogen comprising recombinant human HER2 extracellular domain fused to mouse Fc, hErbB2 ecto-mFc (Company, Catalog #, Location). The mice used for the immunizations express a universal light chain. That is, the antibodies produced in this mouse have different heavy chain variable regions but essentially identical light chain variable domains.
[0354] The antibody immune response was monitored by a HER2-specific immunoassay. When a desired immune response was achieved splenocytes were harvested and fused with mouse myeloma cells to preserve their viability and form hybridoma cell lines. The hybridoma cell lines were screened and selected to identify cell lines that produce HER2-specific antibodies. Using this technique several anti-HER2 chimeric antibodies (i.e., antibodies possessing human variable domains and mouse constant domains) were obtained. In addition, several fully human anti-HER2 antibodies were isolated directly from antigen-positive B cells without fusion to myeloma cells, as described in US 2007/0280945A1.
[0355] Certain biological properties of the exemplary anti-HER2 antibodies generated in accordance with the methods of this Example, and bispecific antibodies constructed therefrom, are described in detail in the Examples set forth below.
Example 2. Construction of Bispecific Antibodies Having Two Different Antigen-Binding Domains Specific for Different Epitopes of HER2
[0356] This example describes the construction of bispecific antibodies comprising two different antigen-binding domains (D1 and D2), wherein D1 and D2 are derived from different anti-HER2 antibodies and, consequently, bind to separate epitopes on the HER2 extracellular domain.
[0357] The individual anti-HER2 antigen-binding domains used to construct the bispecific antibodies of this Example were derived from various bivalent, monospecific anti-HER2 antibodies generated according to Example 1, herein. All HER2?HER2 bispecific antibodies described herein comprise the same (common) light chain (comprising the light chain variable region [LCVR] amino acid sequence of SEQ ID NO:18, and light chain CDR [LCDR1, LCDR2 and LCDR3] amino acid sequences of SEQ ID NOs: 20, 22 and 24). Thus, both antigen-binding domains (D1 and D2) of all of the bispecific antibodies described in this example comprise this common light chain variable region; however, the bispecific antibodies differ from one another in terms of their D1 heavy chain variable regions (HCVRs) and heavy chain CDRs (HCDRs) and D2 heavy chain variable regions (HCVRs) and heavy chain CDRs (HCDRs). The components of the bispecific antibodies of this Example are summarized in Table 1.
[0358] In some aspects, the bispecific antibodies contain an N297Q modification in one or both heavy chains. The 297 residue within the heavy chain is identified according to the Kabat definition of numbering. As such, the HC chain sequences provided in Table 3 can comprise an N297Q modification.
TABLE-US-00001 TABLE 1 HER2 ? HER2 Bispecific Antibody Amino Acid Sequences SEQ ID NOs: (Amino Acid Sequences) First Antigen-Binding Domain (D1) Second Antigen-Binding Domain (D2) D1- D1- D1- D1- D2- D2- D2- D2- Bispecific HCVR/ HCDR1/ HCDR2/ HCDR3/ HCVR/ HCDR1/ HCDR2/ HCDR3/ Antibody LCVR LCDR1 LCDR2 LCDR3 LCVR LCDR1 LCDR2 LCDR3 H4H17325D 2 4 6 8 10 12 14 16 (BsAb1) 18 20 22 24 18 20 22 24 H4H17087D 32 34 36 38 40 42 44 46 (BsAb2) 18 20 22 24 18 20 22 24
TABLE-US-00002 TABLE 2 HER2 ? HER2 Bispecific Nucleic Acid Sequences SEQ ID NOs: (Nucleic Acid Sequences) First Antigen-Binding Domain (D1) Second Antigen-Binding Domain (D2) D1- D1- D1- D1- D2- D2- D2- D2- Bispecific HCVR/ HCDR1/ HCDR2/ HCDR3/ HCVR/ HCDR1/ HCDR2/ HCDR3/ Antibody LCVR LCDR1 LCDR2 LCDR3 LCVR LCDR1 LCDR2 LCDR3 BsAb1 1 3 5 7 9 11 13 15 17 19 21 23 17 19 21 23 BsAb2 31 33 35 37 39 41 43 45 17 19 21 23 17 19 21 23
TABLE-US-00003 TABLE 3 HER2 ? HER2 Bispecific Full Length Heavy and Light Chain Amino Acid Sequences SEQ ID NOs: D1 Full length D2 Full length Full length Antibody Heavy Chain Heavy Chain Light Chain Designation Amino Acid Amino Acid Amino Acid BsAb1 26 28 30 BsAb2 48 50 30
Example 3. Surface Binding of HER2?HER2 Bispecific Antibodies
[0359] In this example, the ability of CompAb1 and HER2?HER2 bispecific antibodies to bind to the cell surface of ZR751 (ATCC Cat. #CRL-1500), JIMT1 (DSMZ Cat. #ACC589), and MDAMB361 (ATCC Cat. #HTB-27) cells was tested.
[0360] For the assay, cells were grown in cell culture treated 75 cm.sup.2 flasks (Corning #430641U) in the medium indicated above at 37? C. in 5% CO.sub.2. The day of the assay, cells were trypsinized and incubated with Violet viability marker (Biolegend #77477) in PBS (10 minutes, 4 C, 1 ml). After, cells were centrifuged (1500 RPM, 5 minutes, 4? C.), resuspended in DMEM+10% FBS, plated in U-Bottom, 96-well plates at 200,000 cells/well and incubated with the indicated dilutions of Alexa 674-labeled (Thermo, Cat #A37573) antibody (20 minutes, DMEM+10% FBS, 4? C., 50 ul/well). Cells were then centrifuged and washed twice (5 minutes, DMEM+10% FBS, 4? C., 200 ul/well). After, cells were fixed with 1% paraformaldehyde (Electron Microcopy Sciences #15710) in PBS (10 minutes, 4? C., 50 ul/well), fixative was diluted with additional 150 ul PBS and cells were subjected to flow cytometry analysis using Fortessa X20 instrument (BD Biosciences).
[0361] As shown in Tables 4-6, both HER2?HER2 bispecific antibodies bound with greater affinity and avidity than CompAb1 in the three cell lines tested, while the isotype control antibody (IC1) showed little or no binding. See also
TABLE-US-00004 TABLE 4 Cell Surface Binding of HER2 ? HER2 Bispecific Antibodies to MDAMB361 Cells [Ab] IC1- CompAb1- BsAb1- BsAb2- ug/ml MFI A.U. MFI A.U. MFI A.U. MFI A.U. 0 131 131 136 136 0.04 132 304 1236 474 0.08 133 465 2073 743 0.16 141 720 3536 1195 0.31 154 1259 5999 2271 0.63 155 2097 9007 3927 1.25 202 3780 13409 6908 2.5 273 6183 15403 10626 5 253 8988 16558 15771 10 605 12003 17556 21616 20 617 13863 17649 23357 40 558 14675 18599 23613
TABLE-US-00005 TABLE 5 Cell Surface Binding of HER2 ? HER2 Bispecific Antibodies to JIMT1 Cells [Ab] IC1- CompAb1- BsAb1- BsAb2- ug/ml MFI A.U. MFI A.U. MFI A.U. MFI A.U. 0 150 149 148 175 0.04 149 276 1165 472 0.08 151 481 2121 742 0.16 153 811 3679 1287 0.31 156 1377 6107 2388 0.63 160 2396 8726 4100 1.25 183 3778 11468 6454 2.5 167 5713 12889 10250 5 190 7995 13523 15103 10 240 10320 14121 18069 20 516 11378 14231 20133 40 315 11349 13585 19164
TABLE-US-00006 TABLE 6 Binding of HER2 ? HER2 Bispecific Antibodies to ZR751 Cells [Ab] IC1- CompAb1- BsAb1- BsAb2- ug/ml MFI A.U. MFI A.U. MFI A.U. MFI A.U. 0 165 168 192 172 0.04 171 435 1753 613 0.08 175 648 3024 1008 0.16 182 1073 5147 1800 0.31 199 1850 8106 3019 0.63 271 3283 11848 4966 1.25 312 5369 15167 8295 2.5 484 7901 17112 13761 5 696 9983 17650 18654 10 1081 11078 19027 21468 20 2538 11793 19250 22096 40 3316 11749 20804 21931
Example 4. HER2?HER2 Surface Binding in a Panel of Cell Lines
[0362] To test the ability of HER2?HER bispecific antibodies of the invention to bind to cells lines expressing various levels of HER2, a high content imaging assay was performed. For the assay, 16 cancer cell lines and 4 normal primary cultures were used (see Table 7). The cell lines were classified for relative expression of HER2 by Western Blot Analysis.
TABLE-US-00007 TABLE 7 Cell Lines and Relative HER2 Expression Relative HER2 Cell Line Source Catalog # Expression Primary Myocardial Promo C12811 6% cells Cell Primary Prostate ATCC PCS-440-010 1% Epithelial cells Primary Lung ATCC PCS-300-010 1% Epithelial cells Primary Mammary ATCC PCS-600-010 1% Epithelial cells MDA-MB468 ATCC HTB-132 0% MDA-MB231 ATCC HTB-26 3% HepG2 ATCC HB-8065 13% EBC-1 6% (Lung Carcinoma) MCF7 ATCC HTB-22 15% T47D ATCC HTB-133 24% BT483 ATCC HTB121 37% ZR751 ATCC CRL-1500 39% JIMT1 DSMZ ACC589 52% MDA-MB361 ATCC HTB-27 82% MDA-MB453 ATCC HTB-131 60% SK-BR-3 ATCC HTB-30 100% B1474 ATCC HTB-20 89% N87 (NCI-N87) ATCC HTB-5822 93% Calu-3 ATCC HTB-55 84% SKOV-3 ATCC HTB-77 93%
[0363] Cells were plated on collagen-coated, black wall, 96-well, optical plates (Greiner, Cat #655936) at 2.5?10.sup.5 cells per well in their appropriate culture media and incubated overnight at 37? C. in 5% CO.sub.2. The following day, cell were incubated for 30 minutes with 10 ug/mL of Alexa647 labeled (Thermo, Cat #A37573) antibodies in 50 uL of DMEM at 4? C. After, cells were washed twice with cold DMEM+10% FBS and incubated with ? % paraformaldehyde (Electron Microcopy Sciences, Cat #15710)+0.075% Saponin (Sigma, Cat #S4521)+10 ug/ml Hoechst (Lifetech, #H3569) in PBS for 10 minutes at room temperature. After, the solution was replaced with PBS.
[0364] Images were obtained with Image Xpress.sup.Micro high content microscope (Molecular Devices) and quantified by dividing the mean intensity fluorescence of AF647 by the nuclear signal using ImageJ.
[0365] Table 8 shows that CompAb1 and HER2?HER2 bispecific antibodies (BsAb1 and BsAb2) efficiently bound to cancer cell lines expressing intermediate and high levels of HER2, but bound poorly to normal cells expressing low HER2 levels. In agreement with experiment from Example 3, HER2?HER2 bispecific antibodies bound more efficiently than CompAb1 to cell lines expressing intermediate HER2 levels. See also
TABLE-US-00008 TABLE 8 Binding of HER2 ? HER2 Bispecific Antibodies to Cancer Cell Lines Expressing Various Levels of HER2 CompAb1- BsAb2-MFI BsAb1-MFI Cancer Cell Line MFI A.U. A.U. A.U. Myocardium 0.095432 0.02757 0.029776 Prostate 0.204242 0.19399 0.187972 Lung 0.303172 0.279337 0.239779 Breast 0.241461 0.254625 0.222378 MDAMB469 0.130358 0.136112 0.106277 MDAMB231 0.179825 0.300987 0.163362 epG2 0.400157 0.469533 0.44311 EBC1 0.2684 0.32991 0.295594 MCF7 0.283129 0.544385 0.348432 T47D 0.341463 0.690112 0.480429 B1483 0.494924 0.961112 0.69367 ZR751 0.601427 1.208203 0.932819 JIMT1 0.621217 1.834957 1.468691 MDAMB361 1.521691 2.260846 2.125254 MDAMB453 0.80355 1.57078 1.263122 SKBR3 1.93848 2.4215 2.196925 BT474 1.73622 1.892457 1.770925 N87 1.8087 1.963576 1.905515 CaLu3 1.530369 2.345307 2.145096 SKOV3 1.603426 2.107737 1.955882
Example 5: HER2?HER2 Internalization and Cluster Formation
[0366] This example tested the ability of HER2?HER2 bispecific antibodies to form clusters and internalize on T47D cells (ATCC Catalog #HTB-133). For 2D monolayer assays, T47D cells were plated on collagen-coated 96-well optical plates (Greiner, Cat #655936) at 25,000 cells/well in complete media and incubated overnight at 37? C. in 5% CO.sub.2. For 3D spheroids, cells were plated in low adhesion 96-well plates (Corning #4515) at 10,000 cells/well and incubated for 72 hours. The day of the assay, cells were incubated for 30 minutes with cold (4? C.) media containing 10 ug/mL of Alexa647 (Thermo, Cat #A37573) labeled antibodies. After, cells were washed twice (5 minutes, 100 ul, 4? C., complete medium) and incubated in complete media at 37? C. for 60 minutes. Cells were incubated for 30 minutes with cold (4? C.) media containing 4 ug/mL of Alexa488 anti-Human Fab (Jackson #109-547-003). After, cells were washed twice (5 minutes, 100 ul, 4? C., complete medium) and incubated with ? % paraformaldehyde (Electron Microcopy Sciences, Cat #15710)+0.075% Saponin (Sigma, Cat #S4521)+10 ug/ml Hoechst (Lifetech, #H3569) in PBS for 10 minutes at room temperature. After, the solution was replaced with PBS. Images were acquired with a Zeiss Spinning Disc Confocal Microscope and analyzed using Zeiss Zen Blue software. Quantification of the number of intracellular vesicles and surface clusters was performed in single confocal sections of representative images.
[0367] As can be seen in Tables 9 and 10, HER2?HER2 biparatopic antibody forms surface clusters and internalizes more efficiently than CompAb1.
TABLE-US-00009 TABLE 9 3D Spheroids (SD55) Ab ID Internalized Vesicles % Cluster % CompAb1 4% 24% BsAb1 83% 100% BsAb2 42% 24% CompAb2 100% 41%
TABLE-US-00010 TABLE 10 2D monolayers (SD53) Ab ID Internalized Vesicles % Cluster % CompAb1 11% 6% BsAb1 29% 100% BsAb2 43% 12% CompAb2 100% 28%
Example 6. DM1-Antibody Conjugation and Characterization of Conjugates
[0368] The antibodies (BsAb1, BsAb2 and IC1; 10-20 mg/ml) in 50 mM HEPES, 150 mM NaCl, pH 8.0, and 10-15% (v/v) DMA were conjugated with a 5-6 fold excess of M1 (SMCC-DM1) for 2 hours at ambient temperature. The conjugates were purified by size exclusion chromatography or extensive ultrafiltration and sterile filtered. Protein concentrations were determined by UV spectral analysis. Size-exclusion HPLC established that all conjugates used were >90% monomeric, and RP-HPLC established that there was <1% unconjugated linker payload. All conjugated antibodies were analyzed by UV for linker payload loading values according to Hamblett et al. (American Association for Cancer Research. 2004 Oct. 15; 10(20):7063-70). Payload to antibody ratios are reported in Table 11.
TABLE-US-00011 TABLE 11 Percent Yield and Payload to Antibody Ratios for Each of the Antibody Drug Conjugates Antibody Yield (%) DAR (UV) BsAb1-MCC-Maytansinoid A 80 3.4 BsAb2-MCC-Maytansinoid A 80 3.6
Example 6A: Maytansinoid B Antibody Conjugation
[0369] In this example, the antibodies (BsAb1, BsAb2) were conjugated to Maytansinoid B:
##STR00142##
to form
##STR00143## [0370] wherein Ab is BsAb1 or BsAB2.
[0371] The antibodies BsAb1 and BsAb2 10-20 mg/ml were conjugated with excess of maytansin-3-N-methyl-L-alanine-N-Me-beta-alanine-carbamyl-(p-amino)benzyl-citrulline-valine-adipoyl-succinate (Compound B1). The conjugates were purified by size exclusion chromatography or extensive ultrafiltration and sterile filtered. Protein concentrations were determined by UV spectral analysis. All conjugated antibodies were analyzed by UV for linker payload loading values according to Hamblett et al. (American Association for Cancer Research. 2004 Oct. 15; 10(20):7063-70) and/or by mass difference, native versus conjugated.
[0372] Compound B1 was synthesized following the methods described for Compound 1 in US 2018-0134794 A1 (U.S. Ser. No. 15/814,095), incorporated herein by reference in its entirety.
##STR00144##
Example 7. Site Specific Conjugation of HER2?HER2 Bispecific Antibodies with Tubulysin 1A and Campt-1
[0373] In this example, the bispecific antibodies BsAb1 and BsAb2 were site specifically conjugated to 2 or more LP of the following structure:
##STR00145##
which comprises the payload tubulysin 1A. Furthermore, the bispecific antibodies BsAb1 and BsAb2 were site specifically conjugated to the following:
##STR00146##
[0374] Site-specific conjugates of a cyclooctyne-spacer-payload to a wild-type antibody or antigen-binding fragment thereof were produced in three steps. The first step was deglycosylation of a wild-type antibody. The second step was microbial transglutaminase (MTG) based enzymatic attachment of a small molecule, such as an azido-PEG.sub.3-amine, to the Q295 site of the deglycosylated antibody (hereinafter MTG-based conjugation). The third step employed the attachment of a cyclooctyne-spacer-payload to the azido-functionalized antibody via a [2+3] cycloaddition, for example, the 1,3-dipolar cycloaddition between an azide and a cyclooctyne (aka copper-free click chemistry). See, Baskin, J. M.; Prescher, J. A.; Laughlin, S. T.; Agard, N. J.; Chang, P. V.; Miller, I. A.; Lo, A.; Codelli, J. A.; Bertozzi, C. R. PNAS 2007, 104 (43), 16793-7.
Step 1: Preparation of an Deglycosylated Antibody.
[0375] Deglycosylation was performed to expose the conjugation site. An anti-HER2 human IgG4 bispecific antibody (40 mg, 27 mg/mL in PBS; pH5.5-8.0) was mixed with PNGase F enzyme (New England BioLabs, 500,000 U/mL, 2 uL enzyme per 1 mg antibody, so 80 uL total). The reaction mixture was incubated at 37? C. overnight while gently shaking. The deglycosylation was monitored by ESI-MS. Upon reaction completion, the reaction mixture was used directly in next step.
Step 2: Preparation of an Azido-Functionalized Antibody.
[0376] The deglycosylated HER2?HER2 bispecific antibody (40 mg) in 1.5 mL PBS (pH 7.2) was incubated with 200 molar equivalents of the azido-PEG.sub.3-amine (MW=218.26 g/mol) in the presence of MTG (ACTIVA TI, Ajinomoto, Japan) (0.06 mg MTG per mg antibody). The reaction was incubated at 37? C. for 4 h then 25? C. overnight while gently mixing. The reaction was monitored by ESI-MS. Upon reaction completion, excess azido-PEG.sub.3-amine and MTG were removed by SEC (Superdex 200 PG, GE Healthcare), to generate the azido-functionalized antibody. The azido-PEG.sub.3-amine added to two Q295 sites on the antibody resulting in a 404 Da increase for the 2DAR antibody-PEG.sub.3-azide conjugate.
[0377] This process can also be carried out on antibodies having an N297Q modification in one or both heavy chains. In this instance, the azido-PEG.sub.3-amine would be added to two Q295 sites and at least one 297Q site on the antibody resulting in a 3DAR or 4DAR antibody-PEG.sub.3-azide conjugate.
Step 3: Preparation of Site-Specific Conjugates by a [2+3] Click Reaction Between the Azido-Functionalized Glutaminyl-Modified Antibodies and Cyclooctyne Containing Linker-Payload (LPs).
[0378] In general, an azido-functionalized antibody-LP conjugate was prepared by incubating the azido-functionalized glutaminyl-modified antibody with ?6 molar equivalents of LP, e.g., the compound of the following structure:
##STR00147##
dissolved in a suitable organic solvent (e.g., DMSO, DMF or DMA; reaction mixture contains 10-20% organic solvent, v/v) at 25? C. to 37? ? C. for 3-24 h. The progress of the reaction was monitored by ESI-MS. Absence of azido-functionalized antibody (mAb-PEG.sub.3-N.sub.3) indicated completion of the conjugation. The excess linker-payload (LP) and organic solvent were removed by desalting column or size exclusion chromatography (SEC). The purified conjugate was analyzed by SEC-HPLC and ESI-MS. Conjugates' monomer purity was >99% by SEC-HPLC analysis.
[0379] In a specific example, the azido-functionalized HER2?HER2 antibody, e.g. BsAb1 BsAb2, (31 mg) in 2.4 mL PBS was treated with six equivalents of Tubulysin 1ALP (conc. 10 mg/mL in DMA) at 30? ? C. overnight. The excess linker payload (LP) was removed by SEC (Superdex 200 PG, GE Healthcare). The final product was characterized by UV, SEC-HPLC (see
[0380] In a similar fashion, BsAb1 and BsAb2, both azido functionalized with a bis azido-alkyl substituted amine (bisSP1) as described at Q295, were treated with CAMPT-1-LP, which has the structure below, to provide BsAb1-Campt1 and BsAb2-Campt1, shown below.
##STR00148## ##STR00149##
[0381] CAMPT-1-LP (i.e., LP1) is synthesized as described in Scheme 1 and in Examples i-iii, below. Starting material L1-1 (CAS 2226472-26-8) was synthesized according to WO2018089373A2, incorporated by reference herein in its entirety.
##STR00150##
Example i: N-[(1S)-1-{[(1S)-4-(Carbamoylamino)-1-{[4-(hydroxymethyl)phenyl] carbamoyl}butyl]carbamoyl}-2-methylpropyl]-1-[2-(cyclooct-2-yn-1-yloxy)acetamido]-3,6,9,12-tetraoxapentadecan-15-amide (L1-2)
[0382] ##STR00151##
[0383] To a solution of compound L1-1 (0.17 g, 0.33 mmol) in DMF (10 mL) were added DIPEA (0.13 g, 1.0 mmol) and vcPAB (0.13 g, 0.34 mmol) successively, and the reaction mixture was stirred at RT for an hour. Reaction completion was monitored by LCMS. The resulting mixture was directly purified by reversed phase flash chromatography (0-80% acetonitrile in water) to give compound L1-2 (0.18 g, 70% yield) as a colorless oil. ESI m/z: 791.3 (M+H).sup.+. 1H NMR (400 MHZ, DMSO.sub.d6) ? 9.91 (s, 1H), 8.11 (d, J=8.4 Hz, 1H), 7.89 (d, J=8.8 Hz, 1H), 7.61 (t, J=5.6 Hz, 1H), 7.55 (d, J=8.4 Hz, 2H), 7.23 (d, J=8.4 Hz, 2H), 5.98 (t, J=5.6 Hz, 1H), 5.42 (s, 2H), 5.10 (br s, 1H),), 4.43 (s, 2H), 4.39-4.37 (m, 1H), 4.30-4.21 (m, 2H), 3.87 (d, J=14.8 Hz, 1H), 3.75 (d, J=14.8 Hz, 1H), 3.62-3.58 (m, 2H), 3.50-3.46 (m, 12H), 3.43 (t, J=6.0 Hz, 2H), 3.27-3.22 (m, 2H), 3.06-2.92 (m, 2H), 2.41-2.32 (m, 2H), 2.26-2.05 (m, 3H), 1.99-1.66 (m, 6H), 1.62-1.55 (m, 3H), 1.44-1.35 (m, 3H), 0.89 (d, J=6.8 Hz, 3H), 0.83 (d, J=6.8 Hz, 3H) ppm.
Example ii: {4-[(2S)-5-(Carbamoylamino)-2-[(2S)-2-{1-[2-(cyclooct-2-yn-1-yloxy) acetamido]-3,6,9,12-tetraoxapentadecan-15-amido}-3-methylbutanamido]pentanamido] phenyl} methyl 4-nitrophenyl carbonate (L1-3)
[0384] ##STR00152##
[0385] A suspension of compound L1-2 (80 mg, 0.10 mmol), DMAP (12 mg, 0.10 mmol) and DIPEA (26 mg, 0.20 mmol) in dry DMF (5 mL) was stirred at RT for 10 minutes before the addition of bis(4-nitrophenyl) carbonate (61 mg, 0.20 mmol). The reaction mixture was stirred at RT for 2 hours. Reaction completion was monitored by LCMS. The resulting mixture was directly purified by reversed phase flash chromatography (0-80% acetonitrile in water) to give compound L1-3 (53 mg, 55% yield) as a white solid. ESI m/z: 956.3 (M+H).sup.+.
Example iii: {4-[(2S)-5-(Carbamoylamino)-2-[(2S)-2-{1-[2-(cyclooct-2-yn-1-yloxy)acetamido]-3,6,9,12-tetraoxapentadecan-15-amido}-3-methylbutanamido]pentanamido] phenyl}methyl N-({[({[(10S,23S)-10-ethyl-18-fluoro-10-hydroxy-19-methyl-5,9-dioxo-8-oxa-4,15-diazahexacyclo[14.7.1.0.SUP.2,14..0.SUP.4,13..0.SUP.6,11..0.SUP.20,24.]tetracosa-1,6(11), 12,14,16,18,20(24)-heptaen-23-yl]carbamoyl}methoxy)methyl]carbamoyl}methyl)carbamate (LP1/CAMPT-1-LP)
[0386] ##STR00153##
[0387] To a yellow solution of compound L1-3 (16 mg, 17 ?mol) and Exatecan mesylate (12 mg, 17 ?mol) in dry DMF (2 mL) was added DIPEA (6.5 mg, 51 ?mol), and the clear reaction solution was stirred at RT for 2 hours. Reaction completion was monitored by LCMS. The resulting mixture was directly purified by reversed phase flash chromatography (0-60% acetonitrile in aq. TFA (0.01%)) to give linker-payload LP1 (15 mg, 63% yield as TFA salt) as a white solid. ESI m/z: 698.8 (M/2+H).sup.+. 1H NMR (400 MHZ, DMSO.sub.d6) ? 9.99 (s, 1H), 8.80 (t, J=6.8 Hz, 1H), 8.50 (d, J=9.2 Hz, 1H), 8.12 (d, J=7.2 Hz, 1H), 7.87 (d, J=8.8 Hz, 1H), 7.79 (d, J=10.8 Hz, 1H), 7.62-7.58 (m, 3H), 7.42 (t, J=6.0 Hz, 1H), 7.31 (s, 1H), 7.28 (d, J=8.4 Hz, 2H), 6.53 (br s, 1H), 5.98 (t, J=5.2 Hz, 1H), 5.63-5.57 (m, 1H), 5.46-5.37 (m, 3H), 5.21 (s, 2H), 4.93 (s, 2H), 4.63 (d, J=6.4 Hz, 2H), 4.41-4.35 (m, 1H), 4.29-4.21 (m, 2H), 4.02 (s, 2H), 3.87 (d, J=14.4 Hz, 1H), 3.75 (d, J=14.8 Hz, 1H), 3.63-3.58 (m, 4H), 3.50-3.48 (m, 12H), 3.46-3.41 (m, 2H), 3.27-3.24 (m, 2H), 3.23-3.12 (m, 2H), 3.07-2.91 (m, 2H), 2.47-2.45 (m, 0.5H), 2.41-2.33 (m, 4.5H), 2.25-2.04 (m, 5H), 1.99-1.69 (m, 9H), 1.63-1.54 (m, 3H), 1.44-1.33 (m, 3H), 0.88-0.82 (m, 9H) ppm. (The proton of TFA was not observed). 19F NMR (376 MHZ, DMSOd6) ? ?74 (TFA), ?111 (ArF) ppm.
[0388] Shown in Table 12 is a list of DAR (ESI-MS) values for the synthesized antibody tubulysin and camptothecin conjugates (ADCs).
Characterization of Antibody and ADCs by SEC-HPLC and LC-ESI-MS
[0389] The purified conjugates were analyzed by SEC-HPLC and ESI-MS, with representative SEC and ESI-MS.
[0390] Analytical SEC experiments were run using a Waters 1515 instrument, on a Superdex? 200 Increase (1.0?30 cm) column, at flow rate of 0.80 mL/min using PBS pH 7.2 and monitored at ?=280 nm using a Waters 2998 PDA. An analytic sample was composed of 30-80 ?L of test sample. The SEC results in
[0391] Measurement of intact mass for the ADC samples by LC-ESI-MS was performed to determine drug-payload distribution profiles and to calculate the average DAR. Each testing sample (20-50 ng, 5 ?L) was reduced by DTT then loaded onto an Acquity UPLC Protein BEH C.sub.4 column (10K psi, 300 ?, 1.7 ?m, 75 ?m?100 mm; Cat No. 186003810). After desalting for 3 min, the protein was eluted, and mass spectra were acquired by a Waters Synapt G2-Si mass spectrometer. As summarized in Table 12, most site-specific ADCs have near 2DAR.
TABLE-US-00012 TABLE 12 Antibody Drug Conjugate DARs DAR (by ADC ESI-MS) BsAb1-Tubulysin Anti HER2 BsAb1-PEG.sub.3-N.sub.3- 2.1 1A-LP Tubulysin 1A-LP BsAb2-Tubulysin Anti HER2 BsAb2-PEG.sub.3-N.sub.3- 2.1 1A-LP Tubulysin 1A-LP BsAb1-CAMPT1 Anti-HER2 BsAb1-subsituted 5.2 alkyl amine-(N.sub.3).sub.2-CAMPT-1-LP BsAb2-CAMPT1 Anti-HER2 BsAb1-subsituted 3.8 alkyl amine-(N.sub.3).sub.2-CAMPT-1-LP IC1-Tubulysin Isotype mAb-PEG.sub.3-N.sub.3-Tubulysin 2.0 1A-LP 1A-LP IC1-CAMP1 Isotype-substituted alkyl 3.8 amine-(N.sub.3).sub.2-CAMP-1-LP
[0392] The ADCs generated in this experiment were used in the following Examples.
Example 8. Surface Plasmon Resonance Derived Binding Affinities and Kinetic Constants of HER2?HER2 Human Bispecific Monoclonal Antibodies and Conjugated HER2?HER2 Human Bispecific Monoclonal Antibodies
[0393] Equilibrium dissociation constants (K.sub.D values) for hErbB2.mmh binding to anti-HER2?HER2 antibodies conjugated with either M830 or M1 were determined using a real-time surface plasmon resonance biosensor assay on a MASS-2 instrument. The MASS-2 sensor surface was derivatized by amine coupling with a monoclonal mouse anti-human Fc antibody (REGN2567) to capture anti-HER2?HER2 ADC and parent unmodified antibodies expressed with human constant regions. Biacore binding studies were performed in HBS-EP running buffer (0.01M HEPES pH 7.4, 0.15M NaCl, 3 mM EDTA, 0.05% v/v Surfactant P20). Human hErbB2 was prepared in-house expressing a C-terminal myc-myc-hexahistidine tag (hErbB2-MMH). Different concentrations (3-fold dilutions) of hErbB2-MMH (ranging from 90 nM to 1.1 nM) prepared in HBS-EP running buffer were injected over the anti-HER2?HER2 ADC or antibody captured surface at a flow rate of 30 uL/min. Association of hErbB2-MMH to each of the captured ADCs and monoclonal antibodies was monitored for 3 minutes. Subsequently, hErbB2-MMH dissociation was monitored for 10 minutes in HBS-EP running buffer. Anti-human Fc surface was regenerated by a brief injection of 20 mM H.sub.3PO.sub.4. All binding kinetic experiments were performed at 25? C.
[0394] Kinetic association (k.sub.a) and dissociation (K.sub.d) rate constants were determined by fitting the real-time sensorgrams to a 1:1 binding model using Scrubber 2.0c curve fitting software. All sensorgrams were double referenced by subtracting buffer injection sensorgram signal from the corresponding analyte sensorgram, thereby removing artifacts caused by dissociation of the antibody from the capture surface. Binding dissociation equilibrium constants (K.sub.D) and dissociative half-lives (t?) were calculated from the kinetic rate constants as:
TABLE-US-00013 TABLE 13 Biacore Binding Affinities of Bispecific Anti-HER2 mAbs and ADCs at 25? C. mAb Captured Antigen ADC (RU) Bound (RU) ka (1/Ms) kd (1/s) KD (M) t1/2 (min) BsAb1 155.4 ? 11.6 99.9 5.53E+05 3.99E?04 7.21E?10 29.0 BsAb2 387.1 ? 0.7 122.1 2.10E+05 ?1.00E?05 4.76E?11 ?1155.2 BsAb1-MCC- 169.1 ? 1.4 93.6 6.90E+05 3.53E?04 5.12E?10 32.7 Maytansinoid A BsAb2-MCC- 207.8 ? 1.2 82.8 2.18E+05 1.02E?05 4.69E?11 1131.5 Maytansinoid A BsAb1- 202.3 ? 1 114.1 5.51E+05 3.45E?04 6.26E?10 33.5 Tubulysin 1A-LP BsAb2- 214.2 ? 0.7 72.7 2.32E+05 ?1.00E?05 4.31E?11 ?1155.2 Tubulysin 1A-LP CompAb1 263 ? 0.7 149.4 2.73E+05 1.22E?04 4.47E?10 94.5 CompAb1-MCC- 102 ? 0.6 29.4 7.44E+04 1.40E?04 1.88E?09 82.4 Maytansinoid A CompAb1-MCC- 212.8 ? 0.6 111.6 2.89E+05 2.11E?04 7.28E?10 54.9 Maytansinoid A CompAb1-L- 232.2 ? 0.8 119.9 1.70E+05 1.54E?04 9.10E?10 74.8 Camptothecin CompAb2 305.8 ? 1.3 177.8 2.90E+05 ?1.00E?05 3.45E?11 ?1155.2 CompAb2- 103.4 ? 1.2 60.6 4.09E+05 2.08E?05 5.09E?11 554.3 Tubulysin 2A-LP BsAb1-CAMPT1 215.1 ? 1.5 117.1 5.97E+05 2.82E?04 4.72E?10 41.0 BsAb2-CAMPT1 212.3 ? 1 77.0 2.58E+05 1.00E?05 3.88E?11 1155.2
[0395] As shown in Table 13, the bispecific HER2?HER2 antibodies described herein exhibited T? values of up to greater than 1155 minutes.
Example 9: Processing of Cathepsin B Cleavable Linker
[0396] The ability of CompAb1 and BsAb2 to induce cleavage of the cathepsin B cleavable linker on T47D cells (ATCC Cat. #HTB-133) was studied. T47D cells were plated on collagen-coated 96-well optical plates (Greiner, Cat #655936) at 25,000 cells/well in complete media (RPMI 1640+10% FBS+5 ml Pen/Strep/Glutamine+1 mM NaPyr+10 mM Hepes+10 ug/ml Insulin) and incubated overnight at 37? C. in 5% CO.sub.2. The next day, cells were incubated for 30 minutes with cold (4? C.) media containing 10 ug/mL of fluorescent antibodies (antibodies labeled with Biosensor 1, see WO 2018/044540, incorporated by reference herein). After, cells were washed twice (5 minutes, 100 ul, 4 C, complete medium), recording medium was added (DPBS+2% FBS+10 mM HEPES) and confocal live imaging was started immediately afterwards. Images were acquired with a Zeiss Spinning Disc Confocal Microscope and analyzed using Zeiss Zen Blue software. Quantification of the integrated fluorescence of Alexa 568 (cleaved biosensor) was performed in single confocal sections of 36 different fields.
[0397] When the biosensor is intact it emits AF647 signal; upon internalization of biosensor-conjugated antibodies into endo/lysosomes and cleavage of the cathepsin B linker, both AF647 and AF568 signals are emitted. Table 14 shows that HER2?HER2 bispecific antibodies induce processing of the cathepsin B cleavable biosensor more efficiently than CompAb1. See also
TABLE-US-00014 TABLE 14 Florescence of Cleaved Biosensor in CompAb1 Compared to BsAb2 Time M378 Labeled in Antibodies Mins CompAb1 BsAb1 3 1.8E+05 2.7E+05 5 3.2E+05 1.1E+06 7 1.3E+05 1.8E+06 9 2.0E+05 2.1E+06 11 2.3E+05 1.9E+06 13 1.9E+05 2.2E+06 15 2.2E+05 2.4E+06 17 2.2E+05 2.5E+06 19 3.6E+05 3.0E+06 21 6.0E+05 3.2E+06 23 7.4E+05 3.7E+06 25 9.7E+05 5.1E+06 27 8.7E+05 5.6E+06 29 9.1E+05 6.2E+06 31 7.1E+05 6.7E+06 33 7.9E+05 8.5E+06 35 7.7E+05 9.9E+06 37 8.7E+05 1.1E+07 39 9.8E+05 1.3E+07 41 1.0E+06 1.5E+07 43 1.1E+06 1.7E+07 45 1.5E+06 1.9E+07 47 1.4E+06 2.1E+07 49 1.5E+06 2.4E+07 51 1.6E+06 2.6E+07 53 1.7E+06 2.8E+07 55 2.0E+06 3.0E+07 57 2.1E+06 3.3E+07 59 2.2E+06 3.6E+07 61 2.3E+06 3.9E+07 63 2.1E+06 4.2E+07 65 2.2E+06 4.5E+07 67 2.6E+06 4.7E+07 69 3.0E+06 4.9E+07 71 3.2E+06 5.0E+07 73 3.3E+06 5.3E+07 75 3.7E+06 5.5E+07 77 4.0E+06 5.9E+07 79 4.5E+06 6.3E+07 81 4.8E+06 6.7E+07 83 5.4E+06 7.1E+07 85 5.4E+06 7.5E+07 87 5.6E+06 7.9E+07 89 5.9E+06 8.2E+07 91 7.1E+06 8.5E+07 93 8.2E+06 8.8E+07 95 7.9E+06 9.1E+07 97 8.5E+06 9.5E+07 99 8.8E+06 9.7E+07 101 1.0E+07 1.0E+08 103 1.0E+07 9.5E+07 105 1.2E+07 1.0E+08 107 1.2E+07 1.1E+08 109 1.4E+07 1.0E+08 111 1.4E+07 1.0E+08 113 1.4E+07 1.1E+08 115 1.5E+07 1.1E+08 117 1.7E+07 1.1E+08 119 1.4E+07 1.1E+08 121 1.5E+07 1.2E+08 123 1.6E+07 1.1E+08 125 1.7E+07 1.1E+08 127 1.8E+07 1.2E+08 129 1.7E+07 1.2E+08 131 2.0E+07 1.0E+08 133 2.0E+07 1.2E+08 135 1.8E+07 1.2E+08 137 1.8E+07 1.2E+08 139 1.8E+07 1.2E+08 141 1.8E+07 1.3E+08 143 2.0E+07 1.2E+08 145 2.1E+07 1.3E+08 147 2.0E+07 1.3E+08 149 2.1E+07 1.3E+08 151 2.0E+07 1.3E+08
Example 10. In Vitro Cell Killing by HER2?HER2 Conjugates in HER2+ Cell Lines
[0398] To test the ability of CompAb1 and BsAb1 conjugated with either Maytansinoid A or Tubulysin A1-LP payloads to kill bioassay cells, in vitro cytotoxicity assays were performed. The assays were conducted on cells with varying levels of HER2 expression treated with decreasing ADC concentrations for 6 days. Cell viability was measured after treatment using Cell Titer Glow (Promega #G7571). For the assay, cells were grown in their respective media overnight at 37? C. in 5% CO.sub.2. The following day either CompAb1, HER2?HER2 bispecific antibody, or control antibodies, conjugated with either MCC-Maytansinoid A or Tubulysin A1-LP payload, were added to cells at final concentrations ranging from 66.67 nM to 0.01 nM in DMEM and 10% FBS and incubated for 6 days. After the incubation, 100 uL of cell titer glow were added to each well and incubated for 5 minutes at room temperature and shaking at 500 RPM. Luminiscence signal, which is proportional to the amount of APT in each well was measured with Envision 2105 multimode plate reader (Perkin Elmer). The IC.sub.50 values were determined from a two-phase decay equation over a 10-point response curve (GraphPad Prism). All IC.sub.50 values are expressed in nM concentration.
[0399] Table 15 shows that, in cells that express intermediate HER2 levels (ZR751 and JIMT1), the effect of CompAb1-MCC-Maytansinoid A was not different than control ADCs (IC.sub.50 value of 30-40 nM), BsAb1-MCC-Maytansinoid A showed modest efficacy (IC.sub.50 value of 6-7 nM), CompAb1-Tubulysin 1A-LP showed better efficacy (IC.sub.50 value of 0.15-0.2 nM) and BsAb1-Tubulysin 1A-LP showed the most efficient cell killing of all ADCs tested (IC.sub.50 value of 0.06-0.07 nM). In cells that express higher HER2 levels (MDAMB361, MDAMB453 and SKBR3), CompAb1-MCC-Maytansinoid A induced efficient cell killing (IC.sub.50 value of 0.04-0.5 nM), BsAb1-MCC-Maytansinoid A showed better efficacy (IC.sub.50 value of 0.02-0.1 nM), CompAb1-Tubulysin 1A-LP showed even better efficacy (IC.sub.50 value of 0.006-0.008 nM) and BsAb1-Tubulysin 1A-LP again showed the most efficient cell killing of all ADCs tested (IC.sub.50 value of 0.002-0.004 nM).
TABLE-US-00015 TABLE 15 Efficacy of ADCs Against Cells that Express Different HER2 Levels ZR751 JIMT1 MDAMB453 MDAMB361 SKBR3 IC50 IC50 IC50 IC50 IC50 Antibody-Payload DAR (nm) (nm) (nm) (nm) (nm) IC1-MCC- 2.9 40 40 20 9 9 Maytansinoid A CompAb1-MCC- 2.48 40 30 0.5 0.1 0.04 Maytansinoid A BsAb1 - MCC- 2.4 6 7 0.1 0.05 0.02 Maytansinoid A IC1-Tubulysin 1A- 1.9 40 67 67 20 10 LP CompAb1- 1.9 0.15 0.2 0.06 0.008 0.007 Tubulysin 1A-LP BsAb1-Tubulysin 2.10 0.06 0.07 0.02 0.003 0.004 1A-LP
Example 11. In Vitro Cell Killing in Low HER2 Expressing Cell Lines
[0400] To test the killing effect of BsAb1 Tubulysin 1A-LP, BsAb2 Tubulysin 1A-LP, and Medimmune comparator HER2?HER2-Tubulysin (CompAb2-Tubulysin 2A-LP) on bioassay cells, in vitro cytotoxicity assays were performed. The assays were conducted on normal primary cultures and breast cancer cells expressing low HER2 levels. Cells were treated with decreasing ADC concentrations for 6 days and cell viability was measured after treatment using Cell Titer Glow (Promega #G7571).
[0401] For the assay, cells were grown in their respective media overnight at 37? C. in 5% CO.sub.2. The following day either BsAb1-Tubulysin 1A-LP, BsAb2-Tubulysin 1A-LP, CompAb2-Tubulysin 2A-LP, or their respective non-binding control antibodies, were added to cells at final concentrations ranging from 66.67 nM to 0.01 nM in DMEM and 10% FBS and incubated for 6 days. After the incubation, 100 uL of cell titer glow was added to each well and incubated for 5 minutes at room temperature with shaking at 500 RPM. Luminiscence signal, which is proportional to the amount of APT in each well, was measured with Envision 2105 multimode plate reader (Perkin Elmer). The IC.sub.50 values were determined from a two-phase decay equation over a 10-point response curve (GraphPad Prism). All IC.sub.50 values are expressed in nM concentration.
[0402] Table 16 shows that BsAb1-Tubulysin 1A-LP and BsAb2-Tubulysin 1A-LP had little or no killing effect in cells expressing low HER2 levels (IC.sub.50 value of 8->67 nM). This surprising benefit illustrates the usefulness of the ADC in killing tumor cells while not targeting normal tissues. In contrast, CompAb2-Tubulysin 2A-LP, an ADC reported to have anti-tumor effect in HER2 IHC 0+ xenografts and toxicity in humans, induced cell killing at IC.sub.50 as low as 0.3 nM.
TABLE-US-00016 TABLE 16 Cytotoxicity of ADCs Against Low HER2 Expressing Cell Lines DAR Myocard Breast Lung Prostate MDAMB231 MDAMB468 T47D IC50 IC50 IC50 IC50 IC50 IC50 IC50 IC50 Ab-Payload (nm) (nm) (nm) (nm) (nm) (nm) (nm) (nm) IC1-Tubulysin 1A-LP 2.00 30.0 66.7 >67 >67 >67 >67 >67 IC1-Tubulysin 2A-LP 4.00 1.5 3.0 9.0 4.0 2 5 4.000 CompAb2- 3.00 6.0 20.0 >67 >67 0.3 20 4.000 Tubulysin 2A-LP BsAb2-Tubulysin 2.10 30.0 20.0 >67 >67 50 67 8.000 1A-LP BsAb1-Tubulysin 2.10 9.0 25.0 >67 30.0 40 50 8.000 1A-LP
Example 12. Dose Dependency of HER2?HER2 Bispecific Antibodies ADCs in JIMT1 Xenografts
[0403] To test the efficacy of BsAb1-Tubulysin 1A-LP in HER2 IHC2+ JIMT1 xenograft model, an in vivo tumor study was performed. For the assay, 6 week old female SCID mice (C.B-Igh-1b/lcrTac-Prkdcscid, Taconic Biosciences, n=50) were used. For implantation, JIMT1 (DSMZ Cat. #ACC589) cells were mixed with Matrigel (Corning, Cat #354234) and 150 uL of the cell and matrigel suspension containing 4?10.sup.6 cells was injected to SCID mice. 11 days later, indicated ADCs were injected subcutaneously at the indicated doses to SCID mice that were randomized based on tumor size. The xenograft size for each mouse was measured using a Caliper (Roboz, Cat #RS6466).
[0404] The average tumor size per treatment group for each time point measured is shown in Table 17. HER2?HER2 bispecific ADC, BsAb1-Tubulysin 1A-LP (DAR 2.1), showed tumor cell killing in a dose dependent fashion. Mice that received a single dose of 3 mg/kg HER2?HER2 bispecific ADC, BsAb1-Tubulysin 1A-LP, saw a significant and sustained reduction in JIMT1 xenograft size to an average size of 10 mm.sup.3 (at 123 days). Mice that received a single dose of 1 mg/kg HER2?HER2 bispecific ADC, BsAb1-Tubulysin 1A-LP, saw a reduction in JIMT1 xenograft size to an average size of 74 mm.sup.3 (at 28 days). In contrast, mice that received 3, 1, or 0.3 mg/kg isotype control ADC (IC1-Tubulysin 1A-LP; DAR 2) or saline saw little or no anti-tumor effect. See also
TABLE-US-00017 TABLE 17 JIMT1 Xenograft Tumor Size (mm.sup.3) After HER2 ? HER2 Bispecific ADC and Control ADC treatment IC1-Tubulysin IC1-Tubulysin IC1-Tubulysin BsAb1-Tubulysin BsAb1-Tubulysin BsAb1-Tubulysin Saline Av 1A-LP 3 mg/kg 1A-LP 1 mg/kg 1A-LP 0.3 mg/kg 1A-LP 3 mg/kg 1A-LP 1 mg/kg 1A-LP 0.3 mg/kg St St St St St St St Day Average Error Average Error Average Error Average Error Average Error Average Error Average Error 7 131 8 152 14 132 9 145 19 135 4 131 19 137 13 9 143 9 135 15 123 7 129 17 139 14 151 7 130 14 11 173 19 174 15 158 13 157 36 174 15 182 19 174 20 14 186 24 176 23 145 21 147 35 140 19 182 20 170 26 16 178 30 163 24 149 32 143 34 115 11 144 22 152 23 18 214 38 201 30 168 35 163 30 119 14 126 10 166 31 21 263 51 212 33 195 32 178 31 79 13 95 9 165 35 23 276 51 233 40 239 49 210 41 71 6 95 15 197 45 25 337 51 278 52 250 38 272 50 83 10 81 14 252 73 28 380 75 289 49 372 54 294 46 60 7 74 19 260 60 30 494 74 360 71 434 80 386 63 64 5 83 29 331 67 32 534 90 425 100 473 85 436 58 53 7 78 31 357 83 36 675 135 503 112 560 80 543 74 49 6 101 43 439 94 38 785 117 551 119 642 90 609 105 49 6 96 49 591 125 43 1049 174 684 163 930 163 775 142 41 2 135 70 766 155 45 1060 175 761 162 937 166 927 121 50 6 161 79 909 213 50 1047 234 1113 152 1264 250 56 6 226 113 1251 342 53 1072 199 1298 204 1402 250 45 4 228 122 1293 319 58 47 7 143 53 65 36 2 196 75 74 34 3 338 142 79 20 2 350 151 85 19 1 468 225 92 18 0 810 341 99 20 3 115 14 2 123 10 3 129 11 4 137 15 7 143 20 8 151 47 21 157 58 26
Example 13. In Vivo Efficacy of HER2?HER2 Bispecific ADCs Compared to CompAb1-MCC-Maytansinoid A
[0405] To compare the efficacy of BsAb1-Tubulysin 1A-LP, BsAb2-Tubulysin 1A-LP, and CompAb1-MCC-Maytansinoid A in HER2 IHC2+ JIMT1 xenograft model, an in vivo tumor study was performed. For the assay, 6 week old female SCID mice (C.B-Igh-1b/lcrTac-Prkdescid, Taconic Biosciences, n=50) were used. For implantation, JIMT1 (DSMZ, ACC589) cells were mixed with Matrigel (Corning, Cat #354234) and 150 uL of the cell and matrigel suspension containing 4?10.sup.6 cells was injected to SCID mice. 14 and 28 days later, indicated ADCs were injected subcutaneously to SCID mice that were randomized based on tumor size. The xenograft size for each mouse was measured using a Caliper (Roboz, Cat #RS6466).
[0406] The average tumor size per treatment group for each time point measured is shown in Table 18. Mice that received a single dose of 3 mg/kg BsAb1-Tubulysin 1A-LP or BsAb2-Tubulysin 1A-LP, saw a significant and sustained reduction in JIMT1 xenograft size to an average size of 18 and 6 mm.sup.3, respectively (83 and 97 days, respectively). In contrast, mice that received two doses of 10 mg/kg CompAb1-MCC-Maytansinoid A saw little or no anti-tumor effect, similar to mice that received a single 3 mg/kg dose of IC1-Tubulysin 1A-LP or two 10 mg/kg doses of IC1-MCC-Maytansinoid A. See also
TABLE-US-00018 TABLE 18 JIMT1 Xenograft Tumor Size (mm.sup.3) After Indicated ADC Treatment IC1-MCC- CompAb1-MCC- BsAb1- BsAb2- Maytansinoid A IC1-Tubulysin Maytansinoid A Tubulysin Tubulysin Saline 10 mg/kg 1A-LP 3 mg/kg 10 mg/kg 1A-LP 3 mg/kg 1A-LP 3 mg/kg St St St St St St Day Average Error Average Error Average Error Average Error Average Error Average Error 7 121 3 118 10 94 6 108 8 99 6 118 8 10 129 15 131 8 138 11 141 15 119 14 154 16 12 164 14 150 12 162 13 154 12 169 10 167 16 14 208 23 205 26 202 25 199 26 199 19 202 19 (Dose 1) 17 225 24 226 32 219 26 235 33 208 23 213 25 19 254 38 276 41 245 35 238 43 195 24 190 20 24 327 35 356 44 323 42 288 38 138 18 160 13 26 377 44 345 52 347 51 303 36 110 19 120 6 28 435 30 431 64 403 63 347 54 96 15 105 10 (Dose 2) 31 550 51 504 91 563 93 468 75 98 14 94 11 34 642 92 599 104 655 127 480 84 77 12 77 11 39 883 131 740 140 819 110 588 101 51 6 67 6 42 1013 201 841 164 987 136 675 129 60 15 51 7 46 1132 197 1009 183 1168 127 775 144 40 6 33 7 48 1364 229 1043 181 1282 130 894 164 36 9 33 7 54 972 216 28 5 19 4 56 1143 239 28 5 20 4 62 1320 229 20 4 15 1 69 1946 320 20 3 10 3 76 2345 363 18 5 8 3 83 18 2 8 3 97 22 9 6 3 105 34 14 12 5 111 48 27 15 4 119 68 37 16 7 125 119 70 26 11 133 174 96 40 18 139 200 113 49 21 146 340 195 84 44 153 431 251 138 67 161 599 348 252 142
Example 14. Efficacy of BsAb1-Tubulysin 1A-LP Compared to CompAb1-MCC-Maytansinoid
[0407] A in MDAMB361 Xenografts
[0408] To compare the efficacy of BsAb1-Tubulysin 1A-LP and CompAb1-MCC-Maytansinoid A in HER2 IHC2+ MDAMB361 xenograft model, an in vivo tumor study was performed. For the assay, 6 week old female SCID mice (C.B-Igh-1b/lcrTac-Prkdcscid, Taconic Biosciences, n=50) were used. One day before cell implantation, mice were subcutaneously implanted with 17b-Estradiol pellets (0.72 mg, 60 days release. Innovative research of America #SE-121). The next day, MDAMB361 (DSMZ, ACC589) cells were mixed with Matrigel (Corning, Cat #354234) and 150 uL of the cell and matrigel suspension containing 6?10.sup.6 cells was injected to SCID mice. 19 days later, indicated ADCs were injected subcutaneously at the indicated doses to SCID mice that were randomized based on tumor size. A second dose was administered at day 52 to the BsAb1-Tubulysin 1A-LP-treated cohort to assess development of drug resistance. The xenograft size for each mouse was measured using a Caliper (Roboz, Cat #RS6466).
[0409] The average tumor size per treatment group for each time point measured is shown in Table 19. Mice that received a single dose of 3 mg/kg BsAb1-Tubulysin 1A-LP (DAR 2.1) saw a partial reduction in MDAMB361 xenograft size from an average size of 202 mm.sup.3 to an average size of 122 mm.sup.3 by day 38. A second dose administered at day 52 caused further regression of xenograft tumor size to 70 mm.sup.3 by day 76. In contrast, mice that received a single 3 mg/kg dose of CompAb1-MCC-Maytansinoid A (DAR 3.1) or control ADCs (IC1-MCC-Maytansinoid A, DAR 3.6, or IC1-Tubulysin 1A-LP, DAR 2) or saline, saw little or no anti-tumor effect. See also
TABLE-US-00019 TABLE 19 MDAMB361 Xenograft Tumor Size (mm.sup.3) After Indicated ADC Treatment. IC1-MCC- CompAb1-MCC- Maytansinoid A IC1-Tubulysin Maytansinoid A BsAb1-Tubulysin Saline 1 1 ? 3 mg/kg 1A-LP 1 ? 3 mg/kg 1 ? 3 mg/kg 1A-LP 2 ? 3 mg/kg St St St St St Day Average Error Average Error Average Error Average Error Average Error 11 113 22 101 17 97 8 97 14 105 11 14 141 19 146 30 134 18 127 20 134 13 17 150 20 152 15 176 20 162 10 155 17 19 203 49 203 21 208 26 204 20 202 20 (Dose 1) 21 278 76 283 55 346 92 249 36 233 36 24 444 116 456 70 550 148 385 78 230 45 26 507 115 540 85 635 129 580 99 213 44 28 560 135 666 80 810 138 729 144 225 48 31 590 124 734 81 726 113 171 34 33 633 116 757 67 789 150 146 32 35 739 145 795 55 816 141 123 33 38 122 32 40 133 39 45 128 42 47 153 51 49 214 68 52 238 73 (Dose 2) 54 269 87 56 235 75 59 224 72 61 235 76 63 240 79 66 166 59 68 190 63 70 141 49 74 70 27 76 70 27 80 104 65 84 105 65 90 157 120 97 306 230
Example 15. Efficacy of BeAb1-Tubulysin 1A-LP Compared to CompAb1-MCC-Maytansinold A in N87 Xenografts
[0410] To compare the efficacy of BsAb1-Tubulysin 1A-LP and CompAb1-MCC-Maytansinoid A in HER2 IHC3+ N87 xenograft model, an in vivo tumor study was performed. For the assay, 6 week old female SCID mice (CBySmn.CB17-Prkdcscid/J, Jackson Labs #001803, n=50) were used. For implantation, N87 (ATCC, HTB-5822) cells were mixed with Matrigel (Corning, Cat #354234) and 150 uL of the cell and matrigel suspension containing 3.6?10.sup.6 cells was injected to SCID mice. 12 days later, indicated ADCs were injected subcutaneously at the indicated doses to SCID mice that were randomized based on tumor size. Two additional doses were administered at days 25 and 39 to the cohort treated with 1 mg/kg BsAb1-Tubulysin 1A-LP. The xenograft size for each mouse was measured using a Caliper (Roboz, Cat #RS6466).
[0411] The average tumor size per treatment group for each time point measured is shown in Table 20. Mice that received a single dose of 3 mg/kg BsAb1-Tubulysin 1A-LP (DAR 2.1), saw a significant and durable reduction in N87 xenograft size to an average size of 25 mm.sup.3 (day 57). Mice that received a single dose of 10 mg/kg CompAb1-MCC-Maytansinoid A (DAR 3.1) saw a significant reduction in N87 xenograft size to an average size of 15 mm.sup.3 however (day 29), tumor escaped earlier (i.e. became resistant to the treatment) than those treated with BsAb1-Tubulysin 1A-LP (day 51 versus day 88). Mice that received three doses of 1 mg/kg BsAb1-Tubulysin 1A-LP saw a partial reduction in N87 xenograft size to an average size of 109 mm.sup.3 (day 35). In contrast, mice that received a single dose of control ADCs (3 mg/kg IC1-Tubulysin 1A-LP, DAR 2, or 10 mg/kg IC1-MCC-Maytansinoid A, DAR 3.6) did not see anti-tumor effect. See also
TABLE-US-00020 TABLE 20 N87 Xenograft Tumor Size (mm.sup.3) After Indicated ADC Treatment IC1-MCC- CompAb1-MCC- Maytansinoid A IC1-Tubulysin Maytansinoid A BsAb1-Tubulysin BsAb1-Tubulysin 1 ? 10 mg/kg 1A-LP 1 ? 3 mg/kg 1 ? 10 mg/kg 1A-LP 1 ? 3 mg/kg 1A-LP 3 ? 1 mg/kg St St St St St Day Average Error Average Error Average Error Average Error Average Error 5 25 5 31 8 26 5 31 7 33 6 8 88 13 84 14 89 17 88 13 80 11 10 162 22 165 21 147 23 157 10 133 10 12 161 13 161 13 173 26 164 20 157 14 (Dose 1) 15 221 30 208 37 152 34 186 37 202 23 17 304 29 269 30 138 26 238 34 213 25 19 348 16 338 42 71 13 169 24 185 20 21 427 20 425 68 33 9 124 16 185 40 23 541 53 501 97 44 26 137 24 149 19 25 569 23 566 81 34 18 90 12 168 31 (Dose 2) 28 672 104 642 107 17 5 58 10 149 33 29 688 102 668 115 15 5 52 9 129 24 31 720 76 689 102 22 11 42 8 136 31 35 824 83 786 104 16 12 39 8 109 21 37 1066 134 909 147 24 20 37 10 131 24 39 975 113 955 150 34 28 31 8 186 47 (Dose 3) 42 1284 275 1165 233 52 47 44 11 206 58 44 1225 158 1118 224 64 46 44 11 256 67 46 1472 250 1220 278 64 51 33 12 265 77 49 1492 289 1446 281 72 59 29 12 326 98 51 112 89 30 12 285 68 53 127 105 28 12 333 105 57 134 104 25 13 363 113 59 144 103 26 15 472 134 63 204 162 36 25 572 183 65 218 161 34 26 543 165 67 227 160 39 25 559 172 73 257 188 51 39 653 179 80 367 247 64 51 701 196 88 504 295 113 97 938 305 95 737 424 119 106 1084 364 101 912 525 193 177 1182 360
Example 16. In Vivo Comparison of Three ADCs in JIMT1 Xenografts
[0412] To compare the efficacy of BsAb1-Tubulysin 1A-LP with CompAb1-MCC-Maytansinoid A (DAR 3.1) and CompAb1-L-Camptothecin (DAR 8) in HER2 IHC2+ JIMT1 xenograft model, an in vivo tumor study was performed. For the assay, 6 week old female SCID mice (CBySmn.CB17-Prkdcscid/J, Jackson Labs #001803, n=50) were used. For implantation, JIMT1 (DSMZ, ACC589) cells were mixed with Matrigel (Corning, Cat #354234) and 150 uL of the cell and matrigel suspension containing 4?10.sup.6 cells was injected to SCID mice. 13, 20 and 27 days later, indicated ADCs were injected subcutaneously at the indicated doses to SCID mice that were randomized based on tumor size. One cohort received a single 3 mg/kg dose of BsAb1-Tubulysin 1A-LP at day 13. The xenograft size for each mouse was measured using a Caliper (Roboz, Cat #RS6466). The average tumor size per treatment group for each time point measured is shown in Table 21.
[0413] Mice that received a single dose of 3 mg/kg BsAb1-Tubulysin 1A-LP (DAR 2.1) saw a significant and durable reduction in JIMT1 xenograft size to an average size of 3 mm.sup.3 (day 79) Mice that received three weekly doses of 1 mg/kg BsAb1-Tubulysin 1A-LP saw a partial reduction in JIMT1 xenograft from an average size of 179 mm.sup.3 to an average size of 63 mm.sup.3 by day 44. In contrast, mice that received three weekly doses of 10 mg/kg CompAb1-L-Camptothecin saw only a slow-down in tumor progression that reached an average size of 374 mm.sup.3 by day 44. In contrast, mice that received weekly doses of 10 mg/kg CompAb1-MCC-Maytansinoid A or control ADCs (3 mg/kg IC1-Tubulysin 1A-LP, 10 mg/kg IC1-L-Camptothecin or 10 mg/kg IC1-MCC-Maytansinoid A) did not see anti-tumor effect. See also
TABLE-US-00021 TABLE 21 JIMT1 Xenograft Tumor Size (mm.sup.3) After Indicated ADC Treatment IC1-MCC- IC1-L- CompAb1-MCC- CompAb1-L- Maytansinoid A Camptothecin IC1-Tubulysin Maytansinoid A Camptothecin BsAb1-Tubulysin BsAb1-Tubulysin 3 ? 10 mg 3 ? 10 mg 1A-LP 3 ? 1 mg 3 ? 10 mg 3 ? 10 mg 1A-LP 3 ? 1 mg 1A-LP 1 ? 3 mg St St St St St St St Day Average Error Average Error Average Error Average Error Average Error Average Error Average Error 7 92 8 88 13 101 12 85 6 84 10 91 5 102 11 9 128 12 128 12 126 12 127 11 121 19 121 9 147 16 13 180 18 178 13 182 11 180 13 182 11 179 9 180 13 15 226 23 211 22 217 35 215 38 204 31 203 31 190 17 17 234 30 228 22 236 44 231 39 225 37 195 29 184 14 20 293 49 276 36 318 50 276 49 225 37 195 29 186 10 23 379 69 314 42 335 57 294 43 224 32 178 30 128 12 27 421 75 370 52 407 64 381 62 184 26 150 18 111 8 29 468 96 420 70 459 68 433 78 227 44 124 29 82 12 31 537 91 446 68 471 66 468 79 219 49 113 23 67 11 34 624 117 559 83 547 71 516 70 249 44 109 22 53 9 36 634 121 575 92 547 71 615 103 281 44 98 18 46 8 38 707 131 660 86 739 109 690 94 315 34 85 20 46 6 41 756 142 694 120 771 111 735 99 345 41 75 24 34 4 44 858 157 782 124 902 144 828 92 374 49 63 22 19 5 48 991 186 842 116 1076 169 932 100 446 53 74 36 10 3 50 1023 180 970 144 1161 175 1078 130 500 44 96 59 10 3 53 1143 186 1027 152 1139 165 1170 123 557 54 106 58 8 3 57 1348 234 1296 236 1465 192 1348 119 727 94 149 81 10 5 65 1874 257 1641 237 1705 284 1776 161 963 112 187 91 10 3 69 2188 323 2120 284 2178 285 1161 159 239 122 6 2 79 291 132 3 1 86 389 178 4 3
Example 17. Efficacy of HER2?HER2M830 Bispecific Antibody Drug Conjugate Compared to CompAb1-MCC-Maytansinoid A in JIMT1 Xenografts
[0414] To compare the efficacy of BsAb1-Tubulysin 1A-LP and CompAb1-MCC-Maytansinoid A (DAR 3.1) in HER2 IHC2+ CTG0807, an in vivo tumor study was performed. For the assay, 6-8 week old female Athymic Nude-Fox1nu mice (Envifo, Indianapolis, Indiana) were used.
[0415] Pre-study Animals: When sufficient stock animals reached 1.0-1.5 cm.sup.3, tumors were harvested for re-implantation into pre-study animals. Pre-study animals were implanted unilaterally on the left flank with tumor fragments harvested from stock animals. Study Animals: Pre-study tumor volumes were recorded for each experiment beginning seven to ten days after implantation. When tumors reached an average tumor volume of 150-300 mm.sup.3 animals were matched by tumor volume into treatment or control groups to be used for dosing and dosing initiated on Day 0. Tumor volumes were measured twice weekly.
[0416] Matched study animals were injected intravenously at the indicated doses. The average tumor size per treatment group for each time point measured is shown in Table 22.
[0417] Mice that received three weekly doses of 3 mg/kg BsAb1-Tubulysin 1A-LP (DAR 2.1) saw a complete (0 mm.sup.3) and durable reduction in CTG0807 PDX tumor size. Mice that received three weekly doses of 1 mg/kg BsAb1-Tubulysin 1A-LP saw a delay in tumor growth, as tumor size remained below 300 mm.sup.3 for 30 days. Mice that received three weekly doses of 10 mg/kg CompAb1-MCC-Maytansinoid A (DAR 3.1) continued to grow during and after treatment, although at a slightly slower rate than tumors treated with three weekly doses of PBS or ADC control (10 mg/kg IC1-MCC-Maytansinoid A or 3 mg/kg IC1-Tubulysin 1A-LP). See also
TABLE-US-00022 TABLE 22 CTG0807 PDX Tumor Size (mm.sup.3) After Indicated ADC Treatment IC1-MCC- CompAb1-MCC- IC1-Tubulysin BsAb1-Tubulysin BsAb1-Tubulysin Maytansinoid A Maytansinoid A 1A-LP 1A-LP 1A-LP Day Saline 3 ? 10 mg/kg 3 ? 10 mg/kg 3 ? 3 mg/kg 3 ? 3 mg/kg 3 ? 1 mg/kg Tumor Volume - Mean 0 220 222 233 220 231 221 2 349 341 296 315 310 287 7 478 463 386 429 317 342 9 561 594 471 537 341 380 13 728 683 518 707 337 349 16 783 752 565 756 278 284 20 834 801 574 786 278 289 23 925 897 623 859 253 285 27 962 971 645 871 156 245 30 1123 1169 744 1105 151 278 34 1260 1418 858 1309 80 304 37 1488 1549 941 1439 79 331 41 1579 1064 1677 50 368 44 1225 26 405 47 1330 21 458 51 1522 15 490 55 14 530 58 15 608 62 7 705 65 0 828 69 0 1095 72 0 1149 76 0 1316 79 0 1436 83 0 1739 86 0 90 0 Tumor Volume - SEM 0 7 7 6 7 6 8 2 37 19 30 31 31 19 7 44 45 51 26 41 17 9 57 51 86 66 48 17 13 69 50 104 85 40 32 16 72 33 107 95 33 34 20 64 34 108 100 34 35 23 52 64 123 104 33 30 27 68 88 131 102 25 33 30 92 112 163 131 30 47 34 120 163 206 175 27 60 37 92 182 217 190 25 66 41 138 282 215 16 80 44 324 11 92 47 333 13 113 51 388 9 124 55 8 138 58 9 158 62 7 191 65 0 217 69 0 288 72 0 303 76 0 347 79 0 380 83 0 455 86 0 90 0
Example 18. Efficacy of BsAb1-Tubulysin 1A-LP Compared to CompAb1-MCC-Maytansinoid A in JIMT1 Xenografts
[0418] To compare the efficacy of BsAb1-Tubulysin 1A-LP and CompAb1-MCC-Maytansinoid A in HER2 IHC2+ CTG1184, an in vivo tumor study was performed. For the assay, 6-8 week old female Athymic Nude-Fox1 nu mice (Envifo, Indianapolis, Indiana) were used.
[0419] Pre-study Animals: When sufficient stock animals reached 1.0-1.5 cm.sup.3, tumors were harvested for re-implantation into pre-study animals. Pre-study animals were implanted unilaterally on the left flank with tumor fragments harvested from stock animals. Study Animals: Pre-study tumor volumes were recorded for each experiment beginning seven to ten days after implantation. When tumors reached an average tumor volume of 150-300 mm.sup.3 animals were matched by tumor volume into treatment or control groups to be used for dosing and dosing initiated on Day 0. Tumor volumes were measured twice weekly.
[0420] Matched study animals were injected intravenously at the indicated doses. The average tumor size per treatment group for each time point measured is shown in Table 23.
[0421] Mice that received three weekly doses of 3 mg/kg and 1 mg/kg BsAb1-Tubulysin 1A-LP (DAR 2.1) saw a significant and durable reduction in CTG1184 PDX tumor size to an average value of 6 (day 52) and 13 mm.sup.3 (day 45), respectively. Mice that received three weekly doses of 3 mg/kg IC1-Tubulysin 1A-LP (control ADC) or 10 mg/kg CompAb1-MCC-Maytansinoid A (DAR 3.1) continued to grow during and after treatment, although at a slower rate than tumors treated with three weekly doses of PBS or 10 mg/kg IC1-MCC-Maytansinoid A (control ADC). See also
TABLE-US-00023 TABLE 23 CTG1184 PDX tumor size after indicated ADC treatment. IC1-MCC- CompAb1-MCC- Maytansinoid A Maytansinoid A IC1-Tubulysin BsAb1-Tubulysin BsAb1-Tubulysin Day Saline 3 ? 10 mg/kg 3 ? 10 mg/kg 1A-LP 3 ? 3 mg/kg 1A-LP 3 ? 3 mg/kg 1A-LP 3 ? 1 mg/kg Tumor Volume - Mean 0 218 220 222 223 224 220 3 513 437 334 312 238 250 6 879 627 509 399 144 186 9 1435 805 616 535 123 134 13 1565 1124 665 492 72 104 17 1477 815 614 74 84 20 1994 1176 636 56 70 24 1660 818 28 60 27 1044 27 41 31 1372 19 57 34 1687 13 26 38 10 17 41 7 14 45 10 13 48 12 14 52 6 15 55 8 22 60 8 27 Tumor Volume - SEM 0 17 13 14 11 14 14 3 109 73 53 22 29 14 6 255 106 73 54 26 23 9 364 113 105 96 23 15 13 276 162 137 146 4 10 17 232 176 193 5 11 20 341 219 203 3 6 24 411 254 10 8 27 278 11 5 31 359 13 7 34 411 7 12 38 6 8 41 4 8 45 6 7 48 8 7 52 4 9 55 5 8 60 5 9
Example 19. Immunohistochemistry (IHC) Staining to Assess the Level of HER2 in Tumor Cell Lines and Patient-Derived Xenografts
[0422] The PDX models used in Examples 17 and 1 were confirmed to be HER IHC 2+/3+ for CTG1184 according to the following method. Tissue samples were fixed in 10% neutral buffer formalin for 12 hours at 4? C. in the dark, washed 3? with PBS, dehydrated in a graded ethanol series (1?70%, 80%, 90% and 4?100%, 30 min each), processed in xylene and paraffin (3?, 30 min each) using Tissue-Tek? followed by embedding to generate 4 ?m tissue sections. IHC staining was performed using the protocol provided with HercepTest? Kit. HER2 IHC score was determined by visual comparison of tissue and control sections.
TABLE-US-00024 TABLE 24 IHC Score of Cell Lines and Patient Derived Xenografts Samples Sample type HER2 IHC Score MDAMB468 Cell line 0+ MDAMB231 Cell line 0+ T47D Cell line 1+ JIMT-1 Xenograft 2+ MDAMB361 Xenograft 2+ N-87 Xenograft 3+ CTG0807 PDX 2+/3+ CTG1184 PDX 2+
[0423] In summary, the present inventors have observed that efficient internalization of HER2?HER2 antibodies dramatically increased processing of cathepsin B-cleavable linker in intracellular vesicles. In accordance with that, HER2?HER2-Tubulysin killed cell lines expressing not only high, but also intermediate HER2 levels with sub-nanomolar IC.sub.50. Moreover, HER2?HER2-Tubulysin induced complete and durable tumor regression in a number of HER2 IHC 3+ and 2+ tumor xenograft and PDX models.
Example 20. Efficacy of BsAb1-Campt1 and BsAb2-Campt2 Compared to Comp ADCs in N87 Xenografts
[0424] To compare the efficacy of BsAb1-Camp1 and BsAb2-Camp1 ADCs to CompAb1-MCC-Maytansinoid A, COMPAb1-GGFG-Dxd and BsAb2-Tubulysin 1A-LP in HER2 IHC3+ N87 xenograft model, an in vivo tumor study was performed. For the assay, 6 week old female SCID mice (CBySmn.CB17-Prkdescid/J, Jackson Labs #001803, n=50) were used. For implantation, N87 (ATCC, HTB-5822) cells were mixed with Matrigel (Corning, Cat #354234) and 150 uL of the cell and matrigel suspension containing 4?10.sup.6 cells was injected to SCID mice. 7 days later, indicated ADCs were injected subcutaneously at the indicated doses to SCID mice that were randomized based on tumor size. Two additional doses were administered at days 14 and 21 to the cohort treated with 1 mg/kg H4H17087D-Tubulysin 1A-LP. The xenograft size for each mouse was measured using a Caliper (Roboz, Cat #RS6466).
[0425] Mice that received a single dose of 10 mg/kg BsAb1-Campt1 or BsAb2-Camp1 saw complete regression of N87 tumors out to 110 days. The anti-tumor activity was comparable to that of 10 mg/kg CompAb1-GGFG-Dxd and 3 mg/kg BsAb2-Tubulysin 1A-LP. Mice that received a single dose of 10 mg/kg CompAb1-MCC-Maytansinoid A initially saw a significant reduction in N87 xenograft size but 5 of 5 tumors escaped treatment by day 50. A similar average anti-tumor response was observed for mice that received three doses of 1 mg/kg BsAb2-Tubulysin 1A-LP, however only 2 of 5 tumors escaped treatment. In contrast, mice that received a single dose of control ADCs did not see anti-tumor effect. See
Example 21. Epitope Mapping Data for binding of BsAb2 to Erbb2.mmH
[0426] Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) was performed to determine the amino acid residues of human epidermal growth factor receptor 2 that interact with the bivalent parental antibodies that comprise the binding arms of BsAb2 (Parental Ab1 and Parental Ab2). In this experiment a recombinantly produced version of the ecto domain (ECD) region of HER2 with a 6 histidine tag was used (SEQ ID NO: 54). A general description of the HDX-MS method is set forth in e.g., Ehring (1999) Analytical Biochemistry 267(2):252-259; and Engen and Smith (2001) Anal. Chem. 73:256A-265A.
[0427] The HDX-MS experiments were performed on a customized platform, consisting of a custom HDX automation system for deuterium labeling and quenching, a Waters Acquity Binary Solvent Manager for sample digestion and trapping, another Waters Acquity Binary Solvent Manager for analytical gradient, and a Thermo Q Exactive HF mass spectrometer for peptide identification and mass measurement.
[0428] The D.sub.2O labeling solution was prepared in D20 based buffer (50 mM phosphate, 100 mM sodium chloride, at pD 7.0). For deuterium labeling, 10 ?L of 0.93 mg/mL Her2 protein or Her2 protein premixed with either bivalent parental (antigen to antibody molar ratio 1:0.7) were incubated at 20? ? C. with 90 ?L of D.sub.2O labeling solution for various time-points in duplicates (non-deuterated control as 0 min; deuterium-labeling for 15 s, 60 s, 600 s, 3600 s and 6000 s). The deuteration reaction was quenched by adding 100 uL of 4 M guanidine hydrochloride, 0.85 M TCEP buffer (acidified by HCl to pH 2.3) to each sample for a 180-second incubation at 15? C. The quenched samples were then injected into the LC system for online pepsin digestion at 15? C. The digested peptides were trapped by a C8 column (1 mm?50 mm, Novabioassays) at ?6? C. with a 12.5 min gradient from 2-32% for solvent B. (mobile phase A: 0.2% formic acid in water, mobile phase B: 0.2% formic acid in acetonitrile). The eluted peptides were analyzed by a Thermo Q Exactive HF mass spectrometry in LC-MS/MS or LC-MS mode.
[0429] The LC-MS/MS data from the undeuterated Her2 samples were searched against a database including amino acid sequences of Her2 protein and their reversed sequences using the Byonic search engine (Protein Metrics). The search parameters were set as default using non-specific enzymatic digestion and human glycosylation as common variable modification. The list of identified peptides was then imported into HDX WorkBench software (version 3.3) to calculate the deuterium uptake (D-uptake) and percentage of deuterium uptake (% D) for all deuterated samples. The residue number for the peptides is derived from the actual protein sequence (N-term residue T as 1.sup.st AA) including the tag.
[0430] A total of 351 peptides from Her2 were identified from both Her2 alone and Her2 in complex with Parental Ab1 samples, representing 100% sequence coverage of Her2. Any peptide that exhibited greater than 5% decrease in percentage of deuterium uptake was defined as significantly protected (? % D<?5%). Her2 ECD showed significant reduction in deuterium uptakes upon binding to mAb Parental Ab1 at sequences AA141-145, YQDTI (SEQ ID NO: 55), and AA166-182, RSRACHPCSPMCKGSRC (SEQ ID NO: 56), which were assigned as the epitope on human Her2 ECD targeted by Parental Ab1. The deuterium uptake data for peptides covering epitope regions I (AA141-145, YQDTI, SEQ ID NO: 55) and II (AA166-182, RSRACHPCSPMCKGSRC, SEQ ID NO: 56) are shown in
[0431] A total of 366 peptides from Her2 were identified from both Her2 alone and Her2 in complex with Parental Ab2 samples, representing 100% sequence coverage of Her2. Any peptide that exhibited greater than 5% decrease in percentage of deuterium uptake was defined as significantly protected (? % D<?5%). Her2 ECD showed significant reduction in deuterium uptakes upon binding to Parental Ab2 at sequences AA9-23, MKLRLPASPETHLDM (SEQ ID NO: 57), AA41-51, TYLPTNASLSF (SEQ ID NO: 58), AA64-77, IAHNQVRQVPLQRL (SEQ ID NO: 59). In addition, there was significant reduction in deuterium uptakes at sequence AA353-359, AFLPESF (SEQ ID NO: 60), which could be due to allosteric effects. The deuterium uptake data for peptides covering epitope regions I (AA9-23, MKLRLPASPETHLDM, SEQ ID NO: 57), II (AA41-51, TYLPTNASLSF, SEQ ID NO: 58 and III (AA64-77, IAHNQVRQVPLQRL, SEQ ID NO: 59), and the peripheral epitope region IV (AA353-359, AFLPESF, SEQ ID NO: 60) are shown in
Example 22. Epitope Mapping Data for binding of BsAb1 to Erbb2.mmH
[0432] Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) was performed to determine the amino acid residues of HER2 that interact with the bivalent parental antibodies that comprise the binding arms of BsAb1 (Parental Ab3 and Parental Ab4). The same recombinant HER2 protein as described in Example 21 was used (SEQ ID NO: 54).
[0433] The HDX-MS experiments were performed on a customized platform, consisting of a custom HDX automation system for deuterium labeling and quenching, a Waters Acquity Binary Solvent Manager for sample digestion and trapping, another Waters Acquity Binary Solvent Manager for analytical gradient, and a Thermo Q Exactive HF mass spectrometer for peptide identification and mass measurement.
[0434] The D.sub.2O labeling solution was prepared in D20 based buffer (50 mM phosphate, 100 mM sodium chloride, at pD 7.0). For deuterium labeling, 10 ?L of 0.93 mg/mL Her2 protein or Her2 protein premixed with either Parental Ab3 or Parental Ab4 (antigen to antibody molar ratio 1:0.7) were incubated at 20? C. with 90 uL of D.sub.2O labeling solution for various time-points in duplicates (non-deuterated control as 0 min; deuterium-labeling for 15 s, 60 s, 600 s and 3600 s). The deuteration reaction was quenched by adding 100 ?L of 4 M guanidine hydrochloride, 0.85 M TCEP buffer (acidified by HCl to pH 2.3) to each sample for a 180-second incubation at 15? C. The quenched samples were then injected into the LC system for online pepsin digestion at 15? C. The digested peptides were trapped by a C8 column (1 mm?50 mm, Novabioassays) at ?6? C. with a 12.5 min gradient from 2-32% for solvent B. (mobile phase A: 0.2% formic acid in water, mobile phase B: 0.2% formic acid in acetonitrile). The eluted peptides were analyzed by a Thermo Q Exactive HF mass spectrometry in LC-MS/MS or LC-MS mode.
[0435] The LC-MS/MS data from the undeuterated Her2 samples were searched against a database including amino acid sequences of Her2 protein and their reversed sequences using the Byonic search engine (Protein Metrics). The search parameters were set as default using non-specific enzymatic digestion and human glycosylation as common variable modification. The list of identified peptides was then imported into HDX WorkBench software (version 3.3) to calculate the deuterium uptake (D-uptake) and percentage of deuterium uptake (% D) for all deuterated samples. The residue number for the peptides is derived from the actual protein sequence (N-term residue T as 1.sup.st AA) including the tag.
[0436] A total of 386 peptides from Her2 were identified from both Her2 alone and Her2 in complex with Parental Ab3 samples, representing 99.8% sequence coverage of Her2. Any peptide that exhibited greater than 5% decrease in percentage of deuterium uptake was defined as significantly protected (? % D<?5%). Her2 ECD showed significant reduction in deuterium uptakes upon binding to Parental Ab3 at sequences AA133-148, IQRNPQLCYQDTILWK (SEQ ID NO: 61), and AA174-182, SPMCKGSRC (SEQ ID NO: 62), which were assigned as the epitope on human Her2 ECD targeted by Parental Ab3. In addition, human Her2 ECD showed a modest reduction in deuterium uptakes upon binding to Parental Ab3 at sequence AA194-200, TRTVCAG (SEQ ID NO: 63). The deuterium uptake data for peptides covering epitope regions I (AA133-148, IQRNPQLCYQDTILWK, SEQ ID NO: 61) and II (AA174-182, SPMCKGSRC, SEQ ID NO: 62), and the peripheral epitope region III (AA194-200, TRTVCAG, SEQ ID NO: 63) are shown in
[0437] A total of 385 peptides from Her2 were identified from both Her2 alone and Her2 in complex with Parental Ab4 samples, representing 99.7% sequence coverage of Her2. Any peptide that exhibited greater than 5% decrease in percentage of deuterium uptake was defined as significantly protected (? % D<?5%). Her2 ECD showed significant reduction in deuterium uptakes upon binding to Parental Ab4 at sequences AA152-161, HKNNQLALTL (SEQ ID NO: 64), which was the assigned as the main epitope on human Her2 ECD targeted by Parental Ab4. In addition, human Her2 ECD showed modest reduction in deuterium uptakes upon binding to Parental Ab4 at sequences AA194-200, TRTVCAG (SEQ ID NO: 63), and AA258-273, ESMPNPEGRYTFGASC (SEQ ID NO: 65). The deuterium uptake data for peptides covering epitope region I (AA152-161, HKNNQLALTL, SEQ ID NO: 64), the peripheral epitope region II (AA194-200, TRTVCAG, SEQ ID NO: 63), as well as the region III (AA258-273, ESMPNPEGRYTFGASC, SEQ ID NO: 65) with detected deuterium reduction are shown in
[0438] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and the accompanying figures. Such modifications are intended to fall within the scope of the appended claims.
TABLE-US-00025 TABLE25 InformalSequenceListing SEQ IDNO. Sequence Description 1. gaggtgcagctggtggagtctgggggaggcttggcacagcctggggggtccctgagactc DNA tcctgtgcagcctctggattctccatcagtgactacgaaatacactgggtccgccaagtt nucleotide ccaggaaaaggtctggagtgggtctctggtattggttctgctggtaacacatattatcca sequence ggcgccgtgaagggccgattcaccatctccagagaaaatgccaagaactccttgtatctt caagtgaacagcctgacagtcggggacacggctgtctattattgtgcaagggtctggtcc cctctttattacttcggtttggacgtctggggccaagggaccacggtcaccgtctcctca 2. EVQLVESGGGLAQPGGSLRLSCAASGFSISDYEIHWVRQVPGKGLEWVSGIGSAGNTYYP AAamino GAVKGRFTISRENAKNSLYLQVNSLTVGDTAVYYCARVWSPLYYFGLDVWGQGTTVTVSS acid sequence 3. ggattctccatcagtgactacgaa DNA Nucleotide sequence 4. GFSISDYE AAamino acid sequence 5. attggttctgctggtaacaca DNA nucleotide sequence 6. IGSAGNT AAamino acid sequence 7. gcaagggtctggtcccctctttattacttcggtttggacgtc DNA nucleotide sequence 8. ARVWSPLYYFGLDV AAamino acid sequence 9. gaagtgcagctggtggagtctgggggagacttggtacagcctggcaggtccctgagactc DNA tcctgtgcagcctctggattcacttttgatgaatatgccatgcactgggtccggcaagct nucleotide ccagggaagggcctggagtgggtctcacatattagttggaatagtcatcacatagcctat sequence gcggactctgtgaagggccgattcaccatctccagagacaacgccaggaactccctatat ctgcaaatgaatagtctgagacctgaggacacggccttgtatttctgtgtaaaagattgg ggattgggagcaagcgggggctactactacgttttggacgtctggggccaagggaccacg gtcaccgtctcctca 10. EVQLVESGGDLVQPGRSLRLSCAASGFTFDEYAMHWVRQAPGKGLEWVSHISWNSHHIAY AAamino ADSVKGRFTISRDNARNSLYLQMNSLRPEDTALYFCVKDWGLGASGGYYYVLDVWGQGTT acid VTVSS sequence 11. ggattcacttttgatgaatatgcc DNA nucleotide sequence 12. GFTFDEYA AAamino acid sequence 13. attagttggaatagtcatcacata DNA nucleotide sequence 14. ISWNSHHI AAamino acid sequence 15. gtaaaagattggggattgggagcaagcgggggctactactacgttttggacgtc DNA nucleotide sequence 16. VKDWGLGASGGYYYVLDV AAamino acid sequence 17. gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc DNA atcacttgccgggcaagtcagagcattagcagctatttaaattggtatcagcagaaacca nucleotide gggaaagcccctaagctcctgatctatgctgcatccagtttgcaaagtggggtcccgtca sequence aggttcagtggcagtggatctgggacagatttcactctcaccatcagcagtctgcaacct gaagattttgcaacttactactgtcaacagagttacagtacccctccgatcaccttcggc caagggacacgactggagattaaa 18. DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS AAamino RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPITFGQGTRLEIK acid sequence 19. cagagcattagcagctat DNA nucleotide sequence 20. QSISSY AAamino acid sequence 21. gctgcatcc DNA nucleotide sequence 22. AAS AAamino acid sequence 23. caacagagttacagtacccctccgatcacc DNA nucleotide sequence 24. QQSYSTPPIT AAamino acid sequence 25. gaggtgcagctggtggagtctgggggaggcttggcacagcctggggggtccctgagactc DNA tcctgtgcagcctctggattctccatcagtgactacgaaatacactgggtccgccaagtt nucleotide ccaggaaaaggtctggagtgggtctctggtattggttctgctggtaacacatattatcca sequence ggcgccgtgaagggccgattcaccatctccagagaaaatgccaagaactecttgtatott caagtgaacagcctgacagtcggggacacggctgtctattattgtgcaagggtctggtcc cctctttattacttcggtttggacgtctggggccaagggaccacggtcaccgtctcctca gccagcacaaaaggtcctagcgtttttccacttgccccatgttcaaggtcaacctccgaa agtaccgccgctcttggctgtctcgtaaaagattattttcccgaacctgtaactgtctcc tggaactccggcgcactcacttccggcgtacataccttccccgctgtcctccaatcttcc ggtctctactccctgtcttctgttgtcactgttccatcatcctcactcggcacaaaaaca tatacctgcaacgttgatcacaagccaagtaataccaaagttgataagcgcgtcgaatcc aaatacggtcccccctgccccccatgtcccgctccagagtttctcggtggcccctctgtt ttcctttttccccctaaacccaaagataccctcatgatttccagaacccccgaggtcacc tgcgtcgtcgttgatgtaagccaagaagatcccgaagtccagttcaattggtatgtagac ggtgttgaagtccataatgcaaaaacaaaacccagagaggaacagtttaattcaacctat cgtgtcgttagcgtactcaccgttcttcatcaagactggctcaatggaaaagaatataaa tgtaaagttagcaacaaaggtctgcccagttcaatcgaaaaaacaattagcaaagccaaa ggccaacctcgcgaaccccaagtctataccttgcccccttctcaggaagaaatgaccaaa aaccaagtttcactcacatgcctcgtaaaaggattctatccatcagacattgcagtagaa tgggaatctaacggccaacctgaaaataattacaaaaccactcctcctgtcctcgattct gacggctcttttttcctttactccagattgactgttgataaatcccgctggcaggaaggt aacgttttttcttgttctgtgatgcacgaagccctccataacagattcactcaaaaatct ctttctctctcccctggcaaataa 26. EVQLVESGGGLAQPGGSLRLSCAASGFSISDYEIHWVRQVPGKGLEWVSGIGSAGNTYYP AAamino GAVKGRFTISRENAKNSLYLQVNSLTVGDTAVYYCARVWSPLYYFGLDVWGQGTTVTVSS acid ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS sequence GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNRFTQKSLSLSPGK 27. gaagtgcagctggtggagtctgggggagacttggtacagcctggcaggtccctgagactc DNA tcctgtgcagcctctggattcacttttgatgaatatgccatgcactgggtccggcaagct nucleotide ccagggaagggcctggagtgggtctcacatattagttggaatagtcatcacatagcctat sequence gcggactctgtgaagggccgattcaccatctccagagacaacgccaggaactccctatat ctgcaaatgaatagtctgagacctgaggacacggccttgtatttctgtgtaaaagattgg ggattgggagcaagcgggggctactccctcgttttggacgtctggggccaagggaccacg gtcaccgtctcctcagcctccaccaagggcccatcggtcttccccctggcgccctgctcc aggagcacctccgagagcacagccgccctgggctgcctggtcaaggactacttccccgaa ccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggct gtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagc ttgggcacgaagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggac aagagagttgagtccaaatatggtcccccatgcccaccctgcccagcacctgagttcctg gggggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccgg acccctgaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagttc aactggtacgtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggagcag ttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaac ggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccatcgagaaaacc atctccaaagccaaagggcagccccgagagccacaggtgtacaccctgcccccatcccag gaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctaccccagc gacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcct cccgtgctggactccgacggctccttcttcctctacagcaggctcaccgtggacaagagc aggtggcaggaggggaatgtcttctcatgctccgtgatgcatgaggctctgcacaaccac tacacacagaagtccctctccctgtctctgggtaaatga 28. EVQLVESGGDLVQPGRSLRLSCAASGFTFDEYAMHWVRQAPGKGLEWVSHISWNSHHIAY AAamino ADSVKGRFTISRDNARNSLYLQMNSLRPEDTALYFCVKDWGLGASGGYYYVLDVWGQGTT acid VTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA sequence VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQ EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKS RWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 29. gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcacc DNA atcacttgccgggcaagtcagagcattagcagctatttaaattggtatcagcagaaacca nucleotide gggaaagcccctaagctcctgatctatgctgcatccagtttgcaaagtggggtcccgtca sequence aggttcagtggcagtggatctgggacagatttcactctcaccatcagcagtctgcaacct gaagattttgcaacttactactgtcaacagagttacagtacccctccgatcaccttcggc caagggacacgactggagattaaacgaactgtggctgcaccatctgtcttcatcttcccg ccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttc tatcccagagaggccaaagtacagtggaaggtggataacgccctccaatcgggtaactcc caggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctg acgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcag ggcctgagctcgcccgtcacaaagagcttcaacaggggagagtgttag 30. DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS AAamino RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPITFGQGTRLEIKRTVAAPSVFIFP acid PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL sequence TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 31. caggtgcagctggtggagtctgggggcggcgtggtccagcctgggaggtccctgagactc DNA tcctgtgaagcctctggcttcaccttcagtggctatgccctacactgggtccgccaggct nucleotide ccaggcaaggggctggagtgggtgacagttatatcatatgatggaagtgataaattctat sequence gcagactccgtgaagggccgattcaccatctccagagacaattccaagaacacgctgtac ctgcaaatgaacagcctgagaactgaggacacggctctgtattactgtgcgaaagattgg gggacatatcactggaactacggccactacaattatgttatggacgtctggggccaaggg accacggtcaccgtctcctca 32. QVQLVESGGGVVQPGRSLRLSCEASGFTFSGYALHWVRQAPGKGLEWVTVISYDGSDKFY AAamino ADSVKGRFTISRDNSKNTLYLQMNSLRTEDTALYYCAKDWGTHWNYGHYNYVMDVWGQG acid TTVTVSS sequence 33. ggcttcaccttcagtggctatgcc DNA nucleotide sequence 34. GFTFSGYA AAamino acid sequence 35. atatcatatgatggaagtgataaa DNA nucleotide sequence 36. ISYDGSDK AAamino acid sequence 37. gcgaaagattgggggacatatcactggaactacggccactacaattatgttatggacgtc DNA nucleotide sequence 38. AKDWGTYHWNYGHYNYVMDV AAamino acid sequence 39. caggtgcagctggtggagtctgggggaggcttggtcaagcctggcgggtccctgagactc DNA tcctgcgcagcctctggattcaccttcagtgactactacatgagctggatccgtcaggct nucleotide ccagggaagggactggaatggatttcatacattagcgacaatcgtgataccgtatactac sequence gcagactctgtgaagggccgattcaccatctccagggacaacgcccagagtatactatat ttgcaactgagaagcctgagagccgaggacacggccatatattattgtgcgagagtggca tacggtgctaattcacggttttactttccctactggggccagggaaccctggtcaccgtc tcctca 40. QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWISYISDNRDTVYY AAamino ADSVKGRFTISRDNAQSILYLQLRSLRAEDTAIYYCARVAYGANSRFYFPYWGQGTLVTV acid SS sequence 41. ggattcaccttcagtgactactac DNA nucleotide sequence 42. GFTFSDYY AAamino acid sequence 43. attagcgacaatcgtgataccgta DNA nucleotide sequence 44. ISDNRDTV AAamino acid sequence 45. gcgagagtggcatacggtgctaattcacggttttactttccctac DNA nucleotide sequence 46. ARVAYGANSRFYFPY AAamino acid sequence 47. caggtgcagctggtggagtctgggggcggcgtggtccagcctgggaggtccctgagactc DNA tcctgtgaagcctctggcttcaccttcagtggctatgccctacactgggtccgccaggct nucleotide ccaggcaaggggctggagtgggtgacagttatatcatatgatggaagtgataaattctat sequence gcagactccgtgaagggccgattcaccatctccagagacaattccaagaacacgctgtac ctgcaaatgaacagcctgagaactgaggacacggctctgtattactgtgcgaaagattgg gggacatatcactggaactacggccactacaattatgttatggacgtctggggccaaggg accacggtcaccgtctcctcagccagcacaaaaggtcctagcgtttttccacttgcccca tgttcaaggtcaacctccgaaagtaccgccgctcttggctgtctcgtaaaagattatttt tgttcaaggtcaacctccgaaagtaccgccgctcttggctgtctcgtaaaagattatttt cccgaacctgtaactgtctcctggaactccggcgcactcacttccggcgtacataccttc cccgctgtcctccaatcttccggtctctactccctgtottctgttgtcactgttccatca tcctcactcggcacaaaaacatatacctgcaacgttgatcacaagccaagtaataccaaa gttgataagcgcgtcgaatccaaatacggtcccccctgccccccatgtcccgctccagag tttctcggtggcccctctgttttcctttttccccctaaacccaaagataccctcatgatt tccagaacccccgaggtcacctgcgtcgtcgttgatgtaagccaagaagatcccgaagtc cagttcaattggtatgtagacggtgttgaagtccataatgcaaaaacaaaacccagagag gaacagtttaattcaacctatcgtgtcgttagcgtactcaccgttcttcatcaagactgg ctcaatggaaaagaatataaatgtaaagttagcaacaaaggtctgcccagttcaatcgaa aaaacaattagcaaagccaaaggccaacctcgcgaaccccaagtctataccttgccccct tctcaggaagaaatgaccaaaaaccaagtttcactcacatgcctcgtaaaaggattctat ccatcagacattgcagtagaatgggaatctaacggccaacctgaaaataattacaaaacc actcctcctgtcctcgattctgacggctcttttttcctttactccagattgactgttgat aaatcccgctggcaggaaggtaacgttttttcttgttctgtgatgcacgaagccctccat aacagattcactcaaaaatctctttctctctcccctggcaaataa 48. QVQLVESGGGVVQPGRSLRLSCEASGFTFSGYALHWVRQAPGKGLEWVTVISYDGSDKFY AAamino ADSVKGRFTISRDNSKNTLYLQMNSLRTEDTALYYCAKDWGTYHWNYGHYNYVMDVWGQG acid TTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF sequence PAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPE FLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPP SQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNRFTQKSLSLSPGK 49. caggtgcagctggtggagtctgggggaggcttggtcaagcctggcgggtccctgagactc DNA tcctgcgcagcctctggattcaccttcagtgactactacatgagctggatccgtcaggct nucleotide ccagggaagggactggaatggatttcatacattagcgacaatcgtgataccgtatactac sequence gcagactctgtgaagggccgattcaccatctccagggacaacgcccagagtatactatat ttgcaactgagaagcctgagagccgaggacacggccatatattattgtgcgagagtggca tacggtgctaattcacggttttactttccctactggggccagggaaccctggtcaccgtc tcctcagcctccaccaagggcccatcggtcttccccctggcgccctgctccaggagcacc tccgagagcacagccgccctgggctgcctggtcaaggactacttccccgaaccggtgacg gtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggcacg aagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagagagtt gagtccaaatatggtcccccatgcccaccctgcccagcacctgagttcctggggggacca tcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccggacccctgag gtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagttcaactggtac gtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagttcaacagc acgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaacggcaaggag tacaagtgcaaggtctccaacaaaggcctcccgtcctccatcgagaaaaccatctccaaa gccaaagggcagccccgagagccacaggtgtacaccctgcccccatcccaggaggagatg accaagaaccaggtcagcctgacctgcctggtcaaaggettctaccccagcgacatcgcc gtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctg gactccgacggctccttcttcctctacagcaggctcaccgtggacaagagcaggtggcag gaggggaatgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacacag aagtccctctccctgtctctgggtaaatga 50. VQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWISYISDNRDTVYYA AAamino DSVKGRFTISRDNAQSILYLQLRSLRAEDTAIYYCARVAYGANSRFYFPYWGQGTLVTVS acid SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS sequence SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST YRVVSVLTVLHQDWINGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE GNVFSCSVMHEALHNHYTQKSLSLSLGK 51. TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQG AAamino YVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQL acid RSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGS sequence RCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSG ICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEV TAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFD GDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYS LTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPED ECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLP CHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGA CQPCPINCTHSCVDLDDKGCPAEQRASPLTEPRGPTIKPCPPCKCPAPNLLGGPSVFIFP PKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVS ALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVT LTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYS CSVVHEGLHNHHTTKSFSRTPGK 52. DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS AAamino RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGG acid GSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYP sequence TNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQG TLVTVSSGGGGSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR GGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKR VEPKSCDKTHTCPPCPAPEFLGGPCVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLCLSPGK 53. DIVMTQTPLSLSVTPGQPASISCKSSQSVFFRSNNKNILAWYLQKPGQPPQLLIYWASSR AAamino ESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQYFGSPFTFGPGTKVDIKRTVAAPS acid VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS sequence LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 54. TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQG AAamino YVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQL acid RSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGS sequence RCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSG ICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEV TAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESED GDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYS LTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPED ECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLP CHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGA CQPCPINCTHSCVDLDDKGCPAEQRASPLTEQKLISEEDLGGEQKLISEEDLHHHHHH 55. YQDTI AAamino acid sequence 56. RSRACHPCSPMCKGSRC AAamino acid sequence 57. MKLRLPASPETHLDM AAamino acid sequence 58. TYLPTNASLSF AAamino acid sequence 59. IAHNQVRQVPLQRL AAamino acid sequence 60. AFLPESF AAamino acid sequence 61. IQRNPQLCYQDTILWK AAamino acid sequence 62. SPMCKGSRC AAamino acid sequence 63. TRTVCAG AAamino acid sequence 64 HKNNQLALTL AAamino acid sequence 65. ESMPNPEGRYTFGASC AAamino acid sequence